1JM7B

Solution structure of the brca1/bard1 ring-domain heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
MEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor
molecule keywords BREAST CANCER TYPE 1 SUSCEPTIBILITY PROTEIN
publication title Structure of a BRCA1-BARD1 heterodimeric RING-RING complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 97
sequence length 97
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14835 zf-RING_6 zf-RING of BARD1-type protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1jm7B00
2K4DA 2M85A 2C2VS 4LADB 4AYCB 4A4BA 2EGPA 4LKAA 1WESA 4BHWA 1T1HA 4ZQLA 2NAAA 5DKAA 1V87A 2ECJA 2YURA 4S3OC 5JG6A 4O64A 3VK6A 1X4UA 3HCTA 3U5OA 4BBQA 3PUQA 3SOUA 4AP4A 2YQLA 1WEQA 3HTKC 2FSAA 2YQMA 3O36A 4LJNA 2ECVA 4GNFA 1F62A 4A4CA 4FIPA 2D8SA 4S3OB 3N9PA 3IHPA 4B86C 3O70A 4UP0A 3PHDA 5H1VA 2BAYA 2RSDA 2KWKA 2QJ0A 5H1UA 2MT5A 5G04B 5LKZA 5TBNA 2F6NA 2LQ6A 3I2DA 4PTBA 1LDKC 4IC3A 1WEVA 2KWOA 2EA6A 2ECWA 3C6WA 4UI9B 2VPEA 5H9MA 4QF3A 2ECNA 4N3WA 5KH7A 2JMIA 4FJCA 4WA6A 3O34A 2CSYA 1WFKA 4YADA 2YSMA 1LDJB 1RMDA 2C2LA 3U5NA 5EYAF 3N9MA 1CHCA 3LQJA 2Y1NA 5B76A 4ZDTA 1VYXA 4IC2A 4WZ3B 1IYMA 2KE1A 3V43A 2K16A 2LDRA 3SHBA 5LKXA 1XWHA 4GB0A 2E6SA 2KGGA 2VPDA 4WZ2A 2AN6A 1WILA 5FB0A 1WENA 2LN0A 3C5KA 2G43A 4QF2A 1WGMA 3N9LA 4PPEA 4AVXA 5TDRA 5B78A 1WE9A 4AUQB 2DX8A 3SOXA 3KQIA 4MVTA 3ZPV1 4GNEA 2M3HA 2RI7A 5FERA 5H1TA 2I50A 3DPLR 3MHHA 1JM7A 2JMDA 5I3LA 2G6QA 3KNVA 2YSJA 2K17A 3GV4A 4YBMA 2MNYA 2H0DA 1FBVA 4YAXA 2YYRA 2FUUA 2UZGA 2L80A 2L0BA 1VD4A 3EB5A 3ZVZB 4I7BA 5TABA 2ECIA 3M63A 1DVPA 2LGGA 1WIMA 4YBSA 3ASLA 3U5MA 5LKUA 2LGVA 2Y43A 5B75A 2KWJA 1JM7B 5D1MB 5AIUA 4N4FA 2YT5A 5C13A 2ECGA 2YUCA 2KREA 3EB6A 1N87A 3SOWA 2M6MA 5AITA 3ZYQA 2VJEA 4I7DA 4R7EA 3RTRB 4NN2A 4YABA 4Q6FA 1WEWA 4GNGA 2IDAA 5TDWA 4TKPB 3LQIA 4GNDA 1FP0A 2HDPA 3U5PA 2QICA 2XB1A 3ZPVE 5G0FA 4X3GA 1MM3A 4CCGX 4A0CD 4I7CA 5FEYA 1Z60A 2L75A 3ZVYA 1ZBDB 4UP5A 2LXHC 2F42A 1HYJA 5J3XA 2KGIA 2PNXA 1X4JA 5DINA 2KFTA 3NG2A 4P5OB 4R8PK 2PUYA 3DQVR 2MIQA 5KH9A 3O33A 2VJFA 3ZNIA 2VP7A 4MSXA 2Y1MA 2OXQC 4R2YA 1K2FA 1WEEA 2E6RA 3QZVA 3PURA 2HYED 2MD8C 3KV5A 4F52B 3N9NA 3FL2A 4ZUXU 2MA5A 1HYIA 4FK5A 2F6JA 2CT2A 4L58A 3T6RA 4WZ0A 2QIZA 1WEUA 2LGLA 5FB1A 2VJFB 1U6GB 4B7YC 1JOCA 3N9QA 2MD7B 3O7AA 2LGKA 2YHOA 3HCSA 3ZTGA 2L43A 2YU4A 1Z2QA 1WEPA 3MHSA 3O37A 2KYUA 2YREA 5TRBA 4YBTA 2H0DB 2JRJA 5B79A 5LKTA 2M1RA 