1JM7B

Solution structure of the brca1/bard1 ring-domain heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
b'MEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BREAST CANCER TYPE 1 SUSCEPTIBILITY PROTEIN
publication title Structure of a BRCA1-BARD1 heterodimeric RING-RING complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor
total genus 21
structure length 97
sequence length 97
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14835 zf-RING_6 zf-RING of BARD1-type protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1jm7B00
3ASLA 1WFKA 4LJNA 2EGPA 2G43A 2L80A 2M85A 2KU3A 3IHPA 2FSAA 4L7XA 4YATA 1WEWA 2Y1MA 2XEUA 4WA6A 3N9NA 3RPGC 2CKLB 2ECTA 3M99A 1WESA 2VJFA 3HCTA 1HYIA 2L0BA 2CSZA 4GNDA 3MHSA 3PHDA 2HYED 4R2YA 4BBQA 4WZ2A 3LQJA 1E4UA 2KWKA 2YYRA 5FEYA 1VYXA 1WEOA 3T6RA 1VFYA 2CSYA 4FIPA 2M3HA 5B78A 2LQ6A 5J3XA 1K2FA 2LXHC 4I7DA 3EB5A 1JM7A 1N87A 3O34A 1IYMA 4NN2A 2MNYA 4A4BA 2ECIA 1JOCA 1VD4A 3DQVR 4N4FA 1WEMA 2M6MA 2LGLA 4A49A 2LDRA 4ZUXU 1WIMA 4TKPB 5FB1A 3U5PA 2KR4A 3HCUA 3N9MA 3KQIA 3L1ZB 5TABA 2VJFB 5KH7A 1HYJA 2JMDA 1RMDA 4GNEA 4PTBA 2VPGA 4L58A 4S3OB 2PUYA 2KREA 2G6QA 2K4DA 4F52B 4XI1A 5D1LB 2LGVA 4LADB 4UP0A 1T1HA 2K17A 2KFTA 1X4JA 3T7LA 2C2VS 2LXPC 4FJCA 3SHBA 2QJ0A 4YBSA 1MM3A 1F62A 3NG2A 5EYAF 3LQIA 3U5NA 2ECWA 3ZPVE 1WEQA 4IC2A 2E6RA 4V3LC 1JM7B 2KYUA 2E6SA 4MVTA 5B76A 4BHWA 2YUCA 1WILA 2LRIC 1Z6UA 1Z60A 3RTRB 5B79A 4GNFA 3C5KA 3KV5A 3HCSA 2L43A 4R8PK 4R7EA 2G45A 2FUUA 2L5UA 5DINA 3N9PA 2FUIA 2MUMA 3O35A 2EA6A 2VJEA 4IC3A 2NAAA 4YABA 1Z2QA 3ZVYA 5G0FA 2RSDA 3O70A 4GNGA 1X4UA 1WGMA 4FO9A 2VPEA 2YREA 3I2DA 3FL2A 1U6GB 3N9OA 3SOXA 5LKXA 5LKUA 2LGGA 3ZYQA 1WE9A 2YSJA 2MNZA 2LGKA 1WEVA 2K1JA 2ECVA 1WEUA 2HDPA 4AVXA 2KWOA 5TDWA 1V87A 3U5OA 3N9LA 1CHCA 5I3LA 2VNFA 2QIZA 1X4IA 1BORA 4LK9A 4QF2A 2K16A 2JMIA 1FP0A 2CT2A 3LQHA 2LN0A 4ZQLA 2KGIA 1LDJB 2I50A 4LKAA 1WEPA 3MHHA 5FERA 4FK5A 2YT5A 2MA6A 4ZDTA 3KV6A 1WEEA 2D8SA 4YC9A 2ZETC 3O37A 4UP5A 4N3WA 4CA1A 4GB0A 4CCGX 2IDAA 2VJEB 5G05B 2YHNA 3QZVA 2KWJA 3M63A 2YSMA 4AYCA 2ECJA 3L1XA 2LV9A 3O36A 3ZVZB 2ECNA 3M62A 3N9QA 2KWNA 4AP4A 2KE1A 3GV4A 5H1TA 5B75A 2ECGA 4YBMA 2JRJA 5LKZA 2OXQC 3HTKC 2QICA 4A4CA 2VPDA 3EB6A 5D1MB 1MM2A 3L11A 4V3KC 2YHOA 5H1VA 2MA5A 2YW8A 4WZ3B 2MD8C 4I7BA 2VPBA 4MSXA 5KH9A 5H1UA 3O33A 4I7CA 5TBNA 2YQMA 2BAYA 5LCWB 3KNVA 3U5MA 4YAXA 4X3GA 2MT5A 4P5OB 2XB1A 2H0DA 5LKTA 2KIZA 2M1RA 2F6NA 