1JM7B

Solution structure of the brca1/bard1 ring-domain heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
MEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BREAST CANCER TYPE 1 SUSCEPTIBILITY PROTEIN
publication title Structure of a BRCA1-BARD1 heterodimeric RING-RING complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor
total genus 21
structure length 97
sequence length 97
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14835 zf-RING_6 zf-RING of BARD1-type protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1jm7B00
4CA1A 2K16A 3O37A 2MUMA 2F6JA 4GNFA 1JM7B 1WEVA 4ZUXU 2D8SA 3SHBA 1WEQA 4V3LC 2KFTA 3MHHA 5B77A 3PURA 2CT2A 4Q6FA 4PTBA 2QJ0A 2VJFB 4UP0A 3ZNIA 4X3GA 2G6QA 2XEUA 5B75A 5FB0A 2Y43A 3ASLA 4A4BA 2YHOA 3LQHA 4LLBA 3FL2A 2L43A 4AP4A 1ZBDB 5FEYA 2LXHC 2HDPA 3O70A 3U5NA 2YQLA 4LK9A 1F62A 1HYJA 5AIUA 3IHPA 3EB5A 3N9QA 2I50A 3O33A 3M63A 5LKTA 2MNYA 3ZYQA 1FBVA 1WFKA 5C11A 3N9LA 4YC9A 2UZGA 2Y1NA 3GV4A 3V43A 2KWJA 2AN6A 4AUQB 1N87A 5G0FA 1WEUA 1CHCA 4GNEA 4YAXA 3N9PA 2F6NA 5TDRA 4A49A 1WEEA 4YBMA 2ECJA 4V3KC 3RPGC 2L5UA 2OXQC 2KGIA 2M85A 2M3HA 5FERA 3SOWA 5EYAF 5LCWB 3ZPVE 2VPBA 1VFYA 1WEOA 3N9MA 4LKAA 5LKZA 1G25A 4PPEA 3LQJA 3GL6A 3O35A 4A4CA 2KIZA 4N4FA 4GB0A 3HTKC 2LN0A 2LXPC 5DKAA 2H0DB 2FUUA 4YADA 2VJEB 3I2DA 2YW8A 4FK5A 1WIMA 1BORA 4S3OC 2FUIA 4ZDTA 2CKLA 4MSXA 3RPGB 4A0CD 1T1HA 2VNFA 2ECNA 2MD8C 2L75A 4QF2A 2G43A 4AYCA 4I7DA 2ECWA 3T7LA 1WEPA 3ZPV1 4L7XA 2QIZA 2QICA 3KNVA 2KREA 3HCSA 4YABA 1LDKC 3C5KA 2KWOA 3ZTGA 2CSYA 4R2YA 2LGKA 3KV5A 2LQ6A 4TKPB 1JM7A 2E6RA 2YURA 2LGLA 4LJNA 2ECIA 2MNZA 2RSDA 3M62A 5TDWA 4ZQLA 1WENA 1RMDA 4R8PK 4UI9B 2VJFA 4IC3A 2PUYA 2YU4A 4S3OB 2YSMA 4UP5A 3SOUA 2ECGA 2JMIA 5AITA 4FJCA 3N9OA 5KH7A 1WESA 3O34A 3ZVZB 1K2FA 1X4IA 1VD4A 2E6SA 4GNGA 3KQIA 2M1RA 2EA6A 3U5PA 2ECTA 3KV6A 2LRIC 2K17A 2YHNA 4BBQA 2JMJA 5G04B 2LV9A 3U5MA 4R7EA 3HCUA 5TBNA 2G45A 1V87A 1JOCA 1VYXA 2ZETC 2YYRA 5B76A 2XB1A 4W4UA 4AVXA 2C2VS 2MA6A 1Z2QA 2VPEA 4WZ0A 3RTRB 4BHWA 3O36A 3QZVA 2MT5A 1WEMA 3L1ZB 3L11A 2VPDA 3N9NA 5H1TA 1E4UA 1Z6UA 4FO9A 3SOXA 4YBSA 3M99A 5LKXA 2EODA 2NAAA 2VP7A 5DINA 1LDJB 1X4UA 4L58A 2LDRA 1WEWA 2KR4A 5D1MB 4LADB 4N3WA 1HYIA 1MM3A 4F52B 2MD7B 2M6MA 2L0BA 4O64A 5KH3A 2KGGA 3MHSA 1FP0A 3C6WA 2MA5A 5FB1A 2BAYA 4B86C 2LGVA 3LQIA 2FSAA 1MM2A 2L80A 5D1LB 1WE9A 3DPLR 2H0DA 2KU3A 5B8DA 5G05B 4NN2A 2VJEA 2VPGA 3DQVR 1WILA 3HCTA 3L1XA 