3L11A 2KWNA 5KH3A 3GL6A 1WEOA 4V3LC 2ECTA 2KR4A 1Z6UA 2VPBA 2MA6A 4L7XA 2FUIA 3RPGC 1G25A 3M62A 2LXPC 3O35A 4XI1A 2MUMA 2MNZA 1BORA 2CKLA 5G05B 4CA1A 4YC9A 2EODA 1E4UA 2KU3A 2KIZA 4FO9A 5LCWB 4YATA 1WEMA 3RPGB 4A49A 4V3KC 1MM2A 3L1ZB 3KV6A 5B8DA 3LRQA 4AYCA 3T7LA 2XEUA 3M99A 4LLBA 2VJEB 2YW8A 5D1KB 2YHNA 2K1JA 2L5UA 2ZETC 2CKLB 3LQHA 3L1XA 5B77A 5C11A 2CSZA 2LRIC 4LK9A 2VNFA 3HCUA 3N9OA 5D1LB 2LV9A 4W4UA 1X4IA 2JMJA 4C9ZA 2G45A 2VPGA 1VFYA
chains in the Genus database with same CATH superfamily
2K4DA 2M85A 3T9KA 2C2VS 4LADB 4AYCB 4A4BA 2EGPA 2JM3A 4LKAA 1WESA 4Z0OA 4BHWA 1T1HA 4ZQLA 5SVXA 2NAAA 5DKAA 1V87A 2ECJA 2YURA 4S3OC 3M7KA 5JG6A 4O64A 3VK6A 1X4UA 3HCTA 3U5OA 4BBQA 3PUQA 2P57A 3SOUA 4AP4A 2YQLA 3H7HA 1WEQA 3O47A 3HTKC 2FSAA 2YQMA 3O36A 4LJNA 2ECVA 4GNFA 1F62A 4A4CA 4FIPA 2D8SA 4S3OB 3N9PA 3IHPA 2EGMA 4B86C 3O70A 4UP0A 2XP0A 3PHDA 5H1VA 2BAYA 2XOCA 2RSDA 2KWKA 2QJ0A 5H1UA 2MT5A 5G04B 4QQ4A 5LKZA 5TBNA 2F6NA 2LQ6A 3I2DA 4PTBA 1LDKC 4IC3A 3MDBC 1WEVA 2JUNA 2KWOA 2EA6A 2ECWA 3C6WA 2KKXA 4UI9B 2VPEA 4O62A 5H9MA 4QF3A 2ECNA 2L7PA 4N3WA 5KH7A 2JMIA 4FJCA 4WA6A 3O34A 2CSYA 1WFKA 4YADA 2YSMA 1LDJB 1RMDA 2C2LA 3U5NA 5EYAF 3N9MA 1CHCA 3KDEC 3LQJA 2Y1NA 5B76A 4ZDTA 1VYXA 4IC2A 4WZ3B 1IYMA 2KE1A 3V43A 2K16A 2LDRA 3SHBA 5LKXA 1XWHA 4GB0A 3PLWA 2E6SA 2KGGA 2VPDA 4WZ2A 1MBMA 2AN6A 3DWDA 1WILA 5FB0A 1WENA 3SUBA 2LN0A 3C5KA 2G43A 4QF2A 1WGMA 3N9LA 4PPEA 4AVXA 5TDRA 5B78A 1WE9A 4AUQB 2DX8A 3SOXA 3E2DA 3KQIA 4MVTA 3ZPV1 4GNEA 2M3HA 2RI7A 5FERA 5H1TA 2I50A 3DPLR 3MHHA 1JM7A 2JMDA 5SVIA 5I3LA 4H9DA 2G6QA 3KNVA 2YSJA 2K17A 3GV4A 4YBMA 2MNYA 2H0DA 1FBVA 4YAXA 2YYRA 2FUUA 2FD4A 2UZGA 2L80A 1DCQA 2L0BA 1VD4A 3EB5A 3ZVZB 4I7BA 5TABA 2ECIA 3FM8C 3M63A 1DVPA 2LGGA 1WIMA 2OWAA 4YBSA 3ASLA 3U5MA 5LKUA 2LGVA 2Y43A 5B75A 2KWJA 1JM7B 5SVIB 2CSVA 5D1MB 5AIUA 4N4FA 2YT5A 2DSMA 3Q1DA 5C13A 2ECGA 5SVYA 2YUCA 2KREA 3EB6A 3LVQE 1N87A 2MKEA 2M6MA 2XOZA 3SOWA 5AITA 3ZYQA 3FEHA 2CRWA 2VJEA 4I7DA 4R7EA 3RTRB 4NN2A 4YABA 5K3QA 4Q6FA 1WEWA 4GNGA 2IDAA 5TDWA 2IQJA 4TKPB 3LQIA 4GNDA 1FP0A 2HDPA 3U5PA 2QICA 2XB1A 3ZPVE 5G0FA 4X3GA 1MM3A 2XOYA 4CCGX 4A0CD 4I7CA 5FEYA 1Z60A 2L75A 2CRRA 3ZVYA 1ZBDB 4UP5A 2LXHC 2F42A 1HYJA 5J3XA 2KGIA 3LDYA 2PNXA 1X4JA 5DINA 2KFTA 3NG2A 4P5OB 4R8PK 2PUYA 3DQVR 2MIQA 5KH9A 2EXUA 3O33A 2VJFA 3ZNIA 3FJUB 4OGCA 2VP7A 4MSXA 2Y1MA 2OXQC 4R2YA 1K2FA 1WEEA 2E6RA 3QZVA 3LVRE 3PURA 2HYED 2MD8C 3KV5A 