5FB0A 5G04B 3GL6A 4S3OC 3SOUA 1LDKC 3ZPV1 5C13A 1XWHA 2PNXA 4AUQB 1FBVA 4WZ0A 5JG6A 5DKAA 2Y43A 2AN6A 5B77A 1WENA 2YQLA 4AYCB 1ZBDB 2VP7A 3DPLR 1DVPA 4A0CD 2DX8A 4Q6FA 4PPEA 3LRQA 5TDRA 3O7AA 4O64A 4YADA 1G25A 4B86C 2CKLA 2UZGA 4C9ZA 5C11A 3RPGB 3PUQA 5TRBA 2JMJA 3VK6A 5H9MA 5B8DA 3SOWA 4QF3A 3C6WA 5AIUA 2MD7B 2Y1NA 3PURA 2C2LA 5KH3A 2F42A 3ZTGA 3V43A 4W4UA 2MIQA 2KGGA 4LLBA 5D1KB 4YBTA 4B7YC 2YU4A 2H0DB 3ZNIA 5AITA 2YURA 2RI7A 2F6JA 2L75A 2EODA 4UI9B
chains in the Genus database with same CATH superfamily
3ASLA 1WFKA 4LJNA 2EGPA 2G43A 4OGCA 2L80A 2IQJA 2M85A 2KU3A 3IHPA 2FSAA 4L7XA 4YATA 3JUEA 1WEWA 2DSMA 2Y1MA 2XEUA 4WA6A 3N9NA 3RPGC 2CKLB 2ECTA 3M99A 1WESA 2VJFA 3HCTA 1HYIA 2L0BA 2CSZA 4GNDA 3MHSA 3PHDA 2E61A 2OWAA 2HYED 4R2YA 4BBQA 5K3QA 4WZ2A 3LQJA 2EXUA 1E4UA 2KWKA 2YYRA 5FEYA 1VYXA 1WEOA 3T6RA 2KKYA 1VFYA 2CSYA 4FIPA 2M3HA 4OGEA 5B78A 2LQ6A 5J3XA 1K2FA 1MBMA 2LXHC 4I7DA 3EB5A 1JM7A 1N87A 3O34A 3KDEC 1IYMA 4NN2A 2MNYA 4A4BA 2ECIA 1JOCA 1VD4A 3DQVR 4N4FA 1WEMA 2M6MA 3LVRE 2DJAA 2LGLA 4A49A 2LDRA 4ZUXU 1WIMA 3FJUB 4TKPB 5FB1A 3U5PA 2KR4A 3HCUA 3N9MA 3KQIA 3L1ZB 5TABA 2VJFB 5KH7A 1HYJA 2JMDA 1RMDA 4GNEA 4PTBA 2VPGA 4L58A 4O62A 4S3OB 2PUYA 2KREA 2G6QA 2K4DA 2KKXA 4F52B 4XI1A 5D1LB 2LGVA 5SVYA 4LADB 4UP0A 1T1HA 2K17A 2KFTA 2RR4A 1X4JA 2XP0A 3T7LA 2C2VS 2LXPC 4FJCA 3SHBA 2QJ0A 4YBSA 1MM3A 1F62A 3NG2A 5EYAF 3LQIA 2EGMA 3U5NA 2ECWA 3ZPVE 1WEQA 4IC2A 2E6RA 2XOZA 4V3LC 1JM7B 2KYUA 2E6SA 4MVTA 5B76A 4BHWA 2YUCA 1WILA 2LRIC 2CSVA 1Z6UA 1Z60A 3RTRB 5B79A 4GNFA 3C5KA 3KV5A 3HCSA 2L43A 4R8PK 4R7EA 2G45A 3O47A 2FUUA 2L5UA 5DINA 3N9PA 2CRWA 2FUIA 2MUMA 3O35A 2CONA 2EA6A 2VJEA 1DCQA 4IC3A 2NAAA 4YABA 1Z2QA 3ZVYA 3LDYA 5G0FA 2RSDA 3E2DA 3O70A 4GNGA 1X4UA 1WGMA 4FO9A 2VPEA 3FANA 2YREA 3I2DA 3FL2A 1U6GB 3N9OA 3SOXA 5LKXA 5LKUA 2LGGA 2CRRA 3ZYQA 1WE9A 2YSJA 2MNZA 2LGKA 1WEVA 2K1JA 2ECVA 1WEUA 2B0OE 2HDPA 4AVXA 3FM8C 2KWOA 2MKEA 5TDWA 1V87A 3U5OA 3N9LA 1CHCA 2JM3A 5I3LA 2VNFA 2QIZA 1X4IA 1BORA 4LK9A 4QF2A 2K16A 2JMIA 1FP0A 2CT2A 3LQHA 4H9DA 2LN0A 3FAOA 4ZQLA 2KGIA 2P57A 1LDJB 2I50A 4LKAA 3M7KA 1WEPA 3MHHA 5FERA 4FK5A 2YT5A 2D8UA 2MA6A 4Z0RA 3DDTA 2LAUA 4ZDTA 3KV6A 1WEEA 2D8SA 4YC9A 2ZETC 3O37A 4UP5A 3H7HA 4N3WA 4CA1A 4GB0A 4CCGX 2IDAA 2VJEB 5G05B 2YHNA 3QZVA 2KWJA 3M63A 2YSMA 5SVIA 4AYCA 2FD4A 2ECJA 3L1XA 2LV9A 3O36A 3ZVZB 2ECNA 3M62A 3N9QA 2KWNA 4AP4A 3LVQE 2KE1A 3GV4A 5H1TA 5B75A 2ECGA 4YBMA 