1JM7B

Solution structure of the brca1/bard1 ring-domain heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
MEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a BRCA1-BARD1 heterodimeric RING-RING complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor
molecule keywords BREAST CANCER TYPE 1 SUSCEPTIBILITY PROTEIN
total genus 21
structure length 97
sequence length 97
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14835 zf-RING_6 zf-RING of BARD1-type protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1jm7B00
2KREA 2L5UA 5FB1A 3U5PA 4BHWA 1BORA 2LQ6A 2YW8A 2MD7B 2AN6A 3PUQA 5D1MB 2F6JA 4V3KC 2PUYA 2XB1A 4NN2A 5KH3A 1FBVA 3N9LA 5LKUA 2XEUA 3PHDA 4P5OB 2JMIA 4A4CA 1K2FA 3LRQA 2CSYA 4IC2A 4CCGX 2YT5A 2EODA 4MVTA 4N3WA 1F62A 1WGMA 2KWKA 2CKLA 5D1KB 2MNYA 2VJEB 2YREA 5JG6A 4UP0A 2YSJA 2NAAA 2ECJA 4FJCA 4Q6FA 3LQIA 2EA6A 4LKAA 2VNFA 4I7DA 4PTBA 2ECVA 2YU4A 2C2LA 4LADB 1WEQA 2LDRA 4CA1A 3FL2A 4W4UA 5C13A 1JM7A 5I3LA 2LXHC 1HYIA 3KV6A 5H9MA 3QZVA 2M1RA 3SOXA 1WILA 2KYUA 2LGLA 3O70A 3O34A 2LGGA 1WENA 2ZETC 4WZ3B 3T6RA 1HYJA 5EYAF 3HTKC 1WEEA 2ECIA 2HDPA 5AITA 2MNZA 2QJ0A 2VPEA 2YQLA 4TKPB 2OXQC 1RMDA 3EB5A 3ZPVE 2L80A 5C11A 3ZVYA 3C6WA 1Z60A 4R2YA 4L58A 3N9QA 5KH7A 3DQVR 4FIPA 1WEPA 4I7BA 1ZBDB 3N9OA 4F52B 1WEVA 1WEWA 4N4FA 3SOUA 3U5MA 2KE1A 3SHBA 4A0CD 4X3GA 4FO9A 2CT2A 5LKXA 4ZUXU 3ASLA 2JRJA 4YBMA 2K4DA 4B7YC 3MHSA 5G05B 4AVXA 3LQHA 4GNFA 5AIUA 1JM7B 3L1ZB 2FUIA 2CSZA 1DVPA 1N87A 2MT5A 2M3HA 4WA6A 4GNDA 2K17A 2C2VS 3DPLR 3ZNIA 1WEOA 3PURA 1VFYA 1X4IA 4PPEA 2VPDA 2ECGA 4QF3A 2PNXA 2G6QA 2G43A 2EGPA 2LGVA 4GB0A 2VJFA 4I7CA 3I2DA 5B8DA 2UZGA 3N9MA 4YADA 1Z6UA 1E4UA 5LKZA 1MM3A 3ZTGA 5KH9A 5B77A 5B76A 5D1LB 2F6NA 4R8PK 3RPGC 1LDKC 1IYMA 3LQJA 3GV4A 1X4JA 4MSXA 2G45A 2VPGA 4IC3A 4YBTA 2FUUA 5FERA 1VD4A 1T1HA 2JMJA 2KGIA 2MA5A 5B75A 4AP4A 2ECNA 5FB0A 2VJEA 1CHCA 2YHOA 4AYCB 1MM2A 3O35A 1X4UA 2Y1MA 3M99A 2H0DA 2MA6A 1U6GB 2ECTA 3KQIA 3O36A 3N9NA 4QF2A 5B78A 4WZ2A 2E6RA 2YYRA 2LN0A 3RTRB 2RI7A 1WESA 2KGGA 5TRBA 2M6MA 4AUQB 4UI9B 3HCUA 4L7XA 3C5KA 2DX8A 2Y1NA 3KV5A 4YBSA 5LKTA 4S3OC 2LRIC 5G0FA 2KR4A 5TDWA 3L1XA 2M85A 3O33A 2HYED 4BBQA 3L11A 3RPGB 2KWJA 4GNEA 2RSDA 2QIZA 4WZ0A 4AYCA 3VK6A 2FSAA 2L43A 3M62A 3V43A 3IHPA 2ECWA 4C9ZA 2LXPC 3KNVA 2D8SA 3MHHA 4YABA 3EB6A 1XWHA 2K1JA 3U5OA 4UP5A 2L75A 5H1TA 1Z2QA 2KFTA 2YSMA 4V3LC 5TBNA 1VYXA 2IDAA 2YHNA 3HCSA 5G04B 1WEMA 2L0BA 