2LQ6A

Solution structure of brd1 phd2 finger
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
79
Chain Sequence
MNIPPARWKLTCYLCKQKGVGASIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Bromodomain-containing protein 1
publication title Solution structure of an atypical PHD finger in BRPF2 and its interaction with DNA
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2012-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lq6A00
2FUUA 2YHOA 3ASLA 2NAAA 3EB5A 2JMIA 2KWKA 2MD8C 2LDRA 1U6GB 2ZETC 3N9OA 5KH9A 2YW8A 5TDRA 2VNFA 4R2YA 4LLBA 4NN2A 1WENA 3KNVA 4N3WA 2CT2A 5DINA 3ZNIA 4TKPB 2FUIA 1Z2QA 1JOCA 5D1MB 1VYXA 2C2VS 2K1JA 1DVPA 2Y1NA 2L5UA 4FJCA 4GNFA 3U5OA 4BHWA 5FB1A 2MIQA 2LV9A 2VJFB 4WZ2A 4AUQB 4WZ0A 5G05B 3PURA 3T7LA 3T6RA 2KIZA 2KGGA 1MM2A 4GNDA 2G6QA 2I50A 4S3OB 3SHBA 1HYJA 5B76A 3U5NA 4LK9A 1X4IA 2Y1MA 2KU3A 1WE9A 2MT5A 1G25A 3O7AA 1WEQA 4LADB 2YUCA 3SOWA 5H1UA 1JM7B 2XEUA 2LXPC 2YT5A 2DX8A 4F52B 2ECIA 4UP0A 3KQIA 1E4UA 5KH7A 4I7DA 2QJ0A 3M62A 2MA6A 2JRJA 3ZPV1 3RPGC 3M99A 2VJEA 2YU4A 2KWNA 5AITA 3GL6A 1WEMA 3RTRB 1WIMA 5FB0A 4N4FA 1N87A 2KGIA 5C13A 4UP5A 2MUMA 5I3LA 3LRQA 4C9ZA 1VD4A 4CA1A 5B78A 4YBSA 2YHNA 3NG2A 3L11A 2CSYA 3MHSA 2HDPA 4IC2A 4YATA 4YADA 2L0BA 2EA6A 2Y43A 4V3LC 2G43A 3N9MA 3ZYQA 3C6WA 4QF2A 2MA5A 4IC3A 4AYCA 3VK6A 3V43A 3GV4A 3U5PA 3I2DA 2VP7A 3O33A 3SOXA 2L75A 4B7YC 2ECVA 1F62A 1WGMA 5G04B 4UI9B 2OXQC 2LQ6A 3O36A 2JMDA 4S3OC 2E6RA 3ZPVE 4GB0A 1WEEA 2ECNA 4L58A 2M1RA 4A49A 1XWHA 3N9PA 3LQHA 2L80A 2K16A 3KV5A 2VPGA 3IHPA 4ZDTA 5C11A 1IYMA 1Z60A 3MHHA 3L1XA 2IDAA 5LKZA 1LDJB 4PPEA 3L1ZB 3O37A 1WEPA 2C2LA 4V3KC 4GNGA 2CSZA 1FP0A 3PHDA 4YBTA 1WEVA 2KWOA 2LGVA 1V87A 5AIUA 4I7BA 1MM3A 1CHCA 3DQVR 4CCGX 5B8DA 2JMJA 4XI1A 5B79A 4O64A 2LGLA 3EB6A 2EGPA 2LN0A 2CKLA 2M3HA 5DKAA 3LQJA 2YURA 2PUYA 5J3XA 5LKTA 2EODA 2MNZA 1Z6UA 3HTKC 2F6NA 5TDWA 2M85A 4R7EA 4Q6FA 5B75A 4BBQA 1WESA 2AN6A 5TBNA 5EYAF 4B86C 4A0CD 3RPGB 1JM7A 2MD7B 3LQIA 