2XOYA 2JRJA 5LKZA 2OXQC 3HTKC 2QICA 4A4CA 2VPDA 3EB6A 5D1MB 1MM2A 3Q1DA 3L11A 4V3KC 2YHOA 5H1VA 2MA5A 2YW8A 4WZ3B 2MD8C 3SUBA 4I7BA 2VPBA 4MSXA 5KH9A 5H1UA 3O33A 4I7CA 5TBNA 2YQMA 2BAYA 5LCWB 3KNVA 3U5MA 4YAXA 4X3GA 2MT5A 4P5OB 2XB1A 2H0DA 5LKTA 2KIZA 2M1RA 2F6NA 5FB0A 5G04B 3GL6A 4S3OC 3SOUA 1LDKC 5SVXA 3ZPV1 5C13A 1XWHA 2L7PA 2PNXA 4AUQB 1FBVA 4WZ0A 5JG6A 5DKAA 3FEHA 2Y43A 3LJUX 2AN6A 5SVIB 4F1PA 5B77A 1WENA 2YQLA 4AYCB 1ZBDB 2VP7A 3DPLR 1DVPA 3DWDA 4A0CD 2DX8A 4Q6FA 3PLWA 4PPEA 3LRQA 5TDRA 3O7AA 4O64A 4YADA 1G25A 4B86C 2CKLA 2UZGA 2YVRA 4C9ZA 5C11A 3RPGB 2FFWA 3PUQA 5TRBA 2JMJA 3VK6A 5H9MA 5B8DA 2JUNA 3SOWA 4QF3A 3C6WA 5AIUA 2XOCA 2MD7B 2Y1NA 3PURA 2C2LA 3T9KA 5KH3A 2F42A 3ZTGA 3V43A 4W4UA 2MIQA 4Z0OA 2KGGA 4LLBA 5D1KB 4YBTA 4B7YC 2YU4A 2H0DB 4QQ4A 3ZNIA 3MDBC 5AITA 2YURA 2RI7A 2F6JA 2L75A 2EODA 2M13A 4UI9B
chains in the Genus database with same CATH topology
3ASLA 1WFKA 4LJNA 2EGPA 2G43A 2L80A 2M85A 2KU3A 3IHPA 2FSAA 4L7XA 4YATA 1WEWA 2Y1MA 2XEUA 4WA6A 3N9NA 3RPGC 2CKLB 2ECTA 3M99A 1WESA 2VJFA 3HCTA 1HYIA 2L0BA 2CSZA 4GNDA 3MHSA 3PHDA 2HYED 4R2YA 4BBQA 4WZ2A 3LQJA 1E4UA 2KWKA 2YYRA 5FEYA 1VYXA 1WEOA 3T6RA 1VFYA 2CSYA 4FIPA 2M3HA 5B78A 2LQ6A 5J3XA 1K2FA 2LXHC 4I7DA 3EB5A 1JM7A 1N87A 3O34A 1IYMA 4NN2A 2MNYA 4A4BA 2ECIA 1JOCA 1VD4A 3DQVR 4N4FA 1WEMA 2M6MA 2LGLA 4A49A 2LDRA 4ZUXU 1WIMA 4TKPB 5FB1A 3U5PA 2KR4A 3HCUA 3N9MA 3KQIA 3L1ZB 5TABA 2VJFB 5KH7A 1HYJA 2JMDA 1RMDA 4GNEA 4PTBA 2VPGA 4L58A 4S3OB 2PUYA 2KREA 2G6QA 2K4DA 4F52B 4XI1A 5D1LB 2LGVA 4LADB 4UP0A 1T1HA 2K17A 2KFTA 1X4JA 3T7LA 2C2VS 2LXPC 4FJCA 3SHBA 2QJ0A 4YBSA 1MM3A 1F62A 3NG2A 5EYAF 3LQIA 3U5NA 2ECWA 3ZPVE 1WEQA 4IC2A 2E6RA 4V3LC 1JM7B 2KYUA 2E6SA 4MVTA 5B76A 4BHWA 2YUCA 1WILA 2LRIC 1Z6UA 1Z60A 3RTRB 5B79A 4GNFA 3C5KA 3KV5A 3HCSA 2L43A 4R8PK 4R7EA 2G45A 2FUUA 2L5UA 5DINA 3N9PA 2FUIA 2MUMA 3O35A 2EA6A 2VJEA 4IC3A 2NAAA 4YABA 1Z2QA 3ZVYA 5G0FA 2RSDA 3O70A 4GNGA 1X4UA 1WGMA 4FO9A 2VPEA 2YREA 3I2DA 3FL2A 1U6GB 3N9OA 3SOXA 5LKXA 5LKUA 2LGGA 3ZYQA 1WE9A 2YSJA 2MNZA 2LGKA 1WEVA 2K1JA 2ECVA 1WEUA 2HDPA 4AVXA 2KWOA 5TDWA 1V87A 3U5OA 3N9LA 1CHCA 5I3LA 2VNFA 2QIZA 1X4IA 1BORA 4LK9A 4QF2A 2K16A 2JMIA 1FP0A 2CT2A 3LQHA 2LN0A 4ZQLA 2KGIA 1LDJB 2I50A 4LKAA 1WEPA 3MHHA 5FERA 4FK5A 2YT5A 2MA6A 4ZDTA 3KV6A 1WEEA 2D8SA 4YC9A 2ZETC 3O37A 4UP5A 4N3WA 4CA1A 4GB0A 4CCGX 2IDAA 2VJEB 5G05B 2YHNA 3QZVA 2KWJA 3M63A 2YSMA 4AYCA 2ECJA 3L1XA 2LV9A 