3M63A 5LCWB 2YURA 2MIQA 2KU3A 4YAXA 4YC9A 2KWNA 1JOCA 4A49A 5H1UA 3N9PA 4LK9A 3NG2A 4LLBA 2YUCA 5TABA 1LDJB 2KWOA 2MUMA 3SOWA 1G25A 2BAYA 2QICA 5DINA 5TDRA 2I50A 2VPBA 4LJNA 3ZVZB 1FP0A 5H1VA 3U5NA 2JMDA 2VJFB 2E6SA 3ZPV1 4O64A 5DKAA 3ZYQA 4YATA 3HCTA 1WEUA 1WIMA 3O37A 2CKLB 2K16A 2F42A 4GNGA 2Y43A 2LV9A 4A4BA 4B86C 5B79A 2YQMA 1V87A 4ZQLA 4FK5A 2MD8C 5J3XA 3T7LA 1WE9A 4XI1A 2VP7A 3O7AA 2H0DB 4S3OB 1WFKA 3GL6A 4ZDTA 2LGKA 4R7EA 2KIZA 5FEYA
chains in the Genus database with same CATH superfamily
2KREA 2L5UA 5FB1A 3U5PA 4BHWA 1BORA 2LQ6A 2YW8A 2MD7B 2AN6A 3PUQA 5D1MB 2F6JA 4V3KC 2KKYA 2PUYA 2XB1A 2MKEA 4NN2A 5KH3A 1FBVA 3N9LA 5LKUA 2XEUA 3PHDA 4P5OB 2JMIA 4A4CA 1K2FA 3FAOA 3LRQA 2XOCA 2CSYA 4IC2A 4CCGX 2YT5A 2EODA 3PLWA 4MVTA 4F1PA 2D8UA 4N3WA 1F62A 1WGMA 2KWKA 2CKLA 3LVQE 5D1KB 2MNYA 2VJEB 4QQ4A 2YREA 4OGCA 5JG6A 4UP0A 2YSJA 2NAAA 2ECJA 4FJCA 3H7HA 4Q6FA 3LQIA 2EA6A 4LKAA 2VNFA 4I7DA 2JUNA 4PTBA 2ECVA 2YU4A 2C2LA 4Z0OA 4LADB 1WEQA 2LDRA 4CA1A 3FL2A 4W4UA 5C13A 1JM7A 5I3LA 2LXHC 1HYIA 3KV6A 5H9MA 3QZVA 2M1RA 3SOXA 2M13A 5SVIA 1WILA 2KYUA 2LGLA 3O70A 1DCQA 3MDBC 3O34A 2LGGA 4Z0RA 1WENA 2ZETC 4WZ3B 3T6RA 1HYJA 2FD4A 5EYAF 3HTKC 1WEEA 2ECIA 2HDPA 5AITA 2MNZA 2QJ0A 2XP0A 3DDTA 2VPEA 5SVXA 2YQLA 4TKPB 2OXQC 1RMDA 3EB5A 2DSMA 3ZPVE 2L80A 5C11A 3ZVYA 3C6WA 1Z60A 4R2YA 4L58A 3N9QA 5KH7A 3DQVR 4FIPA 1WEPA 4I7BA 1ZBDB 3N9OA 4F52B 1WEVA 4H9DA 1WEWA 4N4FA 5K3QA 3SOUA 3U5MA 2KE1A 4O62A 3SHBA 4A0CD 4X3GA 4FO9A 2CT2A 5LKXA 4ZUXU 3ASLA 2JRJA 4YBMA 2K4DA 5SVYA 4B7YC 3MHSA 5G05B 4AVXA 3LQHA 4GNFA 5AIUA 1JM7B 3L1ZB 2FUIA 2CSZA 5SVIB 1DVPA 1N87A 2MT5A 2M3HA 4WA6A 4GNDA 2K17A 2C2VS 3DPLR 3ZNIA 1WEOA 3PURA 1VFYA 1X4IA 4PPEA 2VPDA 2ECGA 3M7KA 4QF3A 2PNXA 2G6QA 2G43A 2EGPA 2LGVA 4GB0A 2VJFA 4I7CA 3I2DA 5B8DA 2UZGA 3KDEC 3N9MA 4YADA 1Z6UA 1E4UA 2EXUA 5LKZA 1MM3A 3FM8C 3ZTGA 5KH9A 5B77A 5B76A 5D1LB 3O47A 2F6NA 4R8PK 3RPGC 1LDKC 1IYMA 3FJUB 3LQJA 3GV4A 1X4JA 4MSXA 3JUEA 2G45A 2VPGA 4IC3A 4YBTA 3T9KA 2FUUA 5FERA 1VD4A 2OWAA 1T1HA 2JMJA 2CONA 2KGIA 2MA5A 5B75A 4AP4A 2ECNA 5FB0A 2VJEA 1CHCA 2YHOA 4AYCB 3LVRE 2L7PA 1MM2A 3O35A 1X4UA 2Y1MA 3DWDA 3M99A 2H0DA 2MA6A 1U6GB 2ECTA 3KQIA 3O36A 3N9NA 4QF2A 5B78A 4WZ2A 3SUBA 2E6RA 2YYRA 2LN0A 3RTRB 1MBMA 2RI7A 1WESA 2KGGA 5TRBA 2M6MA 4AUQB 4UI9B 3HCUA 4L7XA 3C5KA 2DX8A 2Y1NA 3KV5A 4YBSA 5LKTA 2RR4A 4S3OC 2LRIC 5G0FA 2P57A 2KR4A 5TDWA 3L1XA 2M85A 3O33A 2HYED 4BBQA 3L11A 