4F52B 4Z0RA 3JUEA 3N9NA 3FL2A 4ZUXU 2MA5A 1HYIA 2E61A 4FK5A 2F6JA 2CT2A 4L58A 3T6RA 4F1PA 4WZ0A 2QIZA 1WEUA 2LGLA 5FB1A 2VJFB 1U6GB 4B7YC 1JOCA 2CONA 3N9QA 2RR4A 2MD7B 3O7AA 2LGKA 2YHOA 3HCSA 2KKYA 3ZTGA 2L43A 2YU4A 1Z2QA 2D8UA 3DDTA 1WEPA 3MHSA 3O37A 2KYUA 2YREA 5TRBA 4YBTA 2H0DB 2JRJA 5B79A 5LKTA 2M1RA 3L11A 2KWNA 5KH3A 2M13A 3GL6A 1WEOA 4V3LC 2ECTA 2KR4A 3FANA 1Z6UA 2VPBA 2MA6A 4L7XA 2DJAA 2FUIA 3RPGC 2B0OE 1G25A 3M62A 2LXPC 3O35A 4XI1A 2MUMA 2MNZA 1BORA 2CKLA 5G05B 4CA1A 4YC9A 2EODA 1E4UA 2KU3A 2KIZA 4OGEA 4FO9A 5LCWB 4YATA 1WEMA 3RPGB 4A49A 3LJUX 4V3KC 1MM2A 3L1ZB 3KV6A 5B8DA 3LRQA 3FAOA 4AYCA 3T7LA 2XEUA 3M99A 4LLBA 2FFWA 2YVRA 2VJEB 2YW8A 5D1KB 2YHNA 2K1JA 2LAUA 2L5UA 2ZETC 2CKLB 3LQHA 3L1XA 5B77A 5C11A 2CSZA 2LRIC 4LK9A 2VNFA 3HCUA 3N9OA 5D1LB 2LV9A 4W4UA 1X4IA 2JMJA 4C9ZA 2G45A 2VPGA 1VFYA
chains in the Genus database with same CATH topology
2K4DA 2M85A 2C2VS 4LADB 4AYCB 4A4BA 2EGPA 4LKAA 1WESA 4BHWA 1T1HA 4ZQLA 2NAAA 5DKAA 1V87A 2ECJA 2YURA 4S3OC 5JG6A 4O64A 3VK6A 1X4UA 3HCTA 3U5OA 4BBQA 3PUQA 3SOUA 4AP4A 2YQLA 1WEQA 3HTKC 2FSAA 2YQMA 3O36A 4LJNA 2ECVA 4GNFA 1F62A 4A4CA 4FIPA 2D8SA 4S3OB 3N9PA 3IHPA 4B86C 3O70A 4UP0A 3PHDA 5H1VA 2BAYA 2RSDA 2KWKA 2QJ0A 5H1UA 2MT5A 5G04B 5LKZA 5TBNA 2F6NA 2LQ6A 3I2DA 4PTBA 1LDKC 4IC3A 1WEVA 2KWOA 2EA6A 2ECWA 3C6WA 4UI9B 2VPEA 5H9MA 4QF3A 2ECNA 4N3WA 5KH7A 2JMIA 4FJCA 4WA6A 3O34A 2CSYA 1WFKA 4YADA 2YSMA 1LDJB 1RMDA 2C2LA 3U5NA 5EYAF 3N9MA 1CHCA 3LQJA 2Y1NA 5B76A 4ZDTA 1VYXA 4IC2A 4WZ3B 1IYMA 2KE1A 3V43A 2K16A 2LDRA 3SHBA 5LKXA 1XWHA 4GB0A 2E6SA 2KGGA 2VPDA 4WZ2A 2AN6A 1WILA 5FB0A 1WENA 2LN0A 3C5KA 2G43A 4QF2A 1WGMA 3N9LA 4PPEA 4AVXA 5TDRA 5B78A 1WE9A 4AUQB 2DX8A 3SOXA 3KQIA 4MVTA 3ZPV1 4GNEA 2M3HA 2RI7A 5FERA 5H1TA 2I50A 3DPLR 3MHHA 1JM7A 2JMDA 5I3LA 2G6QA 3KNVA 2YSJA 2K17A 3GV4A 4YBMA 2MNYA 2H0DA 1FBVA 4YAXA 2YYRA 2FUUA 2UZGA 2L80A 2L0BA 1VD4A 3EB5A 3ZVZB 4I7BA 5TABA 2ECIA 3M63A 1DVPA 2LGGA 1WIMA 4YBSA 3ASLA 3U5MA 5LKUA 2LGVA 2Y43A 5B75A 2KWJA 1JM7B 5D1MB 5AIUA 4N4FA 2YT5A 5C13A 2ECGA 2YUCA 2KREA 3EB6A 1N87A 3SOWA 2M6MA 5AITA 3ZYQA 2VJEA 4I7DA 4R7EA 3RTRB 4NN2A 4YABA 4Q6FA 1WEWA 4GNGA 2IDAA 5TDWA 4TKPB 3LQIA 4GNDA 1FP0A 2HDPA 3U5PA 2QICA 2XB1A 3ZPVE 5G0FA 4X3GA 1MM3A 4CCGX 4A0CD 4I7CA 5FEYA 1Z60A 2L75A 3ZVYA 1ZBDB 4UP5A 2LXHC 2F42A 1HYJA 5J3XA 2KGIA 2PNXA 1X4JA 5DINA 2KFTA 3NG2A 4P5OB 4R8PK 2PUYA 3DQVR 2MIQA 5KH9A 3O33A 2VJFA 3ZNIA 2VP7A 