3O36A 3ZVZB 2ECNA 3M62A 3N9QA 2KWNA 4AP4A 2KE1A 3GV4A 5H1TA 5B75A 2ECGA 4YBMA 2JRJA 5LKZA 2OXQC 3HTKC 2QICA 4A4CA 2VPDA 3EB6A 5D1MB 1MM2A 3L11A 4V3KC 2YHOA 5H1VA 2MA5A 2YW8A 4WZ3B 2MD8C 4I7BA 2VPBA 4MSXA 5KH9A 5H1UA 3O33A 4I7CA 5TBNA 2YQMA 2BAYA 5LCWB 3KNVA 3U5MA 4YAXA 4X3GA 2MT5A 4P5OB 2XB1A 2H0DA 5LKTA 2KIZA 2M1RA 2F6NA 5FB0A 5G04B 3GL6A 4S3OC 3SOUA 1LDKC 3ZPV1 5C13A 1XWHA 2PNXA 4AUQB 1FBVA 4WZ0A 5JG6A 5DKAA 2Y43A 2AN6A 5B77A 1WENA 2YQLA 4AYCB 1ZBDB 2VP7A 3DPLR 1DVPA 4A0CD 2DX8A 4Q6FA 4PPEA 3LRQA 5TDRA 3O7AA 4O64A 4YADA 1G25A 4B86C 2CKLA 2UZGA 4C9ZA 5C11A 3RPGB 3PUQA 5TRBA 2JMJA 3VK6A 5H9MA 5B8DA 3SOWA 4QF3A 3C6WA 5AIUA 2MD7B 2Y1NA 3PURA 2C2LA 5KH3A 2F42A 3ZTGA 3V43A 4W4UA 2MIQA 2KGGA 4LLBA 5D1KB 4YBTA 4B7YC 2YU4A 2H0DB 3ZNIA 5AITA 2YURA 2RI7A 2F6JA 2L75A 2EODA 4UI9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASL A;  1WFK A;  4LJN A;  2EGP A;  2G43 A;  2L80 A;  2M85 A;  2KU3 A;  3IHP A;  2FSA A;  4L7X A;  4YAT A;  1WEW A;  2Y1M A;  2XEU A;  4WA6 A;  3N9N A;  3RPG C;  2CKL B;  2ECT A;  3M99 A;  1WES A;  2VJF A;  3HCT A;  1HYI A;  2L0B A;  2CSZ A;  4GND A;  3MHS A;  3PHD A;  2HYE D;  4R2Y A;  4BBQ A;  4WZ2 A;  3LQJ A;  1E4U A;  2KWK A;  2YYR A;  5FEY A;  1VYX A;  1WEO A;  3T6R A;  1VFY A;  2CSY A;  4FIP A;  2M3H A;  5B78 A;  2LQ6 A;  5J3X A;  1K2F A;  2LXH C;  4I7D A;  3EB5 A;  1JM7 A;  1N87 A;  3O34 A;  1IYM A;  4NN2 A;  2MNY A;  4A4B A;  2ECI A;  1JOC A;  1VD4 A;  3DQV R;  4N4F A;  1WEM A;  2M6M A;  2LGL A;  4A49 A;  2LDR A;  4ZUX U;  1WIM A;  4TKP B;  5FB1 A;  3U5P A;  2KR4 A;  3HCU A;  3N9M A;  3KQI A;  3L1Z B;  5TAB A;  2VJF B;  5KH7 A;  1HYJ A;  2JMD A;  1RMD A;  4GNE A;  4PTB A;  2VPG A;  4L58 A;  4S3O B;  2PUY A;  2KRE A;  2G6Q A;  2K4D A;  4F52 B;  4XI1 A;  5D1L B;  2LGV A;  4LAD B;  4UP0 A;  1T1H A;  2K17 A;  2KFT A;  1X4J A;  3T7L A;  2C2V S;  2LXP C;  4FJC A;  3SHB A;  2QJ0 A;  4YBS A;  1MM3 A;  1F62 A;  3NG2 A;  5EYA F;  3LQI A;  3U5N A;  2ECW A;  3ZPV E;  1WEQ A;  4IC2 A;  2E6R A;  4V3L C;  1JM7 B;  2KYU A;  2E6S A;  4MVT A;  5B76 A;  4BHW A;  2YUC A;  1WIL A;  2LRI C;  1Z6U A;  1Z60 A;  3RTR B;  5B79 A;  4GNF A;  3C5K A;  3KV5 A;  3HCS A;  2L43 A;  4R8P K;  4R7E A;  2G45 A;  2FUU A;  2L5U A;  5DIN A;  3N9P A;  2FUI A;  2MUM A;  3O35 A;  2EA6 A;  2VJE A;  4IC3 A;  2NAA A;  4YAB A;  1Z2Q A;  3ZVY A;  5G0F A;  2RSD A;  3O70 A;  4GNG A;  1X4U A;  1WGM A;  4FO9 A;  