3QZVA 1WEWA 4L7XA 2G45A 4ZQLA 1WEUA 4YABA 3N9LA 2YSJA 4FK5A 2KREA 4W4UA 5KH3A 3HCSA 3ZVYA 2KE1A 2QICA 3SOUA 5LKXA 4AP4A 5FERA 2ECTA 2PNXA 1T1HA 3ZTGA 2LRIC 4A4BA 2D8SA 1X4JA 2K17A 2HYED 2KYUA 4LJNA 3O34A 2FSAA 2VPDA 2H0DA 1HYIA 3ZVZB 3C5KA 5TABA 4YBMA 3N9QA 4ZUXU 3O70A 2VJEB 5G0FA 2KFTA 5D1LB 5LKUA 5H1TA 2XB1A 3HCUA 4X3GA 2MNYA 2RSDA 2KR4A 3O35A 2CKLB 1FBVA 3M63A 4QF3A 4FO9A 2ECWA 4WA6A 4PTBA 2L43A 5LCWB 5H9MA 2YSMA 2VPBA 2VPEA 3N9NA 2LGKA 2YQLA 1WILA 5JG6A 2UZGA 2VJFA 2LGGA 4I7CA 4LKAA 2F42A 2ECGA 4WZ3B 2ECJA 1BORA 3KV6A 4YC9A 5H1VA 1LDKC 5B77A 3HCTA 4YAXA 2YQMA 1ZBDB 3U5MA 4AYCB 4MVTA 2LXHC 2RI7A 1WFKA 2BAYA 1RMDA 4GNEA 4AVXA 1VFYA 3PUQA 1WEOA 4MSXA 5D1KB 2YYRA 4A4CA 4FIPA 2KWJA 5FEYA 3DPLR 1K2FA 1X4UA 2QIZA 4P5OB 3FL2A 5TRBA 2K4DA 4R8PK 2YREA 2H0DB 2F6JA 2E6SA 2M6MA
chains in the Genus database with same CATH superfamily
2FUUA 4F1PA 5K3QA 2YHOA 3ASLA 2NAAA 3EB5A 2JMIA 2KWKA 2MD8C 2LDRA 2DSMA 1U6GB 2ZETC 3N9OA 5KH9A 2YW8A 5TDRA 2VNFA 4R2YA 4LLBA 4NN2A 1WENA 3KNVA 4N3WA 2CT2A 5DINA 3ZNIA 4TKPB 2FUIA 1Z2QA 1JOCA 5D1MB 1VYXA 2C2VS 2K1JA 3SUBA 1DVPA 2Y1NA 2L5UA 4FJCA 4GNFA 2FD4A 3U5OA 4BHWA 5FB1A 2MIQA 2LV9A 2VJFB 2KKXA 4WZ2A 4AUQB 4WZ0A 3H7HA 5G05B 3PURA 3T7LA 3T6RA 2KIZA 1DCQA 2YVRA 2KGGA 1MM2A 4GNDA 2G6QA 2I50A 4S3OB 3SHBA 1HYJA 5B76A 3U5NA 4LK9A 1X4IA 2Y1MA 2KU3A 1WE9A 2MT5A 1G25A 3O7AA 1WEQA 4LADB 2YUCA 3SOWA 5H1UA 3FJUB 3LVQE 1JM7B 2XEUA 2LXPC 2YT5A 2DX8A 4F52B 2ECIA 4UP0A 3KQIA 1E4UA 5KH7A 4I7DA 4QQ4A 2QJ0A 3M62A 2MA6A 3Q1DA 2JRJA 3ZPV1 3RPGC 3M99A 3LDYA 2VJEA 2YU4A 2KWNA 5AITA 2B0OE 2DJAA 3GL6A 1WEMA 3DDTA 3RTRB 1WIMA 5FB0A 4N4FA 1N87A 2KGIA 5C13A 4UP5A 2MUMA 5I3LA 2EXUA 3LRQA 4C9ZA 1VD4A 4CA1A 5B78A 4YBSA 2YHNA 3NG2A 3L11A 2CSYA 3MHSA 2CSVA 2HDPA 4IC2A 4YATA 2XOCA 4YADA 2L0BA 2EA6A 2Y43A 4V3LC 4Z0OA 2G43A 3N9MA 3ZYQA 3C6WA 4QF2A 2MA5A 4IC3A 4AYCA 3VK6A 3V43A 3GV4A 4OGEA 3FAOA 3U5PA 2D8UA 3I2DA 2VP7A 3O33A 3SOXA 2L75A 2LAUA 2ECVA 2M13A 1WGMA 4B7YC 