4MSXA 2Y1MA 2OXQC 4R2YA 1K2FA 1WEEA 2E6RA 3QZVA 3PURA 2HYED 2MD8C 3KV5A 4F52B 3N9NA 3FL2A 4ZUXU 2MA5A 1HYIA 4FK5A 2F6JA 2CT2A 4L58A 3T6RA 4WZ0A 2QIZA 1WEUA 2LGLA 5FB1A 2VJFB 1U6GB 4B7YC 1JOCA 3N9QA 2MD7B 3O7AA 2LGKA 2YHOA 3HCSA 3ZTGA 2L43A 2YU4A 1Z2QA 1WEPA 3MHSA 3O37A 2KYUA 2YREA 5TRBA 4YBTA 2H0DB 2JRJA 5B79A 5LKTA 2M1RA 3L11A 2KWNA 5KH3A 3GL6A 1WEOA 4V3LC 2ECTA 2KR4A 1Z6UA 2VPBA 2MA6A 4L7XA 2FUIA 3RPGC 1G25A 3M62A 2LXPC 3O35A 4XI1A 2MUMA 2MNZA 1BORA 2CKLA 5G05B 4CA1A 4YC9A 2EODA 1E4UA 2KU3A 2KIZA 4FO9A 5LCWB 4YATA 1WEMA 3RPGB 4A49A 4V3KC 1MM2A 3L1ZB 3KV6A 5B8DA 3LRQA 4AYCA 3T7LA 2XEUA 3M99A 4LLBA 2VJEB 2YW8A 5D1KB 2YHNA 2K1JA 2L5UA 2ZETC 2CKLB 3LQHA 3L1XA 5B77A 5C11A 2CSZA 2LRIC 4LK9A 2VNFA 3HCUA 3N9OA 5D1LB 2LV9A 4W4UA 1X4IA 2JMJA 4C9ZA 2G45A 2VPGA 1VFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4D A;  2M85 A;  2C2V S;  4LAD B;  4AYC B;  4A4B A;  2EGP A;  4LKA A;  1WES A;  4BHW A;  1T1H A;  4ZQL A;  2NAA A;  5DKA A;  1V87 A;  2ECJ A;  2YUR A;  4S3O C;  5JG6 A;  4O64 A;  3VK6 A;  1X4U A;  3HCT A;  3U5O A;  4BBQ A;  3PUQ A;  3SOU A;  4AP4 A;  2YQL A;  1WEQ A;  3HTK C;  2FSA A;  2YQM A;  3O36 A;  4LJN A;  2ECV A;  4GNF A;  1F62 A;  4A4C A;  4FIP A;  2D8S A;  4S3O B;  3N9P A;  3IHP A;  4B86 C;  3O70 A;  4UP0 A;  3PHD A;  5H1V A;  2BAY A;  2RSD A;  2KWK A;  2QJ0 A;  5H1U A;  2MT5 A;  5G04 B;  5LKZ A;  5TBN A;  2F6N A;  2LQ6 A;  3I2D A;  4PTB A;  1LDK C;  4IC3 A;  1WEV A;  2KWO A;  2EA6 A;  2ECW A;  3C6W A;  4UI9 B;  2VPE A;  5H9M A;  4QF3 A;  2ECN A;  4N3W A;  5KH7 A;  2JMI A;  4FJC A;  4WA6 A;  3O34 A;  2CSY A;  1WFK A;  4YAD A;  2YSM A;  1LDJ B;  1RMD A;  2C2L A;  3U5N A;  5EYA F;  3N9M A;  1CHC A;  3LQJ A;  2Y1N A;  5B76 A;  4ZDT A;  1VYX A;  4IC2 A;  4WZ3 B;  1IYM A;  2KE1 A;  3V43 A;  2K16 A;  2LDR A;  3SHB A;  5LKX A;  1XWH A;  4GB0 A;  2E6S A;  2KGG A;  2VPD A;  4WZ2 A;  2AN6 A;  1WIL A;  5FB0 A;  1WEN A;  2LN0 A;  3C5K A;  2G43 A;  4QF2 A;  1WGM A;  3N9L A;  4PPE A;  4AVX A;  5TDR A;  5B78 A;  1WE9 A;  4AUQ B;  2DX8 A;  3SOX A;  3KQI A;  4MVT A;  3ZPV 1;  4GNE A;  2M3H A;  2RI7 A;  5FER A;  5H1T A;  2I50 A;  3DPL R;  3MHH A;  1JM7 A;  2JMD A;  5I3L A;  2G6Q A;  3KNV A;  2YSJ A;  2K17 A;  3GV4 A;  4YBM A;  2MNY A;  2H0D A;  1FBV A;  4YAX A;  2YYR A;  2FUU A;  2UZG A;  2L80 A;  2L0B A;  1VD4 A;  3EB5 A;  3ZVZ B;  4I7B A;  5TAB A;  2ECI A;  3M63 A;  1DVP A;  2LGG A;  