1JM7B

Solution structure of the brca1/bard1 ring-domain heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
MEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a BRCA1-BARD1 heterodimeric RING-RING complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor
molecule keywords BREAST CANCER TYPE 1 SUSCEPTIBILITY PROTEIN
total genus 21
structure length 97
sequence length 97
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14835 zf-RING_6 zf-RING of BARD1-type protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1jm7B00
2LGGA 1X4UA 3MHHA 2K1JA 5EYAF 4GNDA 2QICA 2LGLA 2G43A 3O33A 4W4UA 2YURA 2K16A 3ZNIA 2M1RA 5D1MB 2MA6A 1FBVA 3EB6A 2LXPC 4AUQB 5B8DA 4YABA 2YQLA 2YUCA 4LADB 4C9ZA 2KE1A 2YQMA 4TKPB 3GL6A 2VPEA 5B76A 3C6WA 5LCWB 2KREA 3SOXA 2YT5A 4LJNA 1WEPA 5B75A 1MM2A 2CKLB 5H9MA 2MA5A 4IC2A 2PUYA 2K17A 3C5KA 3NG2A 3L11A 3L1XA 5KH7A 2G45A 1MM3A 2H0DA 3U5OA 5LKZA 4N4FA 2QIZA 2MNZA 5H1VA 2ECWA 4YBSA 4UP0A 4A0CD 4FO9A 5C13A 1LDKC 2Y43A 1JM7B 4L58A 2ECTA 3T6RA 4FJCA 2HDPA 3QZVA 4A49A 3SHBA 2LV9A 2CSYA 3EB5A 1X4IA 5TBNA 2MNYA 1Z60A 5KH9A 3O36A 4YBTA 2MT5A 2VJFA 3PHDA 5D1LB 2CT2A 2RI7A 5LKUA 5TDWA 2KWOA 4WZ3B 4ZDTA 4R7EA 4L7XA 2F6NA 2M85A 2F6JA 2YU4A 2KU3A 2MUMA 2EA6A 2KFTA 2L0BA 4NN2A 5DINA 1X4JA 2ZETC 3LQHA 2EGPA 1WEEA 1WEWA 1CHCA 2Y1NA 3DPLR 4YC9A 3O35A 2FUUA 3I2DA 5G04B 4XI1A 4LLBA 1WIMA 3V43A 4P5OB 3RPGC 2LXHC 2L80A 2YHNA 3M63A 2C2LA 2VPDA 2KWNA 4YBMA 2FUIA 4IC3A 3N9NA 1LDJB 4GNGA 2F42A 3N9PA 4R2YA 4S3OC 2E6RA 3O7AA 2RSDA 5TABA 3RTRB 5B79A 4CCGX 4AYCB 3HCSA 3T7LA 2G6QA 2KWJA 3PURA 2VP7A 2VNFA 4S3OB 2JMJA 2CSZA 3O70A 2BAYA 4LKAA 4PTBA 4B86C 1G25A 3ZPVE 2AN6A 3N9OA 4FK5A 3RPGB 3VK6A 3M62A 3L1ZB 2KYUA 4UP5A 3KV5A 2VJEA 1HYJA 1Z2QA 1WE9A 3O34A 1WFKA 4ZUXU 1JM7A 4I7DA 5FB0A 2C2VS 4GB0A 2LDRA 2KWKA 4V3LC 1F62A 1WEVA 5J3XA 3LQJA 4N3WA 3SOUA 5KH3A 4YATA 3ZVZB 1BORA 2LRIC 1WEQA 4YAXA 5FEYA 2MD7B 2L5UA 3HCUA 3DQVR 2MIQA 2FSAA 5I3LA 4Q6FA 3KQIA 4WA6A 2NAAA 4FIPA 4QF3A 2KGIA 4AP4A 2JRJA 2XEUA 2H0DB 5TDRA 3LRQA 4F52B 3U5PA 2ECIA 1V87A 2ECJA 2KIZA 5G0FA 2VPGA 2D8SA 3LQIA 2EODA 2CKLA 2OXQC 4R8PK 2E6SA 2LGKA 3N9LA 5FERA 2L43A 5LKTA 3FL2A 5AITA 4ZQLA 4QF2A 1IYMA 5G05B 1N87A 3ZYQA 4PPEA 4A4BA 1WEMA 1FP0A 5TRBA 2L75A 2K4DA 1DVPA 3IHPA 4MSXA 5C11A 2LQ6A 2M3HA 1WGMA 2VJFB 2JMDA 4B7YC 3KNVA 5D1KB 3ZPV1 5FB1A 1WENA 4MVTA 3U5MA 2PNXA 4WZ0A 4GNFA 2VJEB 4CA1A 1VFYA 1HYIA 5H1TA 1ZBDB 4GNEA 4BBQA 