2VPE A;  2YRE A;  3I2D A;  3FL2 A;  1U6G B;  3N9O A;  3SOX A;  5LKX A;  5LKU A;  2LGG A;  3ZYQ A;  1WE9 A;  2YSJ A;  2MNZ A;  2LGK A;  1WEV A;  2K1J A;  2ECV A;  1WEU A;  2HDP A;  4AVX A;  2KWO A;  5TDW A;  1V87 A;  3U5O A;  3N9L A;  1CHC A;  5I3L A;  2VNF A;  2QIZ A;  1X4I A;  1BOR A;  4LK9 A;  4QF2 A;  2K16 A;  2JMI A;  1FP0 A;  2CT2 A;  3LQH A;  2LN0 A;  4ZQL A;  2KGI A;  1LDJ B;  2I50 A;  4LKA A;  1WEP A;  3MHH A;  5FER A;  4FK5 A;  2YT5 A;  2MA6 A;  4ZDT A;  3KV6 A;  1WEE A;  2D8S A;  4YC9 A;  2ZET C;  3O37 A;  4UP5 A;  4N3W A;  4CA1 A;  4GB0 A;  4CCG X;  2IDA A;  2VJE B;  5G05 B;  2YHN A;  3QZV A;  2KWJ A;  3M63 A;  2YSM A;  4AYC A;  2ECJ A;  3L1X A;  2LV9 A;  3O36 A;  3ZVZ B;  2ECN A;  3M62 A;  3N9Q A;  2KWN A;  4AP4 A;  2KE1 A;  3GV4 A;  5H1T A;  5B75 A;  2ECG A;  4YBM A;  2JRJ A;  5LKZ A;  2OXQ C;  3HTK C;  2QIC A;  4A4C A;  2VPD A;  3EB6 A;  5D1M B;  1MM2 A;  3L11 A;  4V3K C;  2YHO A;  5H1V A;  2MA5 A;  2YW8 A;  4WZ3 B;  2MD8 C;  4I7B A;  2VPB A;  4MSX A;  5KH9 A;  5H1U A;  3O33 A;  4I7C A;  5TBN A;  2YQM A;  2BAY A;  5LCW B;  3KNV A;  3U5M A;  4YAX A;  4X3G A;  2MT5 A;  4P5O B;  2XB1 A;  2H0D A;  5LKT A;  2KIZ A;  2M1R A;  2F6N A;  5FB0 A;  5G04 B;  3GL6 A;  4S3O C;  3SOU A;  1LDK C;  3ZPV 1;  5C13 A;  1XWH A;  2PNX A;  4AUQ B;  1FBV A;  4WZ0 A;  5JG6 A;  5DKA A;  2Y43 A;  2AN6 A;  5B77 A;  1WEN A;  2YQL A;  4AYC B;  1ZBD B;  2VP7 A;  3DPL R;  1DVP A;  4A0C D;  2DX8 A;  4Q6F A;  4PPE A;  3LRQ A;  5TDR A;  3O7A A;  4O64 A;  4YAD A;  1G25 A;  4B86 C;  2CKL A;  2UZG A;  4C9Z A;  5C11 A;  3RPG B;  3PUQ A;  5TRB A;  2JMJ A;  3VK6 A;  5H9M A;  5B8D A;  3SOW A;  4QF3 A;  3C6W A;  5AIU A;  2MD7 B;  2Y1N A;  3PUR A;  2C2L A;  5KH3 A;  2F42 A;  3ZTG A;  3V43 A;  4W4U A;  2MIQ A;  2KGG A;  4LLB A;  5D1K B;  4YBT A;  4B7Y C;  2YU4 A;  2H0D B;  3ZNI A;  5AIT A;  2YUR A;  2RI7 A;  2F6J A;  2L75 A;  2EOD A;  4UI9 B; 
#chains in the Genus database with same CATH topology
 3ASL A;  1WFK A;  4LJN A;  2EGP A;  2G43 A;  4OGC A;  2L80 A;  2IQJ A;  2M85 A;  2KU3 A;  3IHP A;  2FSA A;  4L7X A;  4YAT A;  3JUE A;  1WEW A;  2DSM A;  2Y1M A;  2XEU A;  4WA6 A;  3N9N A;  3RPG C;  2CKL B;  2ECT A;  3M99 A;  1WES A;  2VJF A;  3HCT A;  1HYI A;  2L0B A;  2CSZ A;  4GND A;  3MHS A;  3PHD A;  2E61 A;  2OWA A;  2HYE D;  4R2Y A;  4BBQ A;  5K3Q A;  4WZ2 A;  3LQJ A;  2EXU A;  1E4U A;  2KWK A;  2YYR A;  5FEY A;  