1WIM A;  4YBS A;  3ASL A;  3U5M A;  5LKU A;  2LGV A;  2Y43 A;  5B75 A;  2KWJ A;  1JM7 B;  5D1M B;  5AIU A;  4N4F A;  2YT5 A;  5C13 A;  2ECG A;  2YUC A;  2KRE A;  3EB6 A;  1N87 A;  3SOW A;  2M6M A;  5AIT A;  3ZYQ A;  2VJE A;  4I7D A;  4R7E A;  3RTR B;  4NN2 A;  4YAB A;  4Q6F A;  1WEW A;  4GNG A;  2IDA A;  5TDW A;  4TKP B;  3LQI A;  4GND A;  1FP0 A;  2HDP A;  3U5P A;  2QIC A;  2XB1 A;  3ZPV E;  5G0F A;  4X3G A;  1MM3 A;  4CCG X;  4A0C D;  4I7C A;  5FEY A;  1Z60 A;  2L75 A;  3ZVY A;  1ZBD B;  4UP5 A;  2LXH C;  2F42 A;  1HYJ A;  5J3X A;  2KGI A;  2PNX A;  1X4J A;  5DIN A;  2KFT A;  3NG2 A;  4P5O B;  4R8P K;  2PUY A;  3DQV R;  2MIQ A;  5KH9 A;  3O33 A;  2VJF A;  3ZNI A;  2VP7 A;  4MSX A;  2Y1M A;  2OXQ C;  4R2Y A;  1K2F A;  1WEE A;  2E6R A;  3QZV A;  3PUR A;  2HYE D;  2MD8 C;  3KV5 A;  4F52 B;  3N9N A;  3FL2 A;  4ZUX U;  2MA5 A;  1HYI A;  4FK5 A;  2F6J A;  2CT2 A;  4L58 A;  3T6R A;  4WZ0 A;  2QIZ A;  1WEU A;  2LGL A;  5FB1 A;  2VJF B;  1U6G B;  4B7Y C;  1JOC A;  3N9Q A;  2MD7 B;  3O7A A;  2LGK A;  2YHO A;  3HCS A;  3ZTG A;  2L43 A;  2YU4 A;  1Z2Q A;  1WEP A;  3MHS A;  3O37 A;  2KYU A;  2YRE A;  5TRB A;  4YBT A;  2H0D B;  2JRJ A;  5B79 A;  5LKT A;  2M1R A;  3L11 A;  2KWN A;  5KH3 A;  3GL6 A;  1WEO A;  4V3L C;  2ECT A;  2KR4 A;  1Z6U A;  2VPB A;  2MA6 A;  4L7X A;  2FUI A;  3RPG C;  1G25 A;  3M62 A;  2LXP C;  3O35 A;  4XI1 A;  2MUM A;  2MNZ A;  1BOR A;  2CKL A;  5G05 B;  4CA1 A;  4YC9 A;  2EOD A;  1E4U A;  2KU3 A;  2KIZ A;  4FO9 A;  5LCW B;  4YAT A;  1WEM A;  3RPG B;  4A49 A;  4V3K C;  1MM2 A;  3L1Z B;  3KV6 A;  5B8D A;  3LRQ A;  4AYC A;  3T7L A;  2XEU A;  3M99 A;  4LLB A;  2VJE B;  2YW8 A;  5D1K B;  2YHN A;  2K1J A;  2L5U A;  2ZET C;  2CKL B;  3LQH A;  3L1X A;  5B77 A;  5C11 A;  2CSZ A;  2LRI C;  4LK9 A;  2VNF A;  3HCU A;  3N9O A;  5D1L B;  2LV9 A;  4W4U A;  1X4I A;  2JMJ A;  4C9Z A;  2G45 A;  2VPG A;  1VFY A; 
#chains in the Genus database with same CATH topology
 2K4D A;  2M85 A;  3T9K A;  2C2V S;  4LAD B;  4AYC B;  4A4B A;  2EGP A;  2JM3 A;  4LKA A;  1WES A;  4Z0O A;  4BHW A;  1T1H A;  4ZQL A;  5SVX A;  2NAA A;  5DKA A;  1V87 A;  2ECJ A;  2YUR A;  4S3O C;  3M7K A;  5JG6 A;  4O64 A;  3VK6 A;  1X4U A;  3HCT A;  3U5O A;  4BBQ A;  3PUQ A;  2P57 A;  3SOU A;  4AP4 A;  2YQL A;  3H7H A;  1WEQ A;  3O47 A;  3HTK C;  2FSA A;  2YQM A;  3O36 A;  4LJN A;  2ECV A;  4GNF A;  1F62 A;  4A4C A;  4FIP