5B79A 1IYMA 2K4DA 3PUQA 2DX8A 5D1KB 4I7BA 2YSJA 3VK6A 4IC2A 5H1UA 2EGPA 5TABA 1Z60A 3NG2A 2LGGA 4C9ZA 5TRBA 3U5OA 1X4JA 1DVPA 2F42A 2K1JA 2KWKA 3EB6A 3ZVYA 4YATA 2YREA 2JRJA 4MVTA 4B7YC 2KYUA 4WZ2A 2Y1MA 4FIPA 4QF3A 5KH9A 2RI7A 5LKUA 2YQMA 2HYED 2ECVA 4CCGX 5H1VA 4WA6A 2CKLB 2CSZA 2YUCA 2KWNA 4I7CA 5I3LA 5JG6A 1XWHA 2JMDA 2YT5A 5B78A 4P5OB 4AYCB 2KE1A 5C13A 1WGMA 3PHDA 4GNDA 2IDAA 4WZ3B 4XI1A 5J3XA 1U6GB 2MIQA 3O7AA 5H9MA 4YBTA 3LRQA 2C2LA 2PNXA 3T6RA
chains in the Genus database with same CATH superfamily
4CA1A 2K16A 3O37A 2MUMA 2F6JA 4GNFA 1JM7B 1WEVA 4ZUXU 2D8SA 3SHBA 1WEQA 4V3LC 2KFTA 3MHHA 5B77A 3PURA 2CT2A 4Q6FA 4PTBA 2QJ0A 2VJFB 4UP0A 2XP0A 3ZNIA 4X3GA 2G6QA 2XEUA 5B75A 5FB0A 2Y43A 3ASLA 2M13A 4A4BA 2YHOA 3LQHA 4LLBA 3FL2A 2L43A 4AP4A 1ZBDB 2XOZA 5FEYA 2LXHC 2HDPA 3O70A 3U5NA 2YQLA 2FFWA 4LK9A 3JUEA 1F62A 1HYJA 5AIUA 2D8UA 3IHPA 3EB5A 3N9QA 3MDBC 2L7PA 2I50A 3O33A 3M63A 5LKTA 2MNYA 3FANA 3ZYQA 1FBVA 1WFKA 5C11A 3N9LA 4YC9A 2UZGA 2Y1NA 3GV4A 3V43A 2KWJA 4OGEA 2AN6A 4AUQB 1N87A 5G0FA 1WEUA 1CHCA 4GNEA 4YAXA 3N9PA 2F6NA 5TDRA 4A49A 1WEEA 1MBMA 4YBMA 2ECJA 4V3KC 3RPGC 2IQJA 2L5UA 2OXQC 2KGIA 2M85A 3H7HA 5SVYA 2M3HA 5FERA 3SOWA 3DDTA 5EYAF 3LVQE 5LCWB 3ZPVE 2VPBA 1VFYA 3FM8C 1WEOA 3N9MA 4LKAA 5LKZA 4F1PA 1G25A 4PPEA 3LQJA 5K3QA 3GL6A 3O35A 4A4CA 2KIZA 2JUNA 4N4FA 3T9KA 2KKYA 4GB0A 3HTKC 2MKEA 2LN0A 2LXPC 5DKAA 2H0DB 2CONA 2FUUA 4YADA 2E61A 2VJEB 3I2DA 2YW8A 4FK5A 5SVIB 1WIMA 1BORA 4S3OC 2FUIA 4ZDTA 2CKLA 4MSXA 3RPGB 4A0CD 1T1HA 2VNFA 2ECNA 2MD8C 2L75A 4QF2A 2JM3A 2G43A 4Z0OA 4AYCA 4I7DA 2ECWA 3T7LA 1WEPA 3ZPV1 4L7XA 2QIZA 2QICA 3KNVA 2KREA 3HCSA 4YABA 1LDKC 3LVRE 3C5KA 4H9DA 2KWOA 3ZTGA 2CSYA 2XOYA 4R2YA 2LGKA 4Z0RA 3KV5A 2LQ6A 3M7KA 4TKPB 1JM7A 3LDYA 2E6RA 2YURA 2LGLA 4LJNA 2OWAA 2KKXA 2ECIA 2MNZA 2RSDA 3M62A 5TDWA 4ZQLA 1WENA 2FD4A 1RMDA 4R8PK 4UI9B 2P57A 2VJFA 4IC3A 2PUYA 2YU4A 4S3OB 2YSMA 4UP5A 3SOUA 2ECGA 3KDEC 2JMIA 5AITA 4FJCA 3N9OA 5KH7A 1WESA 2CSVA 3O34A 3ZVZB 1K2FA 1X4IA 1VD4A 2E6SA 4OGCA 4GNGA 3KQIA 2M1RA 2LAUA 2EXUA 2EA6A 5SVXA 3U5PA 2ECTA 3KV6A 2LRIC 2K17A 2YHNA 4BBQA 2JMJA 2RR4A 5G04B 2LV9A 3U5MA 4R7EA 3HCUA 5TBNA 2G45A 1V87A 1JOCA 1VYXA 3DWDA 2ZETC 2YYRA 3Q1DA 5B76A 2XB1A 4W4UA 4AVXA 2C2VS 2MA6A 1Z2QA 2VPEA 4WZ0A 3RTRB 4BHWA 3O36A 2YVRA 4O62A 3QZVA 2MT5A 1WEMA 3L1ZB 3L11A 2VPDA 3N9NA 5H1TA 1E4UA 1Z6UA 4FO9A 3SOXA 4YBSA 3M99A 5LKXA 2EODA 2NAAA 2VP7A 5DINA 1LDJB 