3RPGB 2KWJA 4GNEA 3FANA 2RSDA 2QIZA 4WZ0A 4AYCA 3VK6A 2FSAA 2L43A 3M62A 3V43A 3IHPA 2ECWA 4C9ZA 2EGMA 2LXPC 2CRWA 3KNVA 2D8SA 3MHHA 4YABA 3EB6A 1XWHA 2K1JA 2B0OE 2IQJA 3U5OA 4UP5A 2L75A 5H1TA 2YVRA 1Z2QA 2KFTA 2YSMA 4V3LC 5TBNA 1VYXA 3LDYA 2IDAA 2LAUA 2CRRA 2YHNA 3HCSA 5G04B 1WEMA 2L0BA 2XOYA 3M63A 5LCWB 2YURA 2MIQA 2KU3A 4YAXA 4YC9A 2KWNA 1JOCA 4A49A 5H1UA 3N9PA 4LK9A 3NG2A 4LLBA 2YUCA 5TABA 1LDJB 2KWOA 2MUMA 3SOWA 2FFWA 2E61A 1G25A 2BAYA 2QICA 5DINA 5TDRA 2I50A 2VPBA 4LJNA 1FP0A 5H1VA 3ZVZB 3U5NA 2JMDA 2VJFB 2E6SA 3ZPV1 3Q1DA 2KKXA 4O64A 5DKAA 3ZYQA 4OGEA 4YATA 3FEHA 3HCTA 3E2DA 1WEUA 1WIMA 3O37A 2CKLB 2K16A 2F42A 4GNGA 2Y43A 2LV9A 4A4BA 4B86C 5B79A 2YQMA 2CSVA 1V87A 4ZQLA 4FK5A 2MD8C 5J3XA 3T7LA 1WE9A 4XI1A 2VP7A 3O7AA 2H0DB 4S3OB 3LJUX 1WFKA 3GL6A 4ZDTA 2LGKA 2XOZA 4R7EA 2DJAA 2JM3A 2KIZA 5FEYA
chains in the Genus database with same CATH topology
2KREA 2L5UA 5FB1A 3U5PA 4BHWA 1BORA 2LQ6A 2YW8A 2MD7B 2AN6A 3PUQA 5D1MB 2F6JA 4V3KC 2PUYA 2XB1A 4NN2A 5KH3A 1FBVA 3N9LA 5LKUA 2XEUA 3PHDA 4P5OB 2JMIA 4A4CA 1K2FA 3LRQA 2CSYA 4IC2A 4CCGX 2YT5A 2EODA 4MVTA 4N3WA 1F62A 1WGMA 2KWKA 2CKLA 5D1KB 2MNYA 2VJEB 2YREA 5JG6A 4UP0A 2YSJA 2NAAA 2ECJA 4FJCA 4Q6FA 3LQIA 2EA6A 4LKAA 2VNFA 4I7DA 4PTBA 2ECVA 2YU4A 2C2LA 4LADB 1WEQA 2LDRA 4CA1A 3FL2A 4W4UA 5C13A 1JM7A 5I3LA 2LXHC 1HYIA 3KV6A 5H9MA 3QZVA 2M1RA 3SOXA 1WILA 2KYUA 2LGLA 3O70A 3O34A 2LGGA 1WENA 2ZETC 4WZ3B 3T6RA 1HYJA 5EYAF 3HTKC 1WEEA 2ECIA 2HDPA 5AITA 2MNZA 2QJ0A 2VPEA 2YQLA 4TKPB 2OXQC 1RMDA 3EB5A 3ZPVE 2L80A 5C11A 3ZVYA 3C6WA 1Z60A 4R2YA 4L58A 3N9QA 5KH7A 3DQVR 4FIPA 1WEPA 4I7BA 1ZBDB 3N9OA 4F52B 1WEVA 1WEWA 4N4FA 3SOUA 3U5MA 2KE1A 3SHBA 4A0CD 4X3GA 4FO9A 2CT2A 5LKXA 4ZUXU 3ASLA 2JRJA 4YBMA 2K4DA 4B7YC 3MHSA 5G05B 4AVXA 3LQHA 4GNFA 5AIUA 1JM7B 3L1ZB 2FUIA 2CSZA 1DVPA 1N87A 2MT5A 2M3HA 4WA6A 4GNDA 2K17A 2C2VS 3DPLR 3ZNIA 1WEOA 3PURA 1VFYA 1X4IA 4PPEA 2VPDA 2ECGA 4QF3A 2PNXA 2G6QA 2G43A 2EGPA 2LGVA 4GB0A 2VJFA 4I7CA 3I2DA 5B8DA 2UZGA 3N9MA 4YADA 1Z6UA 1E4UA 5LKZA 1MM3A 3ZTGA 5KH9A 5B77A 5B76A 5D1LB 2F6NA 4R8PK 3RPGC 1LDKC 1IYMA 3LQJA 3GV4A 1X4JA 4MSXA 2G45A 2VPGA 4IC3A 4YBTA 2FUUA 5FERA 1VD4A 1T1HA 2JMJA 2KGIA 2MA5A 5B75A 4AP4A 2ECNA 5FB0A 2VJEA 1CHCA 2YHOA 4AYCB 1MM2A 3O35A 1X4UA 2Y1MA 3M99A 2H0DA 2MA6A 1U6GB 2ECTA 3KQIA 3O36A 3N9NA 4QF2A 5B78A 4WZ2A 2E6RA 2YYRA 2LN0A 3RTRB 2RI7A 1WESA 2KGGA 5TRBA 2M6MA 4AUQB 4UI9B 3HCUA 4L7XA 3C5KA 2DX8A 