A;  2D8S A;  4S3O B;  3N9P A;  3IHP A;  2EGM A;  4B86 C;  3O70 A;  4UP0 A;  2XP0 A;  3PHD A;  5H1V A;  2BAY A;  2XOC A;  2RSD A;  2KWK A;  2QJ0 A;  5H1U A;  2MT5 A;  5G04 B;  4QQ4 A;  5LKZ A;  5TBN A;  2F6N A;  2LQ6 A;  3I2D A;  4PTB A;  1LDK C;  4IC3 A;  3MDB C;  1WEV A;  2JUN A;  2KWO A;  2EA6 A;  2ECW A;  3C6W A;  2KKX A;  4UI9 B;  2VPE A;  4O62 A;  5H9M A;  4QF3 A;  2ECN A;  2L7P A;  4N3W A;  5KH7 A;  2JMI A;  4FJC A;  4WA6 A;  3O34 A;  2CSY A;  1WFK A;  4YAD A;  2YSM A;  1LDJ B;  1RMD A;  2C2L A;  3U5N A;  5EYA F;  3N9M A;  1CHC A;  3KDE C;  3LQJ A;  2Y1N A;  5B76 A;  4ZDT A;  1VYX A;  4IC2 A;  4WZ3 B;  1IYM A;  2KE1 A;  3V43 A;  2K16 A;  2LDR A;  3SHB A;  5LKX A;  1XWH A;  4GB0 A;  3PLW A;  2E6S A;  2KGG A;  2VPD A;  4WZ2 A;  1MBM A;  2AN6 A;  3DWD A;  1WIL A;  5FB0 A;  1WEN A;  3SUB A;  2LN0 A;  3C5K A;  2G43 A;  4QF2 A;  1WGM A;  3N9L A;  4PPE A;  4AVX A;  5TDR A;  5B78 A;  1WE9 A;  4AUQ B;  2DX8 A;  3SOX A;  3E2D A;  3KQI A;  4MVT A;  3ZPV 1;  4GNE A;  2M3H A;  2RI7 A;  5FER A;  5H1T A;  2I50 A;  3DPL R;  3MHH A;  1JM7 A;  2JMD A;  5SVI A;  5I3L A;  4H9D A;  2G6Q A;  3KNV A;  2YSJ A;  2K17 A;  3GV4 A;  4YBM A;  2MNY A;  2H0D A;  1FBV A;  4YAX A;  2YYR A;  2FUU A;  2FD4 A;  2UZG A;  2L80 A;  1DCQ A;  2L0B A;  1VD4 A;  3EB5 A;  3ZVZ B;  4I7B A;  5TAB A;  2ECI A;  3FM8 C;  3M63 A;  1DVP A;  2LGG A;  1WIM A;  2OWA A;  4YBS A;  3ASL A;  3U5M A;  5LKU A;  2LGV A;  2Y43 A;  5B75 A;  2KWJ A;  1JM7 B;  5SVI B;  2CSV A;  5D1M B;  5AIU A;  4N4F A;  2YT5 A;  2DSM A;  3Q1D A;  5C13 A;  2ECG A;  5SVY A;  2YUC A;  2KRE A;  3EB6 A;  3LVQ E;  1N87 A;  2MKE A;  2M6M A;  2XOZ A;  3SOW A;  5AIT A;  3ZYQ A;  3FEH A;  2CRW A;  2VJE A;  4I7D A;  4R7E A;  3RTR B;  4NN2 A;  4YAB A;  5K3Q A;  4Q6F A;  1WEW A;  4GNG A;  2IDA A;  5TDW A;  2IQJ A;  4TKP B;  3LQI A;  4GND A;  1FP0 A;  2HDP A;  3U5P A;  2QIC A;  2XB1 A;  3ZPV E;  5G0F A;  4X3G A;  1MM3 A;  2XOY A;  4CCG X;  4A0C D;  4I7C A;  5FEY A;  1Z60 A;  2L75 A;  2CRR A;  3ZVY A;  1ZBD B;  4UP5 A;  2LXH C;  2F42 A;  1HYJ A;  5J3X A;  2KGI A;  3LDY A;  2PNX A;  1X4J A;  5DIN A;  2KFT A;  3NG2 A;  4P5O B;  4R8P K;  2PUY A;  3DQV R;  2MIQ A;  5KH9 A;  2EXU A;  3O33 A;  2VJF A;  3ZNI A;  3FJU B;  4OGC A;  2VP7 A;  4MSX A;  2Y1M A;  2OXQ C;  4R2Y A;  1K2F A;  1WEE A;  2E6R A;  3QZV A;  3LVR E;  3PUR A;  2HYE D;  2MD8 C;  3KV5 A;  4F52 B;  4Z0R A;  