1VYX A;  1WEO A;  3T6R A;  2KKY A;  1VFY A;  2CSY A;  4FIP A;  2M3H A;  4OGE A;  5B78 A;  2LQ6 A;  5J3X A;  1K2F A;  1MBM A;  2LXH C;  4I7D A;  3EB5 A;  1JM7 A;  1N87 A;  3O34 A;  3KDE C;  1IYM A;  4NN2 A;  2MNY A;  4A4B A;  2ECI A;  1JOC A;  1VD4 A;  3DQV R;  4N4F A;  1WEM A;  2M6M A;  3LVR E;  2DJA A;  2LGL A;  4A49 A;  2LDR A;  4ZUX U;  1WIM A;  3FJU B;  4TKP B;  5FB1 A;  3U5P A;  2KR4 A;  3HCU A;  3N9M A;  3KQI A;  3L1Z B;  5TAB A;  2VJF B;  5KH7 A;  1HYJ A;  2JMD A;  1RMD A;  4GNE A;  4PTB A;  2VPG A;  4L58 A;  4O62 A;  4S3O B;  2PUY A;  2KRE A;  2G6Q A;  2K4D A;  2KKX A;  4F52 B;  4XI1 A;  5D1L B;  2LGV A;  5SVY A;  4LAD B;  4UP0 A;  1T1H A;  2K17 A;  2KFT A;  2RR4 A;  1X4J A;  2XP0 A;  3T7L A;  2C2V S;  2LXP C;  4FJC A;  3SHB A;  2QJ0 A;  4YBS A;  1MM3 A;  1F62 A;  3NG2 A;  5EYA F;  3LQI A;  2EGM A;  3U5N A;  2ECW A;  3ZPV E;  1WEQ A;  4IC2 A;  2E6R A;  2XOZ A;  4V3L C;  1JM7 B;  2KYU A;  2E6S A;  4MVT A;  5B76 A;  4BHW A;  2YUC A;  1WIL A;  2LRI C;  2CSV A;  1Z6U A;  1Z60 A;  3RTR B;  5B79 A;  4GNF A;  3C5K A;  3KV5 A;  3HCS A;  2L43 A;  4R8P K;  4R7E A;  2G45 A;  3O47 A;  2FUU A;  2L5U A;  5DIN A;  3N9P A;  2CRW A;  2FUI A;  2MUM A;  3O35 A;  2CON A;  2EA6 A;  2VJE A;  1DCQ A;  4IC3 A;  2NAA A;  4YAB A;  1Z2Q A;  3ZVY A;  3LDY A;  5G0F A;  2RSD A;  3E2D A;  3O70 A;  4GNG A;  1X4U A;  1WGM A;  4FO9 A;  2VPE A;  3FAN A;  2YRE A;  3I2D A;  3FL2 A;  1U6G B;  3N9O A;  3SOX A;  5LKX A;  5LKU A;  2LGG A;  2CRR A;  3ZYQ A;  1WE9 A;  2YSJ A;  2MNZ A;  2LGK A;  1WEV A;  2K1J A;  2ECV A;  1WEU A;  2B0O E;  2HDP A;  4AVX A;  3FM8 C;  2KWO A;  2MKE A;  5TDW A;  1V87 A;  3U5O A;  3N9L A;  1CHC A;  2JM3 A;  5I3L A;  2VNF A;  2QIZ A;  1X4I A;  1BOR A;  4LK9 A;  4QF2 A;  2K16 A;  2JMI A;  1FP0 A;  2CT2 A;  3LQH A;  4H9D A;  2LN0 A;  3FAO A;  4ZQL A;  2KGI A;  2P57 A;  1LDJ B;  2I50 A;  4LKA A;  3M7K A;  1WEP A;  3MHH A;  5FER A;  4FK5 A;  2YT5 A;  2D8U A;  2MA6 A;  4Z0R A;  3DDT A;  2LAU A;  4ZDT A;  3KV6 A;  1WEE A;  2D8S A;  4YC9 A;  2ZET C;  3O37 A;  4UP5 A;  3H7H A;  4N3W A;  4CA1 A;  4GB0 A;  4CCG X;  2IDA A;  2VJE B;  5G05 B;  2YHN A;  3QZV A;  2KWJ A;  3M63 A;  2YSM A;  5SVI A;  4AYC A;  2FD4 A;  2ECJ A;  3L1X A;  2LV9 A;  3O36 A;  3ZVZ B;  2ECN A;  3M62 A;  3N9Q A;  2KWN A;  4AP4 A;  3LVQ E;  2KE1 A;  3GV4 A;  5H1T A;  5B75 A;  2ECG A;  4YBM A;  2XOY A;  2JRJ A;  5LKZ A;  2OXQ C;  