1X4UA 4L58A 2LDRA 1WEWA 2CRWA 2KR4A 3FAOA 5D1MB 4LADB 4N3WA 1HYIA 1MM3A 4F52B 2MD7B 2M6MA 2L0BA 1DCQA 4O64A 5KH3A 2KGGA 3MHSA 1FP0A 3C6WA 2MA5A 5FB1A 2DSMA 2BAYA 4B86C 2LGVA 3LQIA 2FSAA 1MM2A 3O47A 2L80A 5D1LB 1WE9A 3DPLR 2H0DA 2KU3A 5B8DA 5G05B 2CRRA 3FEHA 4NN2A 2VJEA 2VPGA 3DQVR 1WILA 5SVIA 3HCTA 3L1XA 5B79A 1IYMA 2K4DA 3PUQA 2DX8A 5D1KB 4I7BA 2YSJA 3VK6A 4IC2A 5H1UA 2EGPA 5TABA 1Z60A 3NG2A 2LGGA 4C9ZA 3SUBA 5TRBA 3U5OA 1X4JA 1DVPA 2F42A 2K1JA 2KWKA 3EB6A 3ZVYA 4YATA 3FJUB 2YREA 2JRJA 4MVTA 4B7YC 2KYUA 2XOCA 4WZ2A 2Y1MA 4FIPA 4QF3A 5KH9A 2RI7A 5LKUA 2DJAA 2YQMA 2HYED 3E2DA 3PLWA 2ECVA 4CCGX 5H1VA 2CKLB 4WA6A 2CSZA 2YUCA 2KWNA 2EGMA 4I7CA 5I3LA 5JG6A 1XWHA 2JMDA 2YT5A 5B78A 4P5OB 3LJUX 4AYCB 2KE1A 5C13A 1WGMA 3PHDA 4GNDA 2IDAA 4WZ3B 4XI1A 5J3XA 1U6GB 2MIQA 4QQ4A 3O7AA 5H9MA 4YBTA 3LRQA 2C2LA 2PNXA 3T6RA 2B0OE
chains in the Genus database with same CATH topology
4CA1A 2K16A 3O37A 2MUMA 2F6JA 4GNFA 1JM7B 1WEVA 4ZUXU 2D8SA 3SHBA 1WEQA 4V3LC 2KFTA 3MHHA 5B77A 3PURA 2CT2A 4Q6FA 4PTBA 2QJ0A 2VJFB 4UP0A 3ZNIA 4X3GA 2G6QA 2XEUA 5B75A 5FB0A 2Y43A 3ASLA 4A4BA 2YHOA 3LQHA 4LLBA 3FL2A 2L43A 4AP4A 1ZBDB 5FEYA 2LXHC 2HDPA 3O70A 3U5NA 2YQLA 4LK9A 1F62A 1HYJA 5AIUA 3IHPA 3EB5A 3N9QA 2I50A 3O33A 3M63A 5LKTA 2MNYA 3ZYQA 1FBVA 1WFKA 5C11A 3N9LA 4YC9A 2UZGA 2Y1NA 3GV4A 3V43A 2KWJA 2AN6A 4AUQB 1N87A 5G0FA 1WEUA 1CHCA 4GNEA 4YAXA 3N9PA 2F6NA 5TDRA 4A49A 1WEEA 4YBMA 2ECJA 4V3KC 3RPGC 2L5UA 2OXQC 2KGIA 2M85A 2M3HA 5FERA 3SOWA 5EYAF 5LCWB 3ZPVE 2VPBA 1VFYA 1WEOA 3N9MA 4LKAA 5LKZA 1G25A 4PPEA 3LQJA 3GL6A 3O35A 4A4CA 2KIZA 4N4FA 4GB0A 3HTKC 2LN0A 2LXPC 5DKAA 2H0DB 2FUUA 4YADA 2VJEB 3I2DA 2YW8A 4FK5A 1WIMA 1BORA 4S3OC 2FUIA 4ZDTA 2CKLA 4MSXA 3RPGB 4A0CD 1T1HA 2VNFA 2ECNA 2MD8C 2L75A 4QF2A 2G43A 4AYCA 4I7DA 2ECWA 3T7LA 1WEPA 3ZPV1 4L7XA 2QIZA 2QICA 3KNVA 2KREA 3HCSA 4YABA 1LDKC 3C5KA 2KWOA 3ZTGA 2CSYA 4R2YA 2LGKA 3KV5A 2LQ6A 4TKPB 1JM7A 2E6RA 2YURA 2LGLA 4LJNA 2ECIA 2MNZA 2RSDA 3M62A 5TDWA 4ZQLA 1WENA 1RMDA 4R8PK 4UI9B 2VJFA 4IC3A 2PUYA 2YU4A 4S3OB 2YSMA 4UP5A 3SOUA 2ECGA 2JMIA 5AITA 4FJCA 3N9OA 5KH7A 1WESA 3O34A 3ZVZB 1K2FA 1X4IA 1VD4A 2E6SA 4GNGA 3KQIA 2M1RA 2EA6A 3U5PA 2ECTA 3KV6A 2LRIC 2K17A 2YHNA 4BBQA 2JMJA 5G04B 2LV9A 3U5MA 4R7EA 3HCUA 5TBNA 2G45A 1V87A 1JOCA 1VYXA 2ZETC 2YYRA 5B76A 2XB1A 4W4UA 4AVXA 2C2VS 2MA6A 1Z2QA 2VPEA 4WZ0A 3RTRB 4BHWA 3O36A 3QZVA 2MT5A 1WEMA 3L1ZB 3L11A 2VPDA 3N9NA 5H1TA 1E4UA 