1F62A 5G04B 4UI9B 2OXQC 2LQ6A 3O36A 2JMDA 4S3OC 2E6RA 3JUEA 3DWDA 3ZPVE 4GB0A 1WEEA 3PLWA 2ECNA 4L58A 2EGMA 2M1RA 4A49A 1XWHA 3N9PA 3LQHA 2L80A 2K16A 3LVRE 3KV5A 2VPGA 3IHPA 4ZDTA 5C11A 1IYMA 1Z60A 3MHHA 3L1XA 2IDAA 5LKZA 1LDJB 3KDEC 4PPEA 3L1ZB 3O37A 1WEPA 2L7PA 2C2LA 4V3KC 4GNGA 2CSZA 1FP0A 2XOZA 3PHDA 4YBTA 1WEVA 2KWOA 2LGVA 1V87A 5AIUA 4I7BA 5SVYA 2E61A 3MDBC 1MM3A 1CHCA 3DQVR 4CCGX 5B8DA 2JMJA 4XI1A 5B79A 4O64A 2LGLA 3EB6A 2EGPA 2LN0A 2CKLA 2M3HA 2KKYA 5DKAA 3LQJA 2YURA 2PUYA 5J3XA 5LKTA 2EODA 2MNZA 1Z6UA 3HTKC 2F6NA 5TDWA 2M85A 4R7EA 4Q6FA 5B75A 4BBQA 1WESA 2AN6A 5TBNA 5EYAF 4B86C 4A0CD 3RPGB 3M7KA 1JM7A 2MD7B 3LQIA 3QZVA 5SVXA 1WEWA 4L7XA 2G45A 4ZQLA 4OGCA 1WEUA 4YABA 2XP0A 3N9LA 2YSJA 4FK5A 2KREA 4W4UA 5KH3A 3HCSA 3ZVYA 2KE1A 2QICA 3SOUA 5LKXA 4AP4A 5FERA 2ECTA 2PNXA 1T1HA 3ZTGA 2LRIC 4A4BA 3FM8C 2RR4A 2D8SA 2FFWA 1X4JA 2K17A 5SVIA 2HYED 4Z0RA 2KYUA 4LJNA 3O34A 2CONA 2FSAA 2OWAA 2CRRA 2VPDA 2H0DA 1HYIA 3ZVZB 3C5KA 5TABA 4YBMA 3N9QA 4ZUXU 3O70A 2VJEB 5G0FA 2KFTA 5D1LB 5LKUA 5H1TA 1MBMA 2XB1A 3HCUA 2MNYA 4X3GA 2RSDA 2KR4A 3O35A 2CKLB 1FBVA 2P57A 3O47A 3M63A 4QF3A 4FO9A 2ECWA 2JM3A 4WA6A 4PTBA 2L43A 4O62A 5LCWB 5H9MA 2YSMA 2VPBA 2VPEA 3N9NA 2LGKA 2YQLA 1WILA 5JG6A 2UZGA 2VJFA 2LGGA 2MKEA 4I7CA 4LKAA 2F42A 2ECGA 4WZ3B 2ECJA 1BORA 3KV6A 3FEHA 4YC9A 5H1VA 1LDKC 3T9KA 3FANA 2CRWA 5B77A 3HCTA 3E2DA 4YAXA 2YQMA 1ZBDB 3U5MA 4AYCB 4H9DA 4MVTA 2LXHC 2RI7A 3LJUX 1WFKA 2BAYA 1RMDA 4GNEA 4AVXA 1VFYA 3PUQA 1WEOA 2XOYA 2IQJA 4MSXA 5D1KB 2YYRA 4A4CA 5SVIB 4FIPA 2KWJA 5FEYA 3DPLR 1K2FA 1X4UA 2QIZA 4P5OB 3FL2A 5TRBA 2K4DA 4R8PK 2YREA 2H0DB 2JUNA 2F6JA 2E6SA 2M6MA
chains in the Genus database with same CATH topology