2QJ0A 2DX8A 3N9QA 4X3GA 5B78A 1WEOA 2MD8C 5H1UA 1WILA 4BHWA 5LKXA 2VPBA 3U5NA 2I50A 3MHSA 4AVXA 2KGGA 1E4UA 1K2FA 2YW8A 5JG6A 2ECGA 3N9MA 4AYCA 3M99A 1T1HA 4I7BA 1WESA 2YHOA 2LN0A 4A4CA 1RMDA 2M6MA 4V3KC 2Y1MA 4WZ2A 3ASLA 1Z6UA 2JMIA 1VYXA 2IDAA 2ECNA 2YSJA 4O64A 1XWHA 3KV6A 3ZVYA 1JOCA 2YSMA 2YYRA 1WEUA 4UI9B 3HTKC 5AIUA 2YREA 5DKAA 4YADA 3GV4A 3HCTA 2LGVA 2ECVA 2XB1A 2KR4A 3SOWA 1U6GB 4LK9A 2UZGA 1VD4A 2HYED 3ZTGA 3O37A 5B77A 4I7CA 3PUQA
chains in the Genus database with same CATH superfamily
2LGGA 1X4UA 3MHHA 2K1JA 5EYAF 4GNDA 2QICA 2LGLA 2G43A 3O33A 4W4UA 2JUNA 2YURA 2K16A 3ZNIA 3FAOA 2M1RA 5D1MB 2MA6A 1FBVA 3EB6A 3MDBC 2LXPC 4AUQB 5B8DA 4YABA 2YQLA 2YUCA 2MKEA 4LADB 4C9ZA 2D8UA 3DDTA 2KE1A 2YQMA 4TKPB 3GL6A 4Z0OA 2VPEA 3FANA 5B76A 3C6WA 5LCWB 2KREA 3SOXA 2YT5A 4LJNA 1WEPA 5B75A 1MM2A 2CKLB 5H9MA 2MA5A 4IC2A 2PUYA 2K17A 3C5KA 3NG2A 3L11A 3L1XA 5KH7A 2G45A 3PLWA 2IQJA 1MM3A 2H0DA 3U5OA 2CRRA 5LKZA 4N4FA 3O47A 2XOZA 2QIZA 2MNZA 5H1VA 4H9DA 4OGCA 2ECWA 4YBSA 4UP0A 4A0CD 4FO9A 5C13A 1LDKC 2Y43A 1JM7B 4L58A 2ECTA 3T6RA 4FJCA 2HDPA 3QZVA 4A49A 3SHBA 2LV9A 2CSYA 3EB5A 1X4IA 5TBNA 2MNYA 1Z60A 2KKXA 3O36A 5KH9A 4YBTA 2MT5A 2VJFA 3PHDA 5D1LB 2CT2A 2RI7A 5LKUA 5TDWA 2KWOA 3DWDA 4WZ3B 4ZDTA 4R7EA 4L7XA 2F6NA 2M85A 2F6JA 2YU4A 2KU3A 3Q1DA 2MUMA 2EA6A 2KFTA 2L0BA 4NN2A 5DINA 1X4JA 2ZETC 3LQHA 2EGPA 2RR4A 1WEEA 1WEWA 2EGMA 1CHCA 2Y1NA 3DPLR 4YC9A 3O35A 3KDEC 2FUUA 3I2DA 5G04B 4XI1A 4LLBA 2XOYA 1WIMA 3V43A 4P5OB 3RPGC 2LXHC 2CSVA 2L80A 2YHNA 3M63A 3FM8C 2C2LA 2VPDA 2KWNA 5SVIB 2FUIA 4YBMA 4IC3A 2LAUA 5SVYA 3N9NA 1LDJB 4GNGA 2F42A 3N9PA 4R2YA 2CRWA 4S3OC 2E6RA 3O7AA 2RSDA 2YVRA 5TABA 3RTRB 2B0OE 5B79A 3T7LA 3HCSA 4AYCB 4CCGX 2G6QA 2KWJA 4F1PA 3PURA 2VP7A 2VNFA 4S3OB 2JMJA 2XP0A 2E61A 2CSZA 3O70A 2BAYA 4LKAA 4PTBA 4Z0RA 2DJAA 4B86C 1G25A 3ZPVE 2AN6A 1DCQA 3N9OA 4FK5A 3RPGB 3VK6A 3M62A 3L1ZB 2KYUA 4UP5A 2JM3A 3KV5A 2VJEA 1HYJA 2FFWA 1Z2QA 1WE9A 3O34A 1WFKA 4ZUXU 1JM7A 4I7DA 5FB0A 2C2VS 4GB0A 2LDRA 2KWKA 4V3LC 3H7HA 1F62A 1WEVA 5J3XA 3LQJA 2EXUA 4N3WA 3SOUA 5KH3A 4YATA 3ZVZB 1BORA 2LRIC 2XOCA 1WEQA 4YAXA 5FEYA 2MD7B 2L5UA 3HCUA 3DQVR 2MIQA 2FSAA 3SUBA 5I3LA 4Q6FA 3FJUB 3KQIA 4WA6A 2NAAA 4FIPA 4QF3A 2CONA 2KGIA 4AP4A 2JRJA 2XEUA 2H0DB 5TDRA 3LRQA 4F52B 4OGEA 3U5PA 2ECIA 1V87A 2ECJA 2KIZA 5G0FA 2VPGA 2P57A 2D8SA 3LQIA 2EODA 2CKLA 2OXQC 4R8PK 2E6SA 2LGKA 3N9LA 5FERA 2L43A 5LKTA 3FL2A 5AITA 4ZQLA 