3JUE A;  3N9N A;  3FL2 A;  4ZUX U;  2MA5 A;  1HYI A;  2E61 A;  4FK5 A;  2F6J A;  2CT2 A;  4L58 A;  3T6R A;  4F1P A;  4WZ0 A;  2QIZ A;  1WEU A;  2LGL A;  5FB1 A;  2VJF B;  1U6G B;  4B7Y C;  1JOC A;  2CON A;  3N9Q A;  2RR4 A;  2MD7 B;  3O7A A;  2LGK A;  2YHO A;  3HCS A;  2KKY A;  3ZTG A;  2L43 A;  2YU4 A;  1Z2Q A;  2D8U A;  3DDT A;  1WEP A;  3MHS A;  3O37 A;  2KYU A;  2YRE A;  5TRB A;  4YBT A;  2H0D B;  2JRJ A;  5B79 A;  5LKT A;  2M1R A;  3L11 A;  2KWN A;  5KH3 A;  2M13 A;  3GL6 A;  1WEO A;  4V3L C;  2ECT A;  2KR4 A;  3FAN A;  1Z6U A;  2VPB A;  2MA6 A;  4L7X A;  2DJA A;  2FUI A;  3RPG C;  2B0O E;  1G25 A;  3M62 A;  2LXP C;  3O35 A;  4XI1 A;  2MUM A;  2MNZ A;  1BOR A;  2CKL A;  5G05 B;  4CA1 A;  4YC9 A;  2EOD A;  1E4U A;  2KU3 A;  2KIZ A;  4OGE A;  4FO9 A;  5LCW B;  4YAT A;  1WEM A;  3RPG B;  4A49 A;  3LJU X;  4V3K C;  1MM2 A;  3L1Z B;  3KV6 A;  5B8D A;  3LRQ A;  3FAO A;  4AYC A;  3T7L A;  2XEU A;  3M99 A;  4LLB A;  2FFW A;  2YVR A;  2VJE B;  2YW8 A;  5D1K B;  2YHN A;  2K1J A;  2LAU A;  2L5U A;  2ZET C;  2CKL B;  3LQH A;  3L1X A;  5B77 A;  5C11 A;  2CSZ A;  2LRI C;  4LK9 A;  2VNF A;  3HCU A;  3N9O A;  5D1L B;  2LV9 A;  4W4U A;  1X4I A;  2JMJ A;  4C9Z A;  2G45 A;  2VPG A;  1VFY A; 
#chains in the Genus database with same CATH homology
 2K4D A;  2M85 A;  2C2V S;  4LAD B;  4AYC B;  4A4B A;  2EGP A;  4LKA A;  1WES A;  4BHW A;  1T1H A;  4ZQL A;  2NAA A;  5DKA A;  1V87 A;  2ECJ A;  2YUR A;  4S3O C;  5JG6 A;  4O64 A;  3VK6 A;  1X4U A;  3HCT A;  3U5O A;  4BBQ A;  3PUQ A;  3SOU A;  4AP4 A;  2YQL A;  1WEQ A;  3HTK C;  2FSA A;  2YQM A;  3O36 A;  4LJN A;  2ECV A;  4GNF A;  1F62 A;  4A4C A;  4FIP A;  2D8S A;  4S3O B;  3N9P A;  3IHP A;  4B86 C;  3O70 A;  4UP0 A;  3PHD A;  5H1V A;  2BAY A;  2RSD A;  2KWK A;  2QJ0 A;  5H1U A;  2MT5 A;  5G04 B;  5LKZ A;  5TBN A;  2F6N A;  2LQ6 A;  3I2D A;  4PTB A;  1LDK C;  4IC3 A;  1WEV A;  2KWO A;  2EA6 A;  2ECW A;  3C6W A;  4UI9 B;  2VPE A;  5H9M A;  4QF3 A;  2ECN A;  4N3W A;  5KH7 A;  2JMI A;  4FJC A;  4WA6 A;  3O34 A;  2CSY A;  1WFK A;  4YAD A;  2YSM A;  1LDJ B;  1RMD A;  2C2L A;  3U5N A;  5EYA F;  3N9M A;  1CHC A;  3LQJ A;  2Y1N A;  5B76 A;  4ZDT A;  1VYX A;  4IC2 A;  4WZ3 B;  1IYM A;  2KE1 A;  3V43 A;  2K16 A;  2LDR A;  3SHB A;  5LKX A;  1XWH A;  4GB0 A;  2E6S A;  2KGG A;  2VPD A;  4WZ2 A;  2AN6 A;  1WIL A;  5FB0 A;  1WEN A;  2LN0 A;  3C5K A;  2G43 A;  4QF2 A;  