2FUUA 2YHOA 3ASLA 2NAAA 3EB5A 2JMIA 2KWKA 2MD8C 2LDRA 1U6GB 2ZETC 3N9OA 5KH9A 2YW8A 5TDRA 2VNFA 4R2YA 4LLBA 4NN2A 1WENA 3KNVA 4N3WA 2CT2A 5DINA 3ZNIA 4TKPB 2FUIA 1Z2QA 1JOCA 5D1MB 1VYXA 2C2VS 2K1JA 1DVPA 2Y1NA 2L5UA 4FJCA 4GNFA 3U5OA 4BHWA 5FB1A 2MIQA 2LV9A 2VJFB 4WZ2A 4AUQB 4WZ0A 5G05B 3PURA 3T7LA 3T6RA 2KIZA 2KGGA 1MM2A 4GNDA 2G6QA 2I50A 4S3OB 3SHBA 1HYJA 5B76A 3U5NA 4LK9A 1X4IA 2Y1MA 2KU3A 1WE9A 2MT5A 1G25A 3O7AA 1WEQA 4LADB 2YUCA 3SOWA 5H1UA 1JM7B 2XEUA 2LXPC 2YT5A 2DX8A 4F52B 2ECIA 4UP0A 3KQIA 1E4UA 5KH7A 4I7DA 2QJ0A 3M62A 2MA6A 2JRJA 3ZPV1 3RPGC 3M99A 2VJEA 2YU4A 2KWNA 5AITA 3GL6A 1WEMA 3RTRB 1WIMA 5FB0A 4N4FA 1N87A 2KGIA 5C13A 4UP5A 2MUMA 5I3LA 3LRQA 4C9ZA 1VD4A 4CA1A 5B78A 4YBSA 2YHNA 3NG2A 3L11A 2CSYA 3MHSA 2HDPA 4IC2A 4YATA 4YADA 2L0BA 2EA6A 2Y43A 4V3LC 2G43A 3N9MA 3ZYQA 3C6WA 4QF2A 2MA5A 4IC3A 4AYCA 3VK6A 3V43A 3GV4A 3U5PA 3I2DA 2VP7A 3O33A 3SOXA 2L75A 4B7YC 2ECVA 1F62A 1WGMA 5G04B 4UI9B 2OXQC 2LQ6A 3O36A 2JMDA 4S3OC 2E6RA 3ZPVE 4GB0A 1WEEA 2ECNA 4L58A 2M1RA 4A49A 1XWHA 3N9PA 3LQHA 2L80A 2K16A 3KV5A 2VPGA 3IHPA 4ZDTA 5C11A 1IYMA 1Z60A 3MHHA 3L1XA 2IDAA 5LKZA 1LDJB 4PPEA 3L1ZB 3O37A 1WEPA 2C2LA 4V3KC 4GNGA 2CSZA 1FP0A 3PHDA 4YBTA 1WEVA 2KWOA 2LGVA 1V87A 5AIUA 4I7BA 1MM3A 1CHCA 3DQVR 4CCGX 5B8DA 2JMJA 4XI1A 5B79A 4O64A 2LGLA 3EB6A 2EGPA 2LN0A 2CKLA 2M3HA 5DKAA 3LQJA 2YURA 2PUYA 5J3XA 5LKTA 2EODA 2MNZA 1Z6UA 3HTKC 2F6NA 5TDWA 2M85A 4R7EA 4Q6FA 5B75A 4BBQA 1WESA 2AN6A 5TBNA 5EYAF 4B86C 4A0CD 3RPGB 1JM7A 2MD7B 3LQIA 3QZVA 1WEWA 4L7XA 2G45A 4ZQLA 1WEUA 4YABA 3N9LA 2YSJA 4FK5A 2KREA 4W4UA 5KH3A 3HCSA 3ZVYA 2KE1A 2QICA 3SOUA 5LKXA 4AP4A 5FERA 2ECTA 2PNXA 1T1HA 3ZTGA 2LRIC 4A4BA 2D8SA 1X4JA 2K17A 2HYED 2KYUA 4LJNA 3O34A 2FSAA 2VPDA 2H0DA 1HYIA 3ZVZB 3C5KA 5TABA 4YBMA 3N9QA 4ZUXU 3O70A 2VJEB 5G0FA 2KFTA 5D1LB 5LKUA 5H1TA 2XB1A 3HCUA 4X3GA 2MNYA 2RSDA 2KR4A 3O35A 2CKLB 1FBVA 3M63A 4QF3A 4FO9A 2ECWA 4WA6A 4PTBA 2L43A 5LCWB 5H9MA 2YSMA 2VPBA 2VPEA 3N9NA 2LGKA 2YQLA 1WILA 5JG6A 2UZGA 2VJFA 2LGGA 4I7CA 4LKAA 2F42A 2ECGA 4WZ3B 2ECJA 1BORA 3KV6A 4YC9A 5H1VA 1LDKC 5B77A 3HCTA 4YAXA 2YQMA 1ZBDB 3U5MA 4AYCB 4MVTA 2LXHC 2RI7A 1WFKA 2BAYA 1RMDA 4GNEA 4AVXA 1VFYA 3PUQA 1WEOA 4MSXA 5D1KB 2YYRA 4A4CA 4FIPA 2KWJA 5FEYA 3DPLR 1K2FA 