4QF2A 3LJUX 1IYMA 5G05B 1N87A 3ZYQA 2M13A 4PPEA 2KKYA 4A4BA 1WEMA 1FP0A 5TRBA 2FD4A 2L75A 2K4DA 1DVPA 3IHPA 4MSXA 5C11A 3E2DA 2LQ6A 2M3HA 1WGMA 2VJFB 2JMDA 3T9KA 4B7YC 3KNVA 5D1KB 3ZPV1 5FB1A 1WENA 4MVTA 3U5MA 2PNXA 4WZ0A 4GNFA 2VJEB 4CA1A 1VFYA 1HYIA 5H1TA 1ZBDB 5SVIA 4GNEA 4BBQA 2QJ0A 2DX8A 3N9QA 4X3GA 5B78A 1WEOA 2MD8C 3LVQE 5H1UA 5K3QA 1WILA 4BHWA 3FEHA 5LKXA 2VPBA 3JUEA 3U5NA 2I50A 3MHSA 5SVXA 4AVXA 2KGGA 1E4UA 1K2FA 2YW8A 5JG6A 2OWAA 2ECGA 3N9MA 4AYCA 3M99A 1T1HA 4I7BA 1WESA 2YHOA 2LN0A 4A4CA 1RMDA 2M6MA 4V3KC 2Y1MA 4WZ2A 3M7KA 3ASLA 1Z6UA 2JMIA 4O62A 1VYXA 2IDAA 2ECNA 2YSJA 4O64A 1XWHA 3KV6A 3ZVYA 1JOCA 2YSMA 2DSMA 2YYRA 1WEUA 4UI9B 3HTKC 5AIUA 2YREA 5DKAA 4YADA 1MBMA 4QQ4A 3GV4A 3LVRE 3HCTA 2LGVA 2ECVA 2XB1A 2KR4A 3SOWA 2L7PA 1U6GB 4LK9A 2UZGA 1VD4A 2HYED 3ZTGA 3O37A 5B77A 3LDYA 4I7CA 3PUQA
chains in the Genus database with same CATH topology
2LGGA 1X4UA 3MHHA 2K1JA 5EYAF 4GNDA 2QICA 2LGLA 2G43A 3O33A 4W4UA 2YURA 2K16A 3ZNIA 2M1RA 5D1MB 2MA6A 1FBVA 3EB6A 2LXPC 4AUQB 5B8DA 4YABA 2YQLA 2YUCA 4LADB 4C9ZA 2KE1A 2YQMA 4TKPB 3GL6A 2VPEA 5B76A 3C6WA 5LCWB 2KREA 3SOXA 2YT5A 4LJNA 1WEPA 5B75A 1MM2A 2CKLB 5H9MA 2MA5A 4IC2A 2PUYA 2K17A 3C5KA 3NG2A 3L11A 3L1XA 5KH7A 2G45A 1MM3A 2H0DA 3U5OA 5LKZA 4N4FA 2QIZA 2MNZA 5H1VA 2ECWA 4YBSA 4UP0A 4A0CD 4FO9A 5C13A 1LDKC 2Y43A 1JM7B 4L58A 2ECTA 3T6RA 4FJCA 2HDPA 3QZVA 4A49A 3SHBA 2LV9A 2CSYA 3EB5A 1X4IA 5TBNA 2MNYA 1Z60A 5KH9A 3O36A 4YBTA 2MT5A 2VJFA 3PHDA 5D1LB 2CT2A 2RI7A 5LKUA 5TDWA 2KWOA 4WZ3B 4ZDTA 4R7EA 4L7XA 2F6NA 2M85A 2F6JA 2YU4A 2KU3A 2MUMA 2EA6A 2KFTA 2L0BA 4NN2A 5DINA 1X4JA 2ZETC 3LQHA 2EGPA 1WEEA 1WEWA 1CHCA 2Y1NA 3DPLR 4YC9A 3O35A 2FUUA 3I2DA 5G04B 4XI1A 4LLBA 1WIMA 3V43A 4P5OB 3RPGC 2LXHC 2L80A 2YHNA 3M63A 2C2LA 2VPDA 2KWNA 4YBMA 2FUIA 4IC3A 3N9NA 1LDJB 4GNGA 2F42A 3N9PA 4R2YA 4S3OC 2E6RA 3O7AA 2RSDA 5TABA 3RTRB 5B79A 4CCGX 4AYCB 3HCSA 3T7LA 2G6QA 2KWJA 3PURA 2VP7A 2VNFA 4S3OB 2JMJA 2CSZA 3O70A 2BAYA 4LKAA 4PTBA 4B86C 1G25A 3ZPVE 2AN6A 3N9OA 4FK5A 3RPGB 3VK6A 3M62A 3L1ZB 2KYUA 4UP5A 3KV5A 2VJEA 1HYJA 1Z2QA 1WE9A 3O34A 1WFKA 4ZUXU 1JM7A 4I7DA 5FB0A 2C2VS 4GB0A 2LDRA 2KWKA 4V3LC 1F62A 1WEVA 5J3XA 3LQJA 4N3WA 3SOUA 5KH3A 4YATA 3ZVZB 1BORA 2LRIC 1WEQA 4YAXA 5FEYA 2MD7B 2L5UA 3HCUA 3DQVR 2MIQA 2FSAA 5I3LA 4Q6FA 3KQIA 4WA6A 2NAAA 4FIPA 4QF3A 2KGIA 4AP4A 2JRJA 2XEUA 2H0DB 5TDRA 3LRQA 4F52B 3U5PA 2ECIA 1V87A 2ECJA 2KIZA 5G0FA 2VPGA 2D8SA 