3HTK C;  2QIC A;  4A4C A;  2VPD A;  3EB6 A;  5D1M B;  1MM2 A;  3Q1D A;  3L11 A;  4V3K C;  2YHO A;  5H1V A;  2MA5 A;  2YW8 A;  4WZ3 B;  2MD8 C;  3SUB A;  4I7B A;  2VPB A;  4MSX A;  5KH9 A;  5H1U A;  3O33 A;  4I7C A;  5TBN A;  2YQM A;  2BAY A;  5LCW B;  3KNV A;  3U5M A;  4YAX A;  4X3G A;  2MT5 A;  4P5O B;  2XB1 A;  2H0D A;  5LKT A;  2KIZ A;  2M1R A;  2F6N A;  5FB0 A;  5G04 B;  3GL6 A;  4S3O C;  3SOU A;  1LDK C;  5SVX A;  3ZPV 1;  5C13 A;  1XWH A;  2L7P A;  2PNX A;  4AUQ B;  1FBV A;  4WZ0 A;  5JG6 A;  5DKA A;  3FEH A;  2Y43 A;  3LJU X;  2AN6 A;  5SVI B;  4F1P A;  5B77 A;  1WEN A;  2YQL A;  4AYC B;  1ZBD B;  2VP7 A;  3DPL R;  1DVP A;  3DWD A;  4A0C D;  2DX8 A;  4Q6F A;  3PLW A;  4PPE A;  3LRQ A;  5TDR A;  3O7A A;  4O64 A;  4YAD A;  1G25 A;  4B86 C;  2CKL A;  2UZG A;  2YVR A;  4C9Z A;  5C11 A;  3RPG B;  2FFW A;  3PUQ A;  5TRB A;  2JMJ A;  3VK6 A;  5H9M A;  5B8D A;  2JUN A;  3SOW A;  4QF3 A;  3C6W A;  5AIU A;  2XOC A;  2MD7 B;  2Y1N A;  3PUR A;  2C2L A;  3T9K A;  5KH3 A;  2F42 A;  3ZTG A;  3V43 A;  4W4U A;  2MIQ A;  4Z0O A;  2KGG A;  4LLB A;  5D1K B;  4YBT A;  4B7Y C;  2YU4 A;  2H0D B;  4QQ4 A;  3ZNI A;  3MDB C;  5AIT A;  2YUR A;  2RI7 A;  2F6J A;  2L75 A;  2EOD A;  2M13 A;  4UI9 B; 
#chains in the Genus database with same CATH homology
 3ASL A;  1WFK A;  4LJN A;  2EGP A;  2G43 A;  2L80 A;  2M85 A;  2KU3 A;  3IHP A;  2FSA A;  4L7X A;  4YAT A;  1WEW A;  2Y1M A;  2XEU A;  4WA6 A;  3N9N A;  3RPG C;  2CKL B;  2ECT A;  3M99 A;  1WES A;  2VJF A;  3HCT A;  1HYI A;  2L0B A;  2CSZ A;  4GND A;  3MHS A;  3PHD A;  2HYE D;  4R2Y A;  4BBQ A;  4WZ2 A;  3LQJ A;  1E4U A;  2KWK A;  2YYR A;  5FEY A;  1VYX A;  1WEO A;  3T6R A;  1VFY A;  2CSY A;  4FIP A;  2M3H A;  5B78 A;  2LQ6 A;  5J3X A;  1K2F A;  2LXH C;  4I7D A;  3EB5 A;  1JM7 A;  1N87 A;  3O34 A;  1IYM A;  4NN2 A;  2MNY A;  4A4B A;  2ECI A;  1JOC A;  1VD4 A;  3DQV R;  4N4F A;  1WEM A;  2M6M A;  2LGL A;  4A49 A;  2LDR A;  4ZUX U;  1WIM A;  4TKP B;  5FB1 A;  3U5P A;  2KR4 A;  3HCU A;  3N9M A;  3KQI A;  3L1Z B;  5TAB A;  2VJF B;  5KH7 A;  1HYJ A;  2JMD A;  1RMD A;  4GNE A;  4PTB A;  2VPG A;  4L58 A;  4S3O B;  2PUY A;  2KRE A;  2G6Q A;  2K4D A;  4F52 B;  4XI1 A;  5D1L B;  2LGV A;  4LAD B;  4UP0 A;  1T1H A;  2K17 A;  2KFT A;  1X4J A;  3T7L A;  2C2V S;  2LXP C;  4FJC A;  3SHB A;  2QJ0 A;  4YBS A;  1MM3 A;  1F62 A;  3NG2 A;  5EYA F;  3LQI A;  3U5N A;  2ECW