1X4UA 2QIZA 4P5OB 3FL2A 5TRBA 2K4DA 4R8PK 2YREA 2H0DB 2F6JA 2E6SA 2M6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUU A;  2YHO A;  3ASL A;  2NAA A;  3EB5 A;  2JMI A;  2KWK A;  2MD8 C;  2LDR A;  1U6G B;  2ZET C;  3N9O A;  5KH9 A;  2YW8 A;  5TDR A;  2VNF A;  4R2Y A;  4LLB A;  4NN2 A;  1WEN A;  3KNV A;  4N3W A;  2CT2 A;  5DIN A;  3ZNI A;  4TKP B;  2FUI A;  1Z2Q A;  1JOC A;  5D1M B;  1VYX A;  2C2V S;  2K1J A;  1DVP A;  2Y1N A;  2L5U A;  4FJC A;  4GNF A;  3U5O A;  4BHW A;  5FB1 A;  2MIQ A;  2LV9 A;  2VJF B;  4WZ2 A;  4AUQ B;  4WZ0 A;  5G05 B;  3PUR A;  3T7L A;  3T6R A;  2KIZ A;  2KGG A;  1MM2 A;  4GND A;  2G6Q A;  2I50 A;  4S3O B;  3SHB A;  1HYJ A;  5B76 A;  3U5N A;  4LK9 A;  1X4I A;  2Y1M A;  2KU3 A;  1WE9 A;  2MT5 A;  1G25 A;  3O7A A;  1WEQ A;  4LAD B;  2YUC A;  3SOW A;  5H1U A;  1JM7 B;  2XEU A;  2LXP C;  2YT5 A;  2DX8 A;  4F52 B;  2ECI A;  4UP0 A;  3KQI A;  1E4U A;  5KH7 A;  4I7D A;  2QJ0 A;  3M62 A;  2MA6 A;  2JRJ A;  3ZPV 1;  3RPG C;  3M99 A;  2VJE A;  2YU4 A;  2KWN A;  5AIT A;  3GL6 A;  1WEM A;  3RTR B;  1WIM A;  5FB0 A;  4N4F A;  1N87 A;  2KGI A;  5C13 A;  4UP5 A;  2MUM A;  5I3L A;  3LRQ A;  4C9Z A;  1VD4 A;  4CA1 A;  5B78 A;  4YBS A;  2YHN A;  3NG2 A;  3L11 A;  2CSY A;  3MHS A;  2HDP A;  4IC2 A;  4YAT A;  4YAD A;  2L0B A;  2EA6 A;  2Y43 A;  4V3L C;  2G43 A;  3N9M A;  3ZYQ A;  3C6W A;  4QF2 A;  2MA5 A;  4IC3 A;  4AYC A;  3VK6 A;  3V43 A;  3GV4 A;  3U5P A;  3I2D A;  2VP7 A;  3O33 A;  3SOX A;  2L75 A;  4B7Y C;  2ECV A;  1F62 A;  1WGM A;  5G04 B;  4UI9 B;  2OXQ C;  2LQ6 A;  3O36 A;  2JMD A;  4S3O C;  2E6R A;  3ZPV E;  4GB0 A;  1WEE A;  2ECN A;  4L58 A;  2M1R A;  4A49 A;  1XWH A;  3N9P A;  3LQH A;  2L80 A;  2K16 A;  3KV5 A;  2VPG A;  3IHP A;  4ZDT A;  5C11 A;  1IYM A;  1Z60 A;  3MHH A;  3L1X A;  2IDA A;  5LKZ A;  1LDJ B;  4PPE A;  3L1Z B;  3O37 A;  1WEP A;  2C2L A;  4V3K C;  4GNG A;  2CSZ A;  1FP0 A;  3PHD A;  4YBT A;  1WEV A;  2KWO A;  2LGV A;  1V87 