3LQIA 2EODA 2CKLA 2OXQC 4R8PK 2E6SA 2LGKA 3N9LA 5FERA 2L43A 5LKTA 3FL2A 5AITA 4ZQLA 4QF2A 1IYMA 5G05B 1N87A 3ZYQA 4PPEA 4A4BA 1WEMA 1FP0A 5TRBA 2L75A 2K4DA 1DVPA 3IHPA 4MSXA 5C11A 2LQ6A 2M3HA 1WGMA 2VJFB 2JMDA 4B7YC 3KNVA 5D1KB 3ZPV1 5FB1A 1WENA 4MVTA 3U5MA 2PNXA 4WZ0A 4GNFA 2VJEB 4CA1A 1VFYA 1HYIA 5H1TA 1ZBDB 4GNEA 4BBQA 2QJ0A 2DX8A 3N9QA 4X3GA 5B78A 1WEOA 2MD8C 5H1UA 1WILA 4BHWA 5LKXA 2VPBA 3U5NA 2I50A 3MHSA 4AVXA 2KGGA 1E4UA 1K2FA 2YW8A 5JG6A 2ECGA 3N9MA 4AYCA 3M99A 1T1HA 4I7BA 1WESA 2YHOA 2LN0A 4A4CA 1RMDA 2M6MA 4V3KC 2Y1MA 4WZ2A 3ASLA 1Z6UA 2JMIA 1VYXA 2IDAA 2ECNA 2YSJA 4O64A 1XWHA 3KV6A 3ZVYA 1JOCA 2YSMA 2YYRA 1WEUA 4UI9B 3HTKC 5AIUA 2YREA 5DKAA 4YADA 3GV4A 3HCTA 2LGVA 2ECVA 2XB1A 2KR4A 3SOWA 1U6GB 4LK9A 2UZGA 1VD4A 2HYED 3ZTGA 3O37A 5B77A 4I7CA 3PUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGG A;  1X4U A;  3MHH A;  2K1J A;  5EYA F;  4GND A;  2QIC A;  2LGL A;  2G43 A;  3O33 A;  4W4U A;  2YUR A;  2K16 A;  3ZNI A;  2M1R A;  5D1M B;  2MA6 A;  1FBV A;  3EB6 A;  2LXP C;  4AUQ B;  5B8D A;  4YAB A;  2YQL A;  2YUC A;  4LAD B;  4C9Z A;  2KE1 A;  2YQM A;  4TKP B;  3GL6 A;  2VPE A;  5B76 A;  3C6W A;  5LCW B;  2KRE A;  3SOX A;  2YT5 A;  4LJN A;  1WEP A;  5B75 A;  1MM2 A;  2CKL B;  5H9M A;  2MA5 A;  4IC2 A;  2PUY A;  2K17 A;  3C5K A;  3NG2 A;  3L11 A;  3L1X A;  5KH7 A;  2G45 A;  1MM3 A;  2H0D A;  3U5O A;  5LKZ A;  4N4F A;  2QIZ A;  2MNZ A;  5H1V A;  2ECW A;  4YBS A;  4UP0 A;  4A0C D;  4FO9 A;  5C13 A;  1LDK C;  2Y43 A;  1JM7 B;  4L58 A;  2ECT A;  3T6R A;  4FJC A;  2HDP A;  3QZV A;  4A49 A;  3SHB A;  2LV9 A;  2CSY A;  3EB5 A;  1X4I A;  5TBN A;  2MNY A;  1Z60 A;  5KH9 A;  3O36 A;  4YBT A;  2MT5 A;  2VJF A;  3PHD A;  5D1L B;  2CT2 A;  2RI7 A;  5LKU A;  5TDW A;  2KWO A;  4WZ3 B;  4ZDT A;  4R7E A;  4L7X A;  2F6N A;  2M85 A;  2F6J A;  2YU4 A;  2KU3 A;  2MUM A;  2EA6 A;  2KFT A;  2L0B A;  4NN2 A;  5DIN A;  1X4J A;  2ZET C;  3LQH A;  2EGP A;  1WEE A;  1WEW A;  1CHC A;  2Y1N A;  3DPL R;  4YC9 A;  3O35 A;  2FUU A;  3I2D A;  5G04 B;  4XI1 A;  4LLB A;  1WIM A;  3V43 A;  4P5O B;  3RPG C;  2LXH C;  2L80 A;  2YHN A;  3M63 A;  2C2L A;  2VPD A;  2KWN A;  4YBM A;  2FUI A;  4IC3 A;  3N9N A;  1LDJ B;  4GNG A;  2F42 A;  3N9P A;  4R2Y A;  4S3O C;  2E6R A;  3O7A A;  2RSD A;  5TAB A;  3RTR B;  5B79 A;  4CCG X;  4AYC B;  3HCS A;  3T7L A;  2G6Q A;  2KWJ A;  3PUR A;  2VP7 A;  2VNF A;  4S3O B;  2JMJ A;  