1Z6UA 4FO9A 3SOXA 4YBSA 3M99A 5LKXA 2EODA 2NAAA 2VP7A 5DINA 1LDJB 1X4UA 4L58A 2LDRA 1WEWA 2KR4A 5D1MB 4LADB 4N3WA 1HYIA 1MM3A 4F52B 2MD7B 2M6MA 2L0BA 4O64A 5KH3A 2KGGA 3MHSA 1FP0A 3C6WA 2MA5A 5FB1A 2BAYA 4B86C 2LGVA 3LQIA 2FSAA 1MM2A 2L80A 5D1LB 1WE9A 3DPLR 2H0DA 2KU3A 5B8DA 5G05B 4NN2A 2VJEA 2VPGA 3DQVR 1WILA 3HCTA 3L1XA 5B79A 1IYMA 2K4DA 3PUQA 2DX8A 5D1KB 4I7BA 2YSJA 3VK6A 4IC2A 5H1UA 2EGPA 5TABA 1Z60A 3NG2A 2LGGA 4C9ZA 5TRBA 3U5OA 1X4JA 1DVPA 2F42A 2K1JA 2KWKA 3EB6A 3ZVYA 4YATA 2YREA 2JRJA 4MVTA 4B7YC 2KYUA 4WZ2A 2Y1MA 4FIPA 4QF3A 5KH9A 2RI7A 5LKUA 2YQMA 2HYED 2ECVA 4CCGX 5H1VA 4WA6A 2CKLB 2CSZA 2YUCA 2KWNA 4I7CA 5I3LA 5JG6A 1XWHA 2JMDA 2YT5A 5B78A 4P5OB 4AYCB 2KE1A 5C13A 1WGMA 3PHDA 4GNDA 2IDAA 4WZ3B 4XI1A 5J3XA 1U6GB 2MIQA 3O7AA 5H9MA 4YBTA 3LRQA 2C2LA 2PNXA 3T6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CA1 A;  2K16 A;  3O37 A;  2MUM A;  2F6J A;  4GNF A;  1JM7 B;  1WEV A;  4ZUX U;  2D8S A;  3SHB A;  1WEQ A;  4V3L C;  2KFT A;  3MHH A;  5B77 A;  3PUR A;  2CT2 A;  4Q6F A;  4PTB A;  2QJ0 A;  2VJF B;  4UP0 A;  3ZNI A;  4X3G A;  2G6Q A;  2XEU A;  5B75 A;  5FB0 A;  2Y43 A;  3ASL A;  4A4B A;  2YHO A;  3LQH A;  4LLB A;  3FL2 A;  2L43 A;  4AP4 A;  1ZBD B;  5FEY A;  2LXH C;  2HDP A;  3O70 A;  3U5N A;  2YQL A;  4LK9 A;  1F62 A;  1HYJ A;  5AIU A;  3IHP A;  3EB5 A;  3N9Q A;  2I50 A;  3O33 A;  3M63 A;  5LKT A;  2MNY A;  3ZYQ A;  1FBV A;  1WFK A;  5C11 A;  3N9L A;  4YC9 A;  2UZG A;  2Y1N A;  3GV4 A;  3V43 A;  2KWJ A;  2AN6 A;  4AUQ B;  1N87 A;  5G0F A;  1WEU A;  1CHC A;  4GNE A;  4YAX A;  3N9P A;  2F6N A;  5TDR A;  4A49 A;  1WEE A;  4YBM A;  2ECJ A;  4V3K C;  3RPG C;  2L5U A;  2OXQ C;  2KGI A;  2M85 A;  2M3H A;  5FER A;  3SOW A;  5EYA F;  5LCW B;  3ZPV E;  2VPB A;  1VFY A;  1WEO A;  3N9M A;  4LKA A;  5LKZ A;  1G25 A;  4PPE A;  3LQJ A;  3GL6 A;  3O35 A;  4A4C A;  2KIZ A;  4N4F A;  4GB0 A;  3HTK C;  2LN0 A;  2LXP C;  5DKA A;  2H0D B;  2FUU A;  4YAD A;  2VJE B;  3I2D A;  2YW8 A;  4FK5 A;  1WIM A;  1BOR A;  4S3O C;  2FUI A;  4ZDT A;  2CKL A;  4MSX A;  3RPG B;  4A0C D;  1T1H A;  2VNF A;  2ECN A;  2MD8 C;  2L75 A;  4QF2 A;  2G43 A;  4AYC A;  4I7D A;  2ECW A;  3T7L A;  1WEP A;  3ZPV 1;  4L7X A;  2QIZ A;  2QIC A;  3KNV A;  2KRE A;  3HCS A;  4YAB A;  1LDK C;  3C5K A;  2KWO A;  3ZTG A;  2CSY A;  4R2Y A;  2LGK A;  3KV5 A;  2LQ6 A;  4TKP B;  1JM7 A;  2E6R A;  2YUR A;  2LGL A;  4LJN A;  2ECI A;  