2Y1NA 3KV5A 4YBSA 5LKTA 4S3OC 2LRIC 5G0FA 2KR4A 5TDWA 3L1XA 2M85A 3O33A 2HYED 4BBQA 3L11A 3RPGB 2KWJA 4GNEA 2RSDA 2QIZA 4WZ0A 4AYCA 3VK6A 2FSAA 2L43A 3M62A 3V43A 3IHPA 2ECWA 4C9ZA 2LXPC 3KNVA 2D8SA 3MHHA 4YABA 3EB6A 1XWHA 2K1JA 3U5OA 4UP5A 2L75A 5H1TA 1Z2QA 2KFTA 2YSMA 4V3LC 5TBNA 1VYXA 2IDAA 2YHNA 3HCSA 5G04B 1WEMA 2L0BA 3M63A 5LCWB 2YURA 2MIQA 2KU3A 4YAXA 4YC9A 2KWNA 1JOCA 4A49A 5H1UA 3N9PA 4LK9A 3NG2A 4LLBA 2YUCA 5TABA 1LDJB 2KWOA 2MUMA 3SOWA 1G25A 2BAYA 2QICA 5DINA 5TDRA 2I50A 2VPBA 4LJNA 3ZVZB 1FP0A 5H1VA 3U5NA 2JMDA 2VJFB 2E6SA 3ZPV1 4O64A 5DKAA 3ZYQA 4YATA 3HCTA 1WEUA 1WIMA 3O37A 2CKLB 2K16A 2F42A 4GNGA 2Y43A 2LV9A 4A4BA 4B86C 5B79A 2YQMA 1V87A 4ZQLA 4FK5A 2MD8C 5J3XA 3T7LA 1WE9A 4XI1A 2VP7A 3O7AA 2H0DB 4S3OB 1WFKA 3GL6A 4ZDTA 2LGKA 4R7EA 2KIZA 5FEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRE A;  2L5U A;  5FB1 A;  3U5P A;  4BHW A;  1BOR A;  2LQ6 A;  2YW8 A;  2MD7 B;  2AN6 A;  3PUQ A;  5D1M B;  2F6J A;  4V3K C;  2PUY A;  2XB1 A;  4NN2 A;  5KH3 A;  1FBV A;  3N9L A;  5LKU A;  2XEU A;  3PHD A;  4P5O B;  2JMI A;  4A4C A;  1K2F A;  3LRQ A;  2CSY A;  4IC2 A;  4CCG X;  2YT5 A;  2EOD A;  4MVT A;  4N3W A;  1F62 A;  1WGM A;  2KWK A;  2CKL A;  5D1K B;  2MNY A;  2VJE B;  2YRE A;  5JG6 A;  4UP0 A;  2YSJ A;  2NAA A;  2ECJ A;  4FJC A;  4Q6F A;  3LQI A;  2EA6 A;  4LKA A;  2VNF A;  4I7D A;  4PTB A;  2ECV A;  2YU4 A;  2C2L A;  4LAD B;  1WEQ A;  2LDR A;  4CA1 A;  3FL2 A;  4W4U A;  5C13 A;  1JM7 A;  5I3L A;  2LXH C;  1HYI A;  3KV6 A;  5H9M A;  3QZV A;  2M1R A;  3SOX A;  1WIL A;  2KYU A;  2LGL A;  3O70 A;  3O34 A;  2LGG A;  1WEN A;  2ZET C;  4WZ3 B;  3T6R A;  1HYJ A;  5EYA F;  3HTK C;  1WEE A;  2ECI A;  2HDP A;  5AIT A;  2MNZ A;  2QJ0 A;  2VPE A;  2YQL A;  4TKP B;  2OXQ C;  1RMD A;  3EB5 A;  3ZPV E;  2L80 A;  5C11 A;  3ZVY A;  3C6W A;  1Z60 A;  4R2Y A;  4L58 A;  3N9Q A;  5KH7 A;  3DQV R;  4FIP A;  1WEP A;  4I7B A;  1ZBD B;  3N9O A;  4F52 B;  1WEV A;  1WEW A;  4N4F A;  3SOU A;  3U5M A;  2KE1 A;  3SHB A;  4A0C D;  4X3G A;  4FO9 A;  2CT2 A;  5LKX A;  4ZUX U;  3ASL A;  2JRJ A;  4YBM A;  2K4D A;  4B7Y C;  3MHS A;  5G05 B;  4AVX A;  3LQH A;  4GNF A;  5AIU A;  1JM7 B;  3L1Z B;  2FUI A;  2CSZ A;  1DVP A;  1N87 A;  2MT5 A;  2M3H A;  4WA6 A;  4GND A;  2K17 A;  2C2V S;  3DPL R;  3ZNI A;  1WEO A;  3PUR A;  1VFY A;  1X4I A;  4PPE A;  2VPD A;  2ECG A;  4QF3 A;  2PNX A;  2G6Q A;  2G43 A;  2EGP A;  