2CSZ A;  3O70 A;  2BAY A;  4LKA A;  4PTB A;  4B86 C;  1G25 A;  3ZPV E;  2AN6 A;  3N9O A;  4FK5 A;  3RPG B;  3VK6 A;  3M62 A;  3L1Z B;  2KYU A;  4UP5 A;  3KV5 A;  2VJE A;  1HYJ A;  1Z2Q A;  1WE9 A;  3O34 A;  1WFK A;  4ZUX U;  1JM7 A;  4I7D A;  5FB0 A;  2C2V S;  4GB0 A;  2LDR A;  2KWK A;  4V3L C;  1F62 A;  1WEV A;  5J3X A;  3LQJ A;  4N3W A;  3SOU A;  5KH3 A;  4YAT A;  3ZVZ B;  1BOR A;  2LRI C;  1WEQ A;  4YAX A;  5FEY A;  2MD7 B;  2L5U A;  3HCU A;  3DQV R;  2MIQ A;  2FSA A;  5I3L A;  4Q6F A;  3KQI A;  4WA6 A;  2NAA A;  4FIP A;  4QF3 A;  2KGI A;  4AP4 A;  2JRJ A;  2XEU A;  2H0D B;  5TDR A;  3LRQ A;  4F52 B;  3U5P A;  2ECI A;  1V87 A;  2ECJ A;  2KIZ A;  5G0F A;  2VPG A;  2D8S A;  3LQI A;  2EOD A;  2CKL A;  2OXQ C;  4R8P K;  2E6S A;  2LGK A;  3N9L A;  5FER A;  2L43 A;  5LKT A;  3FL2 A;  5AIT A;  4ZQL A;  4QF2 A;  1IYM A;  5G05 B;  1N87 A;  3ZYQ A;  4PPE A;  4A4B A;  1WEM A;  1FP0 A;  5TRB A;  2L75 A;  2K4D A;  1DVP A;  3IHP A;  4MSX A;  5C11 A;  2LQ6 A;  2M3H A;  1WGM A;  2VJF B;  2JMD A;  4B7Y C;  3KNV A;  5D1K B;  3ZPV 1;  5FB1 A;  1WEN A;  4MVT A;  3U5M A;  2PNX A;  4WZ0 A;  4GNF A;  2VJE B;  4CA1 A;  1VFY A;  1HYI A;  5H1T A;  1ZBD B;  4GNE A;  4BBQ A;  2QJ0 A;  2DX8 A;  3N9Q A;  4X3G A;  5B78 A;  1WEO A;  2MD8 C;  5H1U A;  1WIL A;  4BHW A;  5LKX A;  2VPB A;  3U5N A;  2I50 A;  3MHS A;  4AVX A;  2KGG A;  1E4U A;  1K2F A;  2YW8 A;  5JG6 A;  2ECG A;  3N9M A;  4AYC A;  3M99 A;  1T1H A;  4I7B A;  1WES A;  2YHO A;  2LN0 A;  4A4C A;  1RMD A;  2M6M A;  4V3K C;  2Y1M A;  4WZ2 A;  3ASL A;  1Z6U A;  2JMI A;  1VYX A;  2IDA A;  2ECN A;  2YSJ A;  4O64 A;  1XWH A;  3KV6 A;  3ZVY A;  1JOC A;  2YSM A;  2YYR A;  1WEU A;  4UI9 B;  3HTK C;  5AIU A;  2YRE A;  5DKA A;  4YAD A;  3GV4 A;  3HCT A;  2LGV A;  2ECV A;  2XB1 A;  2KR4 A;  3SOW A;  1U6G B;  4LK9 A;  2UZG A;  1VD4 A;  2HYE D;  3ZTG A;  3O37 A;  5B77 A;  4I7C A;  3PUQ A; 
#chains in the Genus database with same CATH topology
 2LGG A;  1X4U A;  3MHH A;  2K1J A;  5EYA F;  4GND A;  2QIC A;  2LGL A;  2G43 A;  3O33 A;  4W4U A;  2JUN A;  2YUR A;  2K16 A;  3ZNI A;  3FAO A;  2M1R A;  5D1M B;  2MA6 A;  1FBV A;  3EB6 A;  3MDB C;  2LXP C;  4AUQ B;  5B8D A;  4YAB A;  2YQL A;  2YUC A;  2MKE A;  4LAD B;  4C9Z A;  2D8U A;  3DDT A;  2KE1 A;  2YQM A;  4TKP B;  3GL6 A;  4Z0O A;  2VPE A;  3FAN A;  5B76 A;  3C6W A;  5LCW B;  2KRE A;  3SOX A;  2YT5 A;  4LJN A;  1WEP