2MNZ A;  2RSD A;  3M62 A;  5TDW A;  4ZQL A;  1WEN A;  1RMD A;  4R8P K;  4UI9 B;  2VJF A;  4IC3 A;  2PUY A;  2YU4 A;  4S3O B;  2YSM A;  4UP5 A;  3SOU A;  2ECG A;  2JMI A;  5AIT A;  4FJC A;  3N9O A;  5KH7 A;  1WES A;  3O34 A;  3ZVZ B;  1K2F A;  1X4I A;  1VD4 A;  2E6S A;  4GNG A;  3KQI A;  2M1R A;  2EA6 A;  3U5P A;  2ECT A;  3KV6 A;  2LRI C;  2K17 A;  2YHN A;  4BBQ A;  2JMJ A;  5G04 B;  2LV9 A;  3U5M A;  4R7E A;  3HCU A;  5TBN A;  2G45 A;  1V87 A;  1JOC A;  1VYX A;  2ZET C;  2YYR A;  5B76 A;  2XB1 A;  4W4U A;  4AVX A;  2C2V S;  2MA6 A;  1Z2Q A;  2VPE A;  4WZ0 A;  3RTR B;  4BHW A;  3O36 A;  3QZV A;  2MT5 A;  1WEM A;  3L1Z B;  3L11 A;  2VPD A;  3N9N A;  5H1T A;  1E4U A;  1Z6U A;  4FO9 A;  3SOX A;  4YBS A;  3M99 A;  5LKX A;  2EOD A;  2NAA A;  2VP7 A;  5DIN A;  1LDJ B;  1X4U A;  4L58 A;  2LDR A;  1WEW A;  2KR4 A;  5D1M B;  4LAD B;  4N3W A;  1HYI A;  1MM3 A;  4F52 B;  2MD7 B;  2M6M A;  2L0B A;  4O64 A;  5KH3 A;  2KGG A;  3MHS A;  1FP0 A;  3C6W A;  2MA5 A;  5FB1 A;  2BAY A;  4B86 C;  2LGV A;  3LQI A;  2FSA A;  1MM2 A;  2L80 A;  5D1L B;  1WE9 A;  3DPL R;  2H0D A;  2KU3 A;  5B8D A;  5G05 B;  4NN2 A;  2VJE A;  2VPG A;  3DQV R;  1WIL A;  3HCT A;  3L1X A;  5B79 A;  1IYM A;  2K4D A;  3PUQ A;  2DX8 A;  5D1K B;  4I7B A;  2YSJ A;  3VK6 A;  4IC2 A;  5H1U A;  2EGP A;  5TAB A;  1Z60 A;  3NG2 A;  2LGG A;  4C9Z A;  5TRB A;  3U5O A;  1X4J A;  1DVP A;  2F42 A;  2K1J A;  2KWK A;  3EB6 A;  3ZVY A;  4YAT A;  2YRE A;  2JRJ A;  4MVT A;  4B7Y C;  2KYU A;  4WZ2 A;  2Y1M A;  4FIP A;  4QF3 A;  5KH9 A;  2RI7 A;  5LKU A;  2YQM A;  2HYE D;  2ECV A;  4CCG X;  5H1V A;  4WA6 A;  2CKL B;  2CSZ A;  2YUC A;  2KWN A;  4I7C A;  5I3L A;  5JG6 A;  1XWH A;  2JMD A;  2YT5 A;  5B78 A;  4P5O B;  4AYC B;  2KE1 A;  5C13 A;  1WGM A;  3PHD A;  4GND A;  2IDA A;  4WZ3 B;  4XI1 A;  5J3X A;  1U6G B;  2MIQ A;  3O7A A;  5H9M A;  4YBT A;  3LRQ A;  2C2L A;  2PNX A;  3T6R A; 
#chains in the Genus database with same CATH topology
 4CA1 A;  2K16 A;  3O37 A;  2MUM A;  2F6J A;  4GNF A;  1JM7 B;  1WEV A;  4ZUX U;  2D8S A;  3SHB A;  1WEQ A;  4V3L C;  2KFT A;  3MHH A;  5B77 A;  3PUR A;  2CT2 A;  4Q6F A;  4PTB A;  2QJ0 A;  2VJF B;  4UP0 A;  2XP0 A;  3ZNI A;  4X3G A;  2G6Q A;  2XEU A;  5B75 A;  5FB0 A;  2Y43 A;  3ASL A;  2M13 A;  4A4B A;  2YHO A;  3LQH A;  4LLB A;  3FL2 A;  2L43 A;  4AP4 A;  1ZBD B;  2XOZ A;  5FEY A;  2LXH C;  2HDP A;  3O70 A;  3U5N A;  