2LGV A;  4GB0 A;  2VJF A;  4I7C A;  3I2D A;  5B8D A;  2UZG A;  3N9M A;  4YAD A;  1Z6U A;  1E4U A;  5LKZ A;  1MM3 A;  3ZTG A;  5KH9 A;  5B77 A;  5B76 A;  5D1L B;  2F6N A;  4R8P K;  3RPG C;  1LDK C;  1IYM A;  3LQJ A;  3GV4 A;  1X4J A;  4MSX A;  2G45 A;  2VPG A;  4IC3 A;  4YBT A;  2FUU A;  5FER A;  1VD4 A;  1T1H A;  2JMJ A;  2KGI A;  2MA5 A;  5B75 A;  4AP4 A;  2ECN A;  5FB0 A;  2VJE A;  1CHC A;  2YHO A;  4AYC B;  1MM2 A;  3O35 A;  1X4U A;  2Y1M A;  3M99 A;  2H0D A;  2MA6 A;  1U6G B;  2ECT A;  3KQI A;  3O36 A;  3N9N A;  4QF2 A;  5B78 A;  4WZ2 A;  2E6R A;  2YYR A;  2LN0 A;  3RTR B;  2RI7 A;  1WES A;  2KGG A;  5TRB A;  2M6M A;  4AUQ B;  4UI9 B;  3HCU A;  4L7X A;  3C5K A;  2DX8 A;  2Y1N A;  3KV5 A;  4YBS A;  5LKT A;  4S3O C;  2LRI C;  5G0F A;  2KR4 A;  5TDW A;  3L1X A;  2M85 A;  3O33 A;  2HYE D;  4BBQ A;  3L11 A;  3RPG B;  2KWJ A;  4GNE A;  2RSD A;  2QIZ A;  4WZ0 A;  4AYC A;  3VK6 A;  2FSA A;  2L43 A;  3M62 A;  3V43 A;  3IHP A;  2ECW A;  4C9Z A;  2LXP C;  3KNV A;  2D8S A;  3MHH A;  4YAB A;  3EB6 A;  1XWH A;  2K1J A;  3U5O A;  4UP5 A;  2L75 A;  5H1T A;  1Z2Q A;  2KFT A;  2YSM A;  4V3L C;  5TBN A;  1VYX A;  2IDA A;  2YHN A;  3HCS A;  5G04 B;  1WEM A;  2L0B A;  3M63 A;  5LCW B;  2YUR A;  2MIQ A;  2KU3 A;  4YAX A;  4YC9 A;  2KWN A;  1JOC A;  4A49 A;  5H1U A;  3N9P A;  4LK9 A;  3NG2 A;  4LLB A;  2YUC A;  5TAB A;  1LDJ B;  2KWO A;  2MUM A;  3SOW A;  1G25 A;  2BAY A;  2QIC A;  5DIN A;  5TDR A;  2I50 A;  2VPB A;  4LJN A;  3ZVZ B;  1FP0 A;  5H1V A;  3U5N A;  2JMD A;  2VJF B;  2E6S A;  3ZPV 1;  4O64 A;  5DKA A;  3ZYQ A;  4YAT A;  3HCT A;  1WEU A;  1WIM A;  3O37 A;  2CKL B;  2K16 A;  2F42 A;  4GNG A;  2Y43 A;  2LV9 A;  4A4B A;  4B86 C;  5B79 A;  2YQM A;  1V87 A;  4ZQL A;  4FK5 A;  2MD8 C;  5J3X A;  3T7L A;  1WE9 A;  4XI1 A;  2VP7 A;  3O7A A;  2H0D B;  4S3O B;  1WFK A;  3GL6 A;  4ZDT A;  2LGK A;  4R7E A;  2KIZ A;  5FEY A; 
#chains in the Genus database with same CATH topology
 2KRE A;  2L5U A;  5FB1 A;  3U5P A;  4BHW A;  1BOR A;  2LQ6 A;  2YW8 A;  2MD7 B;  2AN6 A;  3PUQ A;  5D1M B;  2F6J A;  4V3K C;  2KKY A;  2PUY A;  2XB1 A;  2MKE A;  4NN2 A;  5KH3 A;  1FBV A;  3N9L A;  5LKU A;  2XEU A;  3PHD A;  4P5O B;  2JMI A;  4A4C A;  1K2F A;  3FAO A;  3LRQ A;  2XOC A;  2CSY A;  4IC2 A;  4CCG X;  2YT5 A;  2EOD A;  3PLW A;  4MVT A;  4F1P A;  2D8U A;  4N3W A;  1F62 A;  1WGM A;  2KWK A;  2CKL A;  3LVQ E;  5D1K