A;  5B75 A;  1MM2 A;  2CKL B;  5H9M A;  2MA5 A;  4IC2 A;  2PUY A;  2K17 A;  3C5K A;  3NG2 A;  3L11 A;  3L1X A;  5KH7 A;  2G45 A;  3PLW A;  2IQJ A;  1MM3 A;  2H0D A;  3U5O A;  2CRR A;  5LKZ A;  4N4F A;  3O47 A;  2XOZ A;  2QIZ A;  2MNZ A;  5H1V A;  4H9D A;  4OGC A;  2ECW A;  4YBS A;  4UP0 A;  4A0C D;  4FO9 A;  5C13 A;  1LDK C;  2Y43 A;  1JM7 B;  4L58 A;  2ECT A;  3T6R A;  4FJC A;  2HDP A;  3QZV A;  4A49 A;  3SHB A;  2LV9 A;  2CSY A;  3EB5 A;  1X4I A;  5TBN A;  2MNY A;  1Z60 A;  2KKX A;  3O36 A;  5KH9 A;  4YBT A;  2MT5 A;  2VJF A;  3PHD A;  5D1L B;  2CT2 A;  2RI7 A;  5LKU A;  5TDW A;  2KWO A;  3DWD A;  4WZ3 B;  4ZDT A;  4R7E A;  4L7X A;  2F6N A;  2M85 A;  2F6J A;  2YU4 A;  2KU3 A;  3Q1D A;  2MUM A;  2EA6 A;  2KFT A;  2L0B A;  4NN2 A;  5DIN A;  1X4J A;  2ZET C;  3LQH A;  2EGP A;  2RR4 A;  1WEE A;  1WEW A;  2EGM A;  1CHC A;  2Y1N A;  3DPL R;  4YC9 A;  3O35 A;  3KDE C;  2FUU A;  3I2D A;  5G04 B;  4XI1 A;  4LLB A;  2XOY A;  1WIM A;  3V43 A;  4P5O B;  3RPG C;  2LXH C;  2CSV A;  2L80 A;  2YHN A;  3M63 A;  3FM8 C;  2C2L A;  2VPD A;  2KWN A;  5SVI B;  2FUI A;  4YBM A;  4IC3 A;  2LAU A;  5SVY A;  3N9N A;  1LDJ B;  4GNG A;  2F42 A;  3N9P A;  4R2Y A;  2CRW A;  4S3O C;  2E6R A;  3O7A A;  2RSD A;  2YVR A;  5TAB A;  3RTR B;  2B0O E;  5B79 A;  3T7L A;  3HCS A;  4AYC B;  4CCG X;  2G6Q A;  2KWJ A;  4F1P A;  3PUR A;  2VP7 A;  2VNF A;  4S3O B;  2JMJ A;  2XP0 A;  2E61 A;  2CSZ A;  3O70 A;  2BAY A;  4LKA A;  4PTB A;  4Z0R A;  2DJA A;  4B86 C;  1G25 A;  3ZPV E;  2AN6 A;  1DCQ A;  3N9O A;  4FK5 A;  3RPG B;  3VK6 A;  3M62 A;  3L1Z B;  2KYU A;  4UP5 A;  2JM3 A;  3KV5 A;  2VJE A;  1HYJ A;  2FFW A;  1Z2Q A;  1WE9 A;  3O34 A;  1WFK A;  4ZUX U;  1JM7 A;  4I7D A;  5FB0 A;  2C2V S;  4GB0 A;  2LDR A;  2KWK A;  4V3L C;  3H7H A;  1F62 A;  1WEV A;  5J3X A;  3LQJ A;  2EXU A;  4N3W A;  3SOU A;  5KH3 A;  4YAT A;  3ZVZ B;  1BOR A;  2LRI C;  2XOC A;  1WEQ A;  4YAX A;  5FEY A;  2MD7 B;  2L5U A;  3HCU A;  3DQV R;  2MIQ A;  2FSA A;  3SUB A;  5I3L A;  4Q6F A;  3FJU B;  3KQI A;  4WA6 A;  2NAA A;  4FIP A;  4QF3 A;  2CON A;  2KGI A;  4AP4 A;  2JRJ A;  2XEU A;  2H0D B;  5TDR A;  3LRQ A;  4F52 B;  4OGE A;  3U5P A;  2ECI A;  1V87 A;  2ECJ A;  2KIZ A;  5G0F A;  2VPG A;  2P57 A;  2D8S A;  3LQI A;  2EOD A;  2CKL A;  2OXQ C;  4R8P K;  2E6S A;  2LGK A;  3N9L A;  5FER A;  2L43 A;  5LKT A;  3FL2 A;  5AIT A;  4ZQL A;  4QF2 A;  3LJU X;  