2YQL A;  2FFW A;  4LK9 A;  3JUE A;  1F62 A;  1HYJ A;  5AIU A;  2D8U A;  3IHP A;  3EB5 A;  3N9Q A;  3MDB C;  2L7P A;  2I50 A;  3O33 A;  3M63 A;  5LKT A;  2MNY A;  3FAN A;  3ZYQ A;  1FBV A;  1WFK A;  5C11 A;  3N9L A;  4YC9 A;  2UZG A;  2Y1N A;  3GV4 A;  3V43 A;  2KWJ A;  4OGE A;  2AN6 A;  4AUQ B;  1N87 A;  5G0F A;  1WEU A;  1CHC A;  4GNE A;  4YAX A;  3N9P A;  2F6N A;  5TDR A;  4A49 A;  1WEE A;  1MBM A;  4YBM A;  2ECJ A;  4V3K C;  3RPG C;  2IQJ A;  2L5U A;  2OXQ C;  2KGI A;  2M85 A;  3H7H A;  5SVY A;  2M3H A;  5FER A;  3SOW A;  3DDT A;  5EYA F;  3LVQ E;  5LCW B;  3ZPV E;  2VPB A;  1VFY A;  3FM8 C;  1WEO A;  3N9M A;  4LKA A;  5LKZ A;  4F1P A;  1G25 A;  4PPE A;  3LQJ A;  5K3Q A;  3GL6 A;  3O35 A;  4A4C A;  2KIZ A;  2JUN A;  4N4F A;  3T9K A;  2KKY A;  4GB0 A;  3HTK C;  2MKE A;  2LN0 A;  2LXP C;  5DKA A;  2H0D B;  2CON A;  2FUU A;  4YAD A;  2E61 A;  2VJE B;  3I2D A;  2YW8 A;  4FK5 A;  5SVI B;  1WIM A;  1BOR A;  4S3O C;  2FUI A;  4ZDT A;  2CKL A;  4MSX A;  3RPG B;  4A0C D;  1T1H A;  2VNF A;  2ECN A;  2MD8 C;  2L75 A;  4QF2 A;  2JM3 A;  2G43 A;  4Z0O A;  4AYC A;  4I7D A;  2ECW A;  3T7L A;  1WEP A;  3ZPV 1;  4L7X A;  2QIZ A;  2QIC A;  3KNV A;  2KRE A;  3HCS A;  4YAB A;  1LDK C;  3LVR E;  3C5K A;  4H9D A;  2KWO A;  3ZTG A;  2CSY A;  2XOY A;  4R2Y A;  2LGK A;  4Z0R A;  3KV5 A;  2LQ6 A;  3M7K A;  4TKP B;  1JM7 A;  3LDY A;  2E6R A;  2YUR A;  2LGL A;  4LJN A;  2OWA A;  2KKX A;  2ECI A;  2MNZ A;  2RSD A;  3M62 A;  5TDW A;  4ZQL A;  1WEN A;  2FD4 A;  1RMD A;  4R8P K;  4UI9 B;  2P57 A;  2VJF A;  4IC3 A;  2PUY A;  2YU4 A;  4S3O B;  2YSM A;  4UP5 A;  3SOU A;  2ECG A;  3KDE C;  2JMI A;  5AIT A;  4FJC A;  3N9O A;  5KH7 A;  1WES A;  2CSV A;  3O34 A;  3ZVZ B;  1K2F A;  1X4I A;  1VD4 A;  2E6S A;  4OGC A;  4GNG A;  3KQI A;  2M1R A;  2LAU A;  2EXU A;  2EA6 A;  5SVX A;  3U5P A;  2ECT A;  3KV6 A;  2LRI C;  2K17 A;  2YHN A;  4BBQ A;  2JMJ A;  2RR4 A;  5G04 B;  2LV9 A;  3U5M A;  4R7E A;  3HCU A;  5TBN A;  2G45 A;  1V87 A;  1JOC A;  1VYX A;  3DWD A;  2ZET C;  2YYR A;  3Q1D A;  5B76 A;  2XB1 A;  4W4U A;  4AVX A;  2C2V S;  2MA6 A;  1Z2Q A;  2VPE A;  4WZ0 A;  3RTR B;  4BHW A;  3O36 A;  2YVR A;  4O62 A;  3QZV A;  2MT5 A;  1WEM A;  3L1Z B;  3L11 A;  2VPD A;  3N9N A;  5H1T A;  1E4U A;  1Z6U A;  4FO9 A;  3SOX A;  4YBS A;  3M99 A;  5LKX A;  2EOD A;  2NAA A;  2VP7 A;  5DIN A;  1LDJ B;  1X4U A;  4L58 A;  2LDR A;  1WEW A;  