B;  2MNY A;  2VJE B;  4QQ4 A;  2YRE A;  4OGC A;  5JG6 A;  4UP0 A;  2YSJ A;  2NAA A;  2ECJ A;  4FJC A;  3H7H A;  4Q6F A;  3LQI A;  2EA6 A;  4LKA A;  2VNF A;  4I7D A;  2JUN A;  4PTB A;  2ECV A;  2YU4 A;  2C2L A;  4Z0O A;  4LAD B;  1WEQ A;  2LDR A;  4CA1 A;  3FL2 A;  4W4U A;  5C13 A;  1JM7 A;  5I3L A;  2LXH C;  1HYI A;  3KV6 A;  5H9M A;  3QZV A;  2M1R A;  3SOX A;  2M13 A;  5SVI A;  1WIL A;  2KYU A;  2LGL A;  3O70 A;  1DCQ A;  3MDB C;  3O34 A;  2LGG A;  4Z0R A;  1WEN A;  2ZET C;  4WZ3 B;  3T6R A;  1HYJ A;  2FD4 A;  5EYA F;  3HTK C;  1WEE A;  2ECI A;  2HDP A;  5AIT A;  2MNZ A;  2QJ0 A;  2XP0 A;  3DDT A;  2VPE A;  5SVX A;  2YQL A;  4TKP B;  2OXQ C;  1RMD A;  3EB5 A;  2DSM A;  3ZPV E;  2L80 A;  5C11 A;  3ZVY A;  3C6W A;  1Z60 A;  4R2Y A;  4L58 A;  3N9Q A;  5KH7 A;  3DQV R;  4FIP A;  1WEP A;  4I7B A;  1ZBD B;  3N9O A;  4F52 B;  1WEV A;  4H9D A;  1WEW A;  4N4F A;  5K3Q A;  3SOU A;  3U5M A;  2KE1 A;  4O62 A;  3SHB A;  4A0C D;  4X3G A;  4FO9 A;  2CT2 A;  5LKX A;  4ZUX U;  3ASL A;  2JRJ A;  4YBM A;  2K4D A;  5SVY A;  4B7Y C;  3MHS A;  5G05 B;  4AVX A;  3LQH A;  4GNF A;  5AIU A;  1JM7 B;  3L1Z B;  2FUI A;  2CSZ A;  5SVI B;  1DVP A;  1N87 A;  2MT5 A;  2M3H A;  4WA6 A;  4GND A;  2K17 A;  2C2V S;  3DPL R;  3ZNI A;  1WEO A;  3PUR A;  1VFY A;  1X4I A;  4PPE A;  2VPD A;  2ECG A;  3M7K A;  4QF3 A;  2PNX A;  2G6Q A;  2G43 A;  2EGP A;  2LGV A;  4GB0 A;  2VJF A;  4I7C A;  3I2D A;  5B8D A;  2UZG A;  3KDE C;  3N9M A;  4YAD A;  1Z6U A;  1E4U A;  2EXU A;  5LKZ A;  1MM3 A;  3FM8 C;  3ZTG A;  5KH9 A;  5B77 A;  5B76 A;  5D1L B;  3O47 A;  2F6N A;  4R8P K;  3RPG C;  1LDK C;  1IYM A;  3FJU B;  3LQJ A;  3GV4 A;  1X4J A;  4MSX A;  3JUE A;  2G45 A;  2VPG A;  4IC3 A;  4YBT A;  3T9K A;  2FUU A;  5FER A;  1VD4 A;  2OWA A;  1T1H A;  2JMJ A;  2CON A;  2KGI A;  2MA5 A;  5B75 A;  4AP4 A;  2ECN A;  5FB0 A;  2VJE A;  1CHC A;  2YHO A;  4AYC B;  3LVR E;  2L7P A;  1MM2 A;  3O35 A;  1X4U A;  2Y1M A;  3DWD A;  3M99 A;  2H0D A;  2MA6 A;  1U6G B;  2ECT A;  3KQI A;  3O36 A;  3N9N A;  4QF2 A;  5B78 A;  4WZ2 A;  3SUB A;  2E6R A;  2YYR A;  2LN0 A;  3RTR B;  1MBM A;  2RI7 A;  1WES A;  2KGG A;  5TRB A;  2M6M A;  4AUQ B;  4UI9 B;  3HCU A;  4L7X A;  3C5K A;  2DX8 A;  2Y1N A;  3KV5 A;  4YBS A;  5LKT A;  2RR4 A;  4S3O C;  2LRI C;  5G0F A;  2P57 A;  2KR4 A;  5TDW A;  3L1X A;  2M85 A;  3O33 A;  2HYE D;  4BBQ A;  3L11 A;  3RPG B;  2KWJ A;  