1IYM A;  5G05 B;  1N87 A;  3ZYQ A;  2M13 A;  4PPE A;  2KKY A;  4A4B A;  1WEM A;  1FP0 A;  5TRB A;  2FD4 A;  2L75 A;  2K4D A;  1DVP A;  3IHP A;  4MSX A;  5C11 A;  3E2D A;  2LQ6 A;  2M3H A;  1WGM A;  2VJF B;  2JMD A;  3T9K A;  4B7Y C;  3KNV A;  5D1K B;  3ZPV 1;  5FB1 A;  1WEN A;  4MVT A;  3U5M A;  2PNX A;  4WZ0 A;  4GNF A;  2VJE B;  4CA1 A;  1VFY A;  1HYI A;  5H1T A;  1ZBD B;  5SVI A;  4GNE A;  4BBQ A;  2QJ0 A;  2DX8 A;  3N9Q A;  4X3G A;  5B78 A;  1WEO A;  2MD8 C;  3LVQ E;  5H1U A;  5K3Q A;  1WIL A;  4BHW A;  3FEH A;  5LKX A;  2VPB A;  3JUE A;  3U5N A;  2I50 A;  3MHS A;  5SVX A;  4AVX A;  2KGG A;  1E4U A;  1K2F A;  2YW8 A;  5JG6 A;  2OWA A;  2ECG A;  3N9M A;  4AYC A;  3M99 A;  1T1H A;  4I7B A;  1WES A;  2YHO A;  2LN0 A;  4A4C A;  1RMD A;  2M6M A;  4V3K C;  2Y1M A;  4WZ2 A;  3M7K A;  3ASL A;  1Z6U A;  2JMI A;  4O62 A;  1VYX A;  2IDA A;  2ECN A;  2YSJ A;  4O64 A;  1XWH A;  3KV6 A;  3ZVY A;  1JOC A;  2YSM A;  2DSM A;  2YYR A;  1WEU A;  4UI9 B;  3HTK C;  5AIU A;  2YRE A;  5DKA A;  4YAD A;  1MBM A;  4QQ4 A;  3GV4 A;  3LVR E;  3HCT A;  2LGV A;  2ECV A;  2XB1 A;  2KR4 A;  3SOW A;  2L7P A;  1U6G B;  4LK9 A;  2UZG A;  1VD4 A;  2HYE D;  3ZTG A;  3O37 A;  5B77 A;  3LDY A;  4I7C A;  3PUQ A; 
#chains in the Genus database with same CATH homology
 2LGG A;  1X4U A;  3MHH A;  2K1J A;  5EYA F;  4GND A;  2QIC A;  2LGL A;  2G43 A;  3O33 A;  4W4U A;  2YUR A;  2K16 A;  3ZNI A;  2M1R A;  5D1M B;  2MA6 A;  1FBV A;  3EB6 A;  2LXP C;  4AUQ B;  5B8D A;  4YAB A;  2YQL A;  2YUC A;  4LAD B;  4C9Z A;  2KE1 A;  2YQM A;  4TKP B;  3GL6 A;  2VPE A;  5B76 A;  3C6W A;  5LCW B;  2KRE A;  3SOX A;  2YT5 A;  4LJN A;  1WEP A;  5B75 A;  1MM2 A;  2CKL B;  5H9M A;  2MA5 A;  4IC2 A;  2PUY A;  2K17 A;  3C5K A;  3NG2 A;  3L11 A;  3L1X A;  5KH7 A;  2G45 A;  1MM3 A;  2H0D A;  3U5O A;  5LKZ A;  4N4F A;  2QIZ A;  2MNZ A;  5H1V A;  2ECW A;  4YBS A;  4UP0 A;  4A0C D;  4FO9 A;  5C13 A;  1LDK C;  2Y43 A;  1JM7 B;  4L58 A;  2ECT A;  3T6R A;  4FJC A;  2HDP A;  3QZV A;  4A49 A;  3SHB A;  2LV9 A;  2CSY A;  3EB5 A;  1X4I A;  5TBN A;  2MNY A;  1Z60 A;  5KH9 A;  3O36 A;  4YBT A;  2MT5 A;  2VJF A;  3PHD A;  5D1L B;  2CT2 A;  2RI7 A;  5LKU A;  5TDW A;  2KWO A;  4WZ3 B;  4ZDT A;  4R7E A;  4L7X A;  2F6N A;  2M85 A;  2F6J A;  2YU4 A;  2KU3 A;  2MUM A;  2EA6 A;  2KFT A;  2L0B A;  4NN2 A;  5DIN A;  1X4J A;  2ZET C;  3LQH A;  2EGP A;  1WEE A;  1WEW A;  