2CRW A;  2KR4 A;  3FAO A;  5D1M B;  4LAD B;  4N3W A;  1HYI A;  1MM3 A;  4F52 B;  2MD7 B;  2M6M A;  2L0B A;  1DCQ A;  4O64 A;  5KH3 A;  2KGG A;  3MHS A;  1FP0 A;  3C6W A;  2MA5 A;  5FB1 A;  2DSM A;  2BAY A;  4B86 C;  2LGV A;  3LQI A;  2FSA A;  1MM2 A;  3O47 A;  2L80 A;  5D1L B;  1WE9 A;  3DPL R;  2H0D A;  2KU3 A;  5B8D A;  5G05 B;  2CRR A;  3FEH A;  4NN2 A;  2VJE A;  2VPG A;  3DQV R;  1WIL A;  5SVI A;  3HCT A;  3L1X A;  5B79 A;  1IYM A;  2K4D A;  3PUQ A;  2DX8 A;  5D1K B;  4I7B A;  2YSJ A;  3VK6 A;  4IC2 A;  5H1U A;  2EGP A;  5TAB A;  1Z60 A;  3NG2 A;  2LGG A;  4C9Z A;  3SUB A;  5TRB A;  3U5O A;  1X4J A;  1DVP A;  2F42 A;  2K1J A;  2KWK A;  3EB6 A;  3ZVY A;  4YAT A;  3FJU B;  2YRE A;  2JRJ A;  4MVT A;  4B7Y C;  2KYU A;  2XOC A;  4WZ2 A;  2Y1M A;  4FIP A;  4QF3 A;  5KH9 A;  2RI7 A;  5LKU A;  2DJA A;  2YQM A;  2HYE D;  3E2D A;  3PLW A;  2ECV A;  4CCG X;  5H1V A;  2CKL B;  4WA6 A;  2CSZ A;  2YUC A;  2KWN A;  2EGM A;  4I7C A;  5I3L A;  5JG6 A;  1XWH A;  2JMD A;  2YT5 A;  5B78 A;  4P5O B;  3LJU X;  4AYC B;  2KE1 A;  5C13 A;  1WGM A;  3PHD A;  4GND A;  2IDA A;  4WZ3 B;  4XI1 A;  5J3X A;  1U6G B;  2MIQ A;  4QQ4 A;  3O7A A;  5H9M A;  4YBT A;  3LRQ A;  2C2L A;  2PNX A;  3T6R A;  2B0O E; 
#chains in the Genus database with same CATH homology
 4CA1 A;  2K16 A;  3O37 A;  2MUM A;  2F6J A;  4GNF A;  1JM7 B;  1WEV A;  4ZUX U;  2D8S A;  3SHB A;  1WEQ A;  4V3L C;  2KFT A;  3MHH A;  5B77 A;  3PUR A;  2CT2 A;  4Q6F A;  4PTB A;  2QJ0 A;  2VJF B;  4UP0 A;  3ZNI A;  4X3G A;  2G6Q A;  2XEU A;  5B75 A;  5FB0 A;  2Y43 A;  3ASL A;  4A4B A;  2YHO A;  3LQH A;  4LLB A;  3FL2 A;  2L43 A;  4AP4 A;  1ZBD B;  5FEY A;  2LXH C;  2HDP A;  3O70 A;  3U5N A;  2YQL A;  4LK9 A;  1F62 A;  1HYJ A;  5AIU A;  3IHP A;  3EB5 A;  3N9Q A;  2I50 A;  3O33 A;  3M63 A;  5LKT A;  2MNY A;  3ZYQ A;  1FBV A;  1WFK A;  5C11 A;  3N9L A;  4YC9 A;  2UZG A;  2Y1N A;  3GV4 A;  3V43 A;  2KWJ A;  2AN6 A;  4AUQ B;  1N87 A;  5G0F A;  1WEU A;  1CHC A;  4GNE A;  4YAX A;  3N9P A;  2F6N A;  5TDR A;  4A49 A;  1WEE A;  4YBM A;  2ECJ A;  4V3K C;  3RPG C;  2L5U A;  2OXQ C;  2KGI A;  2M85 A;  2M3H A;  5FER A;  3SOW A;  5EYA F;  5LCW B;  3ZPV E;  2VPB A;  1VFY A;  1WEO A;  3N9M A;  4LKA A;  5LKZ A;  1G25 A;  4PPE A;  3LQJ A;  3GL6 A;  3O35 A;  4A4C A;  2KIZ A;  4N4F A;  4GB0 A;  3HTK C;  2LN0 A;  2LXP C;  5DKA A;  2H0D B;  2FUU A;  4YAD A;  2VJE B;  3I2D