1WGM A;  3N9L A;  4PPE A;  4AVX A;  5TDR A;  5B78 A;  1WE9 A;  4AUQ B;  2DX8 A;  3SOX A;  3KQI A;  4MVT A;  3ZPV 1;  4GNE A;  2M3H A;  2RI7 A;  5FER A;  5H1T A;  2I50 A;  3DPL R;  3MHH A;  1JM7 A;  2JMD A;  5I3L A;  2G6Q A;  3KNV A;  2YSJ A;  2K17 A;  3GV4 A;  4YBM A;  2MNY A;  2H0D A;  1FBV A;  4YAX A;  2YYR A;  2FUU A;  2UZG A;  2L80 A;  2L0B A;  1VD4 A;  3EB5 A;  3ZVZ B;  4I7B A;  5TAB A;  2ECI A;  3M63 A;  1DVP A;  2LGG A;  1WIM A;  4YBS A;  3ASL A;  3U5M A;  5LKU A;  2LGV A;  2Y43 A;  5B75 A;  2KWJ A;  1JM7 B;  5D1M B;  5AIU A;  4N4F A;  2YT5 A;  5C13 A;  2ECG A;  2YUC A;  2KRE A;  3EB6 A;  1N87 A;  3SOW A;  2M6M A;  5AIT A;  3ZYQ A;  2VJE A;  4I7D A;  4R7E A;  3RTR B;  4NN2 A;  4YAB A;  4Q6F A;  1WEW A;  4GNG A;  2IDA A;  5TDW A;  4TKP B;  3LQI A;  4GND A;  1FP0 A;  2HDP A;  3U5P A;  2QIC A;  2XB1 A;  3ZPV E;  5G0F A;  4X3G A;  1MM3 A;  4CCG X;  4A0C D;  4I7C A;  5FEY A;  1Z60 A;  2L75 A;  3ZVY A;  1ZBD B;  4UP5 A;  2LXH C;  2F42 A;  1HYJ A;  5J3X A;  2KGI A;  2PNX A;  1X4J A;  5DIN A;  2KFT A;  3NG2 A;  4P5O B;  4R8P K;  2PUY A;  3DQV R;  2MIQ A;  5KH9 A;  3O33 A;  2VJF A;  3ZNI A;  2VP7 A;  4MSX A;  2Y1M A;  2OXQ C;  4R2Y A;  1K2F A;  1WEE A;  2E6R A;  3QZV A;  3PUR A;  2HYE D;  2MD8 C;  3KV5 A;  4F52 B;  3N9N A;  3FL2 A;  4ZUX U;  2MA5 A;  1HYI A;  4FK5 A;  2F6J A;  2CT2 A;  4L58 A;  3T6R A;  4WZ0 A;  2QIZ A;  1WEU A;  2LGL A;  5FB1 A;  2VJF B;  1U6G B;  4B7Y C;  1JOC A;  3N9Q A;  2MD7 B;  3O7A A;  2LGK A;  2YHO A;  3HCS A;  3ZTG A;  2L43 A;  2YU4 A;  1Z2Q A;  1WEP A;  3MHS A;  3O37 A;  2KYU A;  2YRE A;  5TRB A;  4YBT A;  2H0D B;  2JRJ A;  5B79 A;  5LKT A;  2M1R A;  3L11 A;  2KWN A;  5KH3 A;  3GL6 A;  1WEO A;  4V3L C;  2ECT A;  2KR4 A;  1Z6U A;  2VPB A;  2MA6 A;  4L7X A;  2FUI A;  3RPG C;  1G25 A;  3M62 A;  2LXP C;  3O35 A;  4XI1 A;  2MUM A;  2MNZ A;  1BOR A;  2CKL A;  5G05 B;  4CA1 A;  4YC9 A;  2EOD A;  1E4U A;  2KU3 A;  2KIZ A;  4FO9 A;  5LCW B;  4YAT A;  1WEM A;  3RPG B;  4A49 A;  4V3K C;  1MM2 A;  3L1Z B;  3KV6 A;  5B8D A;  3LRQ A;  4AYC A;  3T7L A;  2XEU A;  3M99 A;  4LLB A;  2VJE B;  2YW8 A;  5D1K B;  2YHN A;  2K1J A;  2L5U A;  2ZET C;  2CKL B;  3LQH A;  3L1X A;  5B77 A;  5C11 A;  2CSZ A;  2LRI C;  4LK9 A;  2VNF A;  3HCU A;  3N9O A;  5D1L B;  2LV9 A;  4W4U A;  1X4I A;  2JMJ A;  4C9Z A;  2G45 A;  2VPG A;  1VFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...