1CHC A;  2Y1N A;  3DPL R;  4YC9 A;  3O35 A;  2FUU A;  3I2D A;  5G04 B;  4XI1 A;  4LLB A;  1WIM A;  3V43 A;  4P5O B;  3RPG C;  2LXH C;  2L80 A;  2YHN A;  3M63 A;  2C2L A;  2VPD A;  2KWN A;  4YBM A;  2FUI A;  4IC3 A;  3N9N A;  1LDJ B;  4GNG A;  2F42 A;  3N9P A;  4R2Y A;  4S3O C;  2E6R A;  3O7A A;  2RSD A;  5TAB A;  3RTR B;  5B79 A;  4CCG X;  4AYC B;  3HCS A;  3T7L A;  2G6Q A;  2KWJ A;  3PUR A;  2VP7 A;  2VNF A;  4S3O B;  2JMJ A;  2CSZ A;  3O70 A;  2BAY A;  4LKA A;  4PTB A;  4B86 C;  1G25 A;  3ZPV E;  2AN6 A;  3N9O A;  4FK5 A;  3RPG B;  3VK6 A;  3M62 A;  3L1Z B;  2KYU A;  4UP5 A;  3KV5 A;  2VJE A;  1HYJ A;  1Z2Q A;  1WE9 A;  3O34 A;  1WFK A;  4ZUX U;  1JM7 A;  4I7D A;  5FB0 A;  2C2V S;  4GB0 A;  2LDR A;  2KWK A;  4V3L C;  1F62 A;  1WEV A;  5J3X A;  3LQJ A;  4N3W A;  3SOU A;  5KH3 A;  4YAT A;  3ZVZ B;  1BOR A;  2LRI C;  1WEQ A;  4YAX A;  5FEY A;  2MD7 B;  2L5U A;  3HCU A;  3DQV R;  2MIQ A;  2FSA A;  5I3L A;  4Q6F A;  3KQI A;  4WA6 A;  2NAA A;  4FIP A;  4QF3 A;  2KGI A;  4AP4 A;  2JRJ A;  2XEU A;  2H0D B;  5TDR A;  3LRQ A;  4F52 B;  3U5P A;  2ECI A;  1V87 A;  2ECJ A;  2KIZ A;  5G0F A;  2VPG A;  2D8S A;  3LQI A;  2EOD A;  2CKL A;  2OXQ C;  4R8P K;  2E6S A;  2LGK A;  3N9L A;  5FER A;  2L43 A;  5LKT A;  3FL2 A;  5AIT A;  4ZQL A;  4QF2 A;  1IYM A;  5G05 B;  1N87 A;  3ZYQ A;  4PPE A;  4A4B A;  1WEM A;  1FP0 A;  5TRB A;  2L75 A;  2K4D A;  1DVP A;  3IHP A;  4MSX A;  5C11 A;  2LQ6 A;  2M3H A;  1WGM A;  2VJF B;  2JMD A;  4B7Y C;  3KNV A;  5D1K B;  3ZPV 1;  5FB1 A;  1WEN A;  4MVT A;  3U5M A;  2PNX A;  4WZ0 A;  4GNF A;  2VJE B;  4CA1 A;  1VFY A;  1HYI A;  5H1T A;  1ZBD B;  4GNE A;  4BBQ A;  2QJ0 A;  2DX8 A;  3N9Q A;  4X3G A;  5B78 A;  1WEO A;  2MD8 C;  5H1U A;  1WIL A;  4BHW A;  5LKX A;  2VPB A;  3U5N A;  2I50 A;  3MHS A;  4AVX A;  2KGG A;  1E4U A;  1K2F A;  2YW8 A;  5JG6 A;  2ECG A;  3N9M A;  4AYC A;  3M99 A;  1T1H A;  4I7B A;  1WES A;  2YHO A;  2LN0 A;  4A4C A;  1RMD A;  2M6M A;  4V3K C;  2Y1M A;  4WZ2 A;  3ASL A;  1Z6U A;  2JMI A;  1VYX A;  2IDA A;  2ECN A;  2YSJ A;  4O64 A;  1XWH A;  3KV6 A;  3ZVY A;  1JOC A;  2YSM A;  2YYR A;  1WEU A;  4UI9 B;  3HTK C;  5AIU A;  2YRE A;  5DKA A;  4YAD A;  3GV4 A;  3HCT A;  2LGV A;  2ECV A;  2XB1 A;  2KR4 A;  3SOW A;  1U6G B;  4LK9 A;  2UZG A;  1VD4 A;  2HYE D;  3ZTG A;  3O37 A;  5B77 A;  4I7C A;  3PUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...