A;  3ZPV E;  1WEQ A;  4IC2 A;  2E6R A;  4V3L C;  1JM7 B;  2KYU A;  2E6S A;  4MVT A;  5B76 A;  4BHW A;  2YUC A;  1WIL A;  2LRI C;  1Z6U A;  1Z60 A;  3RTR B;  5B79 A;  4GNF A;  3C5K A;  3KV5 A;  3HCS A;  2L43 A;  4R8P K;  4R7E A;  2G45 A;  2FUU A;  2L5U A;  5DIN A;  3N9P A;  2FUI A;  2MUM A;  3O35 A;  2EA6 A;  2VJE A;  4IC3 A;  2NAA A;  4YAB A;  1Z2Q A;  3ZVY A;  5G0F A;  2RSD A;  3O70 A;  4GNG A;  1X4U A;  1WGM A;  4FO9 A;  2VPE A;  2YRE A;  3I2D A;  3FL2 A;  1U6G B;  3N9O A;  3SOX A;  5LKX A;  5LKU A;  2LGG A;  3ZYQ A;  1WE9 A;  2YSJ A;  2MNZ A;  2LGK A;  1WEV A;  2K1J A;  2ECV A;  1WEU A;  2HDP A;  4AVX A;  2KWO A;  5TDW A;  1V87 A;  3U5O A;  3N9L A;  1CHC A;  5I3L A;  2VNF A;  2QIZ A;  1X4I A;  1BOR A;  4LK9 A;  4QF2 A;  2K16 A;  2JMI A;  1FP0 A;  2CT2 A;  3LQH A;  2LN0 A;  4ZQL A;  2KGI A;  1LDJ B;  2I50 A;  4LKA A;  1WEP A;  3MHH A;  5FER A;  4FK5 A;  2YT5 A;  2MA6 A;  4ZDT A;  3KV6 A;  1WEE A;  2D8S A;  4YC9 A;  2ZET C;  3O37 A;  4UP5 A;  4N3W A;  4CA1 A;  4GB0 A;  4CCG X;  2IDA A;  2VJE B;  5G05 B;  2YHN A;  3QZV A;  2KWJ A;  3M63 A;  2YSM A;  4AYC A;  2ECJ A;  3L1X A;  2LV9 A;  3O36 A;  3ZVZ B;  2ECN A;  3M62 A;  3N9Q A;  2KWN A;  4AP4 A;  2KE1 A;  3GV4 A;  5H1T A;  5B75 A;  2ECG A;  4YBM A;  2JRJ A;  5LKZ A;  2OXQ C;  3HTK C;  2QIC A;  4A4C A;  2VPD A;  3EB6 A;  5D1M B;  1MM2 A;  3L11 A;  4V3K C;  2YHO A;  5H1V A;  2MA5 A;  2YW8 A;  4WZ3 B;  2MD8 C;  4I7B A;  2VPB A;  4MSX A;  5KH9 A;  5H1U A;  3O33 A;  4I7C A;  5TBN A;  2YQM A;  2BAY A;  5LCW B;  3KNV A;  3U5M A;  4YAX A;  4X3G A;  2MT5 A;  4P5O B;  2XB1 A;  2H0D A;  5LKT A;  2KIZ A;  2M1R A;  2F6N A;  5FB0 A;  5G04 B;  3GL6 A;  4S3O C;  3SOU A;  1LDK C;  3ZPV 1;  5C13 A;  1XWH A;  2PNX A;  4AUQ B;  1FBV A;  4WZ0 A;  5JG6 A;  5DKA A;  2Y43 A;  2AN6 A;  5B77 A;  1WEN A;  2YQL A;  4AYC B;  1ZBD B;  2VP7 A;  3DPL R;  1DVP A;  4A0C D;  2DX8 A;  4Q6F A;  4PPE A;  3LRQ A;  5TDR A;  3O7A A;  4O64 A;  4YAD A;  1G25 A;  4B86 C;  2CKL A;  2UZG A;  4C9Z A;  5C11 A;  3RPG B;  3PUQ A;  5TRB A;  2JMJ A;  3VK6 A;  5H9M A;  5B8D A;  3SOW A;  4QF3 A;  3C6W A;  5AIU A;  2MD7 B;  2Y1N A;  3PUR A;  2C2L A;  5KH3 A;  2F42 A;  3ZTG A;  3V43 A;  4W4U A;  2MIQ A;  2KGG A;  4LLB A;  5D1K B;  4YBT A;  4B7Y C;  2YU4 A;  2H0D B;  3ZNI A;  5AIT A;  2YUR A;  2RI7 A;  2F6J A;  2L75 A;  2EOD A;  4UI9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...