A;  2YW8 A;  4FK5 A;  1WIM A;  1BOR A;  4S3O C;  2FUI A;  4ZDT A;  2CKL A;  4MSX A;  3RPG B;  4A0C D;  1T1H A;  2VNF A;  2ECN A;  2MD8 C;  2L75 A;  4QF2 A;  2G43 A;  4AYC A;  4I7D A;  2ECW A;  3T7L A;  1WEP A;  3ZPV 1;  4L7X A;  2QIZ A;  2QIC A;  3KNV A;  2KRE A;  3HCS A;  4YAB A;  1LDK C;  3C5K A;  2KWO A;  3ZTG A;  2CSY A;  4R2Y A;  2LGK A;  3KV5 A;  2LQ6 A;  4TKP B;  1JM7 A;  2E6R A;  2YUR A;  2LGL A;  4LJN A;  2ECI A;  2MNZ A;  2RSD A;  3M62 A;  5TDW A;  4ZQL A;  1WEN A;  1RMD A;  4R8P K;  4UI9 B;  2VJF A;  4IC3 A;  2PUY A;  2YU4 A;  4S3O B;  2YSM A;  4UP5 A;  3SOU A;  2ECG A;  2JMI A;  5AIT A;  4FJC A;  3N9O A;  5KH7 A;  1WES A;  3O34 A;  3ZVZ B;  1K2F A;  1X4I A;  1VD4 A;  2E6S A;  4GNG A;  3KQI A;  2M1R A;  2EA6 A;  3U5P A;  2ECT A;  3KV6 A;  2LRI C;  2K17 A;  2YHN A;  4BBQ A;  2JMJ A;  5G04 B;  2LV9 A;  3U5M A;  4R7E A;  3HCU A;  5TBN A;  2G45 A;  1V87 A;  1JOC A;  1VYX A;  2ZET C;  2YYR A;  5B76 A;  2XB1 A;  4W4U A;  4AVX A;  2C2V S;  2MA6 A;  1Z2Q A;  2VPE A;  4WZ0 A;  3RTR B;  4BHW A;  3O36 A;  3QZV A;  2MT5 A;  1WEM A;  3L1Z B;  3L11 A;  2VPD A;  3N9N A;  5H1T A;  1E4U A;  1Z6U A;  4FO9 A;  3SOX A;  4YBS A;  3M99 A;  5LKX A;  2EOD A;  2NAA A;  2VP7 A;  5DIN A;  1LDJ B;  1X4U A;  4L58 A;  2LDR A;  1WEW A;  2KR4 A;  5D1M B;  4LAD B;  4N3W A;  1HYI A;  1MM3 A;  4F52 B;  2MD7 B;  2M6M A;  2L0B A;  4O64 A;  5KH3 A;  2KGG A;  3MHS A;  1FP0 A;  3C6W A;  2MA5 A;  5FB1 A;  2BAY A;  4B86 C;  2LGV A;  3LQI A;  2FSA A;  1MM2 A;  2L80 A;  5D1L B;  1WE9 A;  3DPL R;  2H0D A;  2KU3 A;  5B8D A;  5G05 B;  4NN2 A;  2VJE A;  2VPG A;  3DQV R;  1WIL A;  3HCT A;  3L1X A;  5B79 A;  1IYM A;  2K4D A;  3PUQ A;  2DX8 A;  5D1K B;  4I7B A;  2YSJ A;  3VK6 A;  4IC2 A;  5H1U A;  2EGP A;  5TAB A;  1Z60 A;  3NG2 A;  2LGG A;  4C9Z A;  5TRB A;  3U5O A;  1X4J A;  1DVP A;  2F42 A;  2K1J A;  2KWK A;  3EB6 A;  3ZVY A;  4YAT A;  2YRE A;  2JRJ A;  4MVT A;  4B7Y C;  2KYU A;  4WZ2 A;  2Y1M A;  4FIP A;  4QF3 A;  5KH9 A;  2RI7 A;  5LKU A;  2YQM A;  2HYE D;  2ECV A;  4CCG X;  5H1V A;  4WA6 A;  2CKL B;  2CSZ A;  2YUC A;  2KWN A;  4I7C A;  5I3L A;  5JG6 A;  1XWH A;  2JMD A;  2YT5 A;  5B78 A;  4P5O B;  4AYC B;  2KE1 A;  5C13 A;  1WGM A;  3PHD A;  4GND A;  2IDA A;  4WZ3 B;  4XI1 A;  5J3X A;  1U6G B;  2MIQ A;  3O7A A;  5H9M A;  4YBT A;  3LRQ A;  2C2L A;  2PNX A;  3T6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...