4GNE A;  3FAN A;  2RSD A;  2QIZ A;  4WZ0 A;  4AYC A;  3VK6 A;  2FSA A;  2L43 A;  3M62 A;  3V43 A;  3IHP A;  2ECW A;  4C9Z A;  2EGM A;  2LXP C;  2CRW A;  3KNV A;  2D8S A;  3MHH A;  4YAB A;  3EB6 A;  1XWH A;  2K1J A;  2B0O E;  2IQJ A;  3U5O A;  4UP5 A;  2L75 A;  5H1T A;  2YVR A;  1Z2Q A;  2KFT A;  2YSM A;  4V3L C;  5TBN A;  1VYX A;  3LDY A;  2IDA A;  2LAU A;  2CRR A;  2YHN A;  3HCS A;  5G04 B;  1WEM A;  2L0B A;  2XOY A;  3M63 A;  5LCW B;  2YUR A;  2MIQ A;  2KU3 A;  4YAX A;  4YC9 A;  2KWN A;  1JOC A;  4A49 A;  5H1U A;  3N9P A;  4LK9 A;  3NG2 A;  4LLB A;  2YUC A;  5TAB A;  1LDJ B;  2KWO A;  2MUM A;  3SOW A;  2FFW A;  2E61 A;  1G25 A;  2BAY A;  2QIC A;  5DIN A;  5TDR A;  2I50 A;  2VPB A;  4LJN A;  1FP0 A;  5H1V A;  3ZVZ B;  3U5N A;  2JMD A;  2VJF B;  2E6S A;  3ZPV 1;  3Q1D A;  2KKX A;  4O64 A;  5DKA A;  3ZYQ A;  4OGE A;  4YAT A;  3FEH A;  3HCT A;  3E2D A;  1WEU A;  1WIM A;  3O37 A;  2CKL B;  2K16 A;  2F42 A;  4GNG A;  2Y43 A;  2LV9 A;  4A4B A;  4B86 C;  5B79 A;  2YQM A;  2CSV A;  1V87 A;  4ZQL A;  4FK5 A;  2MD8 C;  5J3X A;  3T7L A;  1WE9 A;  4XI1 A;  2VP7 A;  3O7A A;  2H0D B;  4S3O B;  3LJU X;  1WFK A;  3GL6 A;  4ZDT A;  2LGK A;  2XOZ A;  4R7E A;  2DJA A;  2JM3 A;  2KIZ A;  5FEY A; 
#chains in the Genus database with same CATH homology
 2KRE A;  2L5U A;  5FB1 A;  3U5P A;  4BHW A;  1BOR A;  2LQ6 A;  2YW8 A;  2MD7 B;  2AN6 A;  3PUQ A;  5D1M B;  2F6J A;  4V3K C;  2PUY A;  2XB1 A;  4NN2 A;  5KH3 A;  1FBV A;  3N9L A;  5LKU A;  2XEU A;  3PHD A;  4P5O B;  2JMI A;  4A4C A;  1K2F A;  3LRQ A;  2CSY A;  4IC2 A;  4CCG X;  2YT5 A;  2EOD A;  4MVT A;  4N3W A;  1F62 A;  1WGM A;  2KWK A;  2CKL A;  5D1K B;  2MNY A;  2VJE B;  2YRE A;  5JG6 A;  4UP0 A;  2YSJ A;  2NAA A;  2ECJ A;  4FJC A;  4Q6F A;  3LQI A;  2EA6 A;  4LKA A;  2VNF A;  4I7D A;  4PTB A;  2ECV A;  2YU4 A;  2C2L A;  4LAD B;  1WEQ A;  2LDR A;  4CA1 A;  3FL2 A;  4W4U A;  5C13 A;  1JM7 A;  5I3L A;  2LXH C;  1HYI A;  3KV6 A;  5H9M A;  3QZV A;  2M1R A;  3SOX A;  1WIL A;  2KYU A;  2LGL A;  3O70 A;  3O34 A;  2LGG A;  1WEN A;  2ZET C;  4WZ3 B;  3T6R A;  1HYJ A;  5EYA F;  3HTK C;  1WEE A;  2ECI A;  2HDP A;  5AIT A;  2MNZ A;  2QJ0 A;  2VPE A;  2YQL A;  4TKP B;  2OXQ C;  1RMD A;  3EB5 A;  3ZPV E;  2L80 A;  5C11 A;  3ZVY A;  3C6W A;  1Z60 A;  4R2Y A;  4L58 A;  3N9Q A;  5KH7 A;  3DQV R;  4FIP A;  1WEP A;  4I7B A;  1ZBD B;  3N9O A;  4F52 B;  1WEV A;  1WEW A;  4N4F A;  3SOU A;  3U5M A;  2KE1 A;  3SHB A;  4A0C D;  4X3G A;  4FO9 A;  2CT2 A;  5LKX A;  4ZUX U;  3ASL A;  2JRJ A;  4YBM A;  2K4D A;  4B7Y C;  3MHS A;  5G05 B;  4AVX A;  3LQH A;  4GNF A;  5AIU A;  1JM7 B;  3L1Z B;  2FUI A;  2CSZ A;  1DVP A;  1N87 A;  2MT5 A;  2M3H A;  4WA6 A;  4GND A;  2K17 A;  2C2V S;  3DPL R;  3ZNI A;  1WEO A;  3PUR A;  1VFY A;  1X4I A;  4PPE A;  2VPD A;  2ECG A;  4QF3 A;  2PNX A;  2G6Q A;  2G43 A;  2EGP A;  2LGV A;  4GB0 A;  2VJF A;  4I7C A;  3I2D A;  5B8D A;  2UZG A;  3N9M A;  4YAD A;  1Z6U A;  1E4U A;  5LKZ A;  1MM3 A;  3ZTG A;  5KH9 A;  5B77 A;  5B76 A;  5D1L B;  2F6N A;  4R8P K;  3RPG C;  1LDK C;  1IYM A;  3LQJ A;  3GV4 A;  1X4J A;  4MSX A;  2G45 A;  2VPG A;  4IC3 A;  4YBT A;  2FUU A;  5FER A;  1VD4 A;  1T1H A;  2JMJ A;  2KGI A;  2MA5 A;  5B75 A;  4AP4 A;  2ECN A;  5FB0 A;  2VJE A;  1CHC A;  2YHO A;  4AYC B;  1MM2 A;  3O35 A;  1X4U A;  2Y1M A;  3M99 A;  2H0D A;  2MA6 A;  1U6G B;  2ECT A;  3KQI A;  3O36 A;  3N9N A;  4QF2 A;  5B78 A;  4WZ2 A;  2E6R A;  2YYR A;  2LN0 A;  3RTR B;  2RI7 A;  1WES A;  2KGG A;  5TRB A;  2M6M A;  4AUQ B;  4UI9 B;  3HCU A;  4L7X A;  3C5K A;  2DX8 A;  2Y1N A;  3KV5 A;  4YBS A;  5LKT A;  4S3O C;  2LRI C;  5G0F A;  2KR4 A;  5TDW A;  3L1X A;  2M85 A;  3O33 A;  2HYE D;  4BBQ A;  3L11 A;  3RPG B;  2KWJ A;  4GNE A;  2RSD A;  2QIZ A;  4WZ0 A;  4AYC A;  3VK6 A;  2FSA A;  2L43 A;  3M62 A;  3V43 A;  3IHP A;  2ECW A;  4C9Z A;  2LXP C;  3KNV A;  2D8S A;  3MHH A;  4YAB A;  3EB6 A;  1XWH A;  2K1J A;  3U5O A;  4UP5 A;  2L75 A;  5H1T A;  1Z2Q A;  2KFT A;  2YSM A;  4V3L C;  5TBN A;  1VYX A;  2IDA A;  2YHN A;  3HCS A;  5G04 B;  1WEM A;  2L0B A;  3M63 A;  5LCW B;  2YUR A;  2MIQ A;  2KU3 A;  4YAX A;  4YC9 A;  2KWN A;  1JOC A;  4A49 A;  5H1U A;  3N9P A;  4LK9 A;  3NG2 A;  4LLB A;  2YUC A;  5TAB A;  1LDJ B;  2KWO A;  2MUM A;  3SOW A;  1G25 A;  2BAY A;  2QIC A;  5DIN A;  5TDR A;  2I50 A;  2VPB A;  4LJN A;  3ZVZ B;  1FP0 A;  5H1V A;  3U5N A;  2JMD A;  2VJF B;  2E6S A;  3ZPV 1;  4O64 A;  5DKA A;  3ZYQ A;  4YAT A;  3HCT A;  1WEU A;  1WIM A;  3O37 A;  2CKL B;  2K16 A;  2F42 A;  4GNG A;  2Y43 A;  2LV9 A;  4A4B A;  4B86 C;  5B79 A;  2YQM A;  1V87 A;  4ZQL A;  4FK5 A;  2MD8 C;  5J3X A;  3T7L A;  1WE9 A;  4XI1 A;  2VP7 A;  3O7A A;  2H0D B;  4S3O B;  1WFK A;  3GL6 A;  4ZDT A;  2LGK A;  4R7E A;  2KIZ A;  5FEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...