A;  5AIU A;  4I7B A;  1MM3 A;  1CHC A;  3DQV R;  4CCG X;  5B8D A;  2JMJ A;  4XI1 A;  5B79 A;  4O64 A;  2LGL A;  3EB6 A;  2EGP A;  2LN0 A;  2CKL A;  2M3H A;  5DKA A;  3LQJ A;  2YUR A;  2PUY A;  5J3X A;  5LKT A;  2EOD A;  2MNZ A;  1Z6U A;  3HTK C;  2F6N A;  5TDW A;  2M85 A;  4R7E A;  4Q6F A;  5B75 A;  4BBQ A;  1WES A;  2AN6 A;  5TBN A;  5EYA F;  4B86 C;  4A0C D;  3RPG B;  1JM7 A;  2MD7 B;  3LQI A;  3QZV A;  1WEW A;  4L7X A;  2G45 A;  4ZQL A;  1WEU A;  4YAB A;  3N9L A;  2YSJ A;  4FK5 A;  2KRE A;  4W4U A;  5KH3 A;  3HCS A;  3ZVY A;  2KE1 A;  2QIC A;  3SOU A;  5LKX A;  4AP4 A;  5FER A;  2ECT A;  2PNX A;  1T1H A;  3ZTG A;  2LRI C;  4A4B A;  2D8S A;  1X4J A;  2K17 A;  2HYE D;  2KYU A;  4LJN A;  3O34 A;  2FSA A;  2VPD A;  2H0D A;  1HYI A;  3ZVZ B;  3C5K A;  5TAB A;  4YBM A;  3N9Q A;  4ZUX U;  3O70 A;  2VJE B;  5G0F A;  2KFT A;  5D1L B;  5LKU A;  5H1T A;  2XB1 A;  3HCU A;  4X3G A;  2MNY A;  2RSD A;  2KR4 A;  3O35 A;  2CKL B;  1FBV A;  3M63 A;  4QF3 A;  4FO9 A;  2ECW A;  4WA6 A;  4PTB A;  2L43 A;  5LCW B;  5H9M A;  2YSM A;  2VPB A;  2VPE A;  3N9N A;  2LGK A;  2YQL A;  1WIL A;  5JG6 A;  2UZG A;  2VJF A;  2LGG A;  4I7C A;  4LKA A;  2F42 A;  2ECG A;  4WZ3 B;  2ECJ A;  1BOR A;  3KV6 A;  4YC9 A;  5H1V A;  1LDK C;  5B77 A;  3HCT A;  4YAX A;  2YQM A;  1ZBD B;  3U5M A;  4AYC B;  4MVT A;  2LXH C;  2RI7 A;  1WFK A;  2BAY A;  1RMD A;  4GNE A;  4AVX A;  1VFY A;  3PUQ A;  1WEO A;  4MSX A;  5D1K B;  2YYR A;  4A4C A;  4FIP A;  2KWJ A;  5FEY A;  3DPL R;  1K2F A;  1X4U A;  2QIZ A;  4P5O B;  3FL2 A;  5TRB A;  2K4D A;  4R8P K;  2YRE A;  2H0D B;  2F6J A;  2E6S A;  2M6M A; 
#chains in the Genus database with same CATH topology
 2FUU A;  4F1P A;  5K3Q A;  2YHO A;  3ASL A;  2NAA A;  3EB5 A;  2JMI A;  2KWK A;  2MD8 C;  2LDR A;  2DSM A;  1U6G B;  2ZET C;  3N9O A;  5KH9 A;  2YW8 A;  5TDR A;  2VNF A;  4R2Y A;  4LLB A;  4NN2 A;  1WEN A;  3KNV A;  4N3W A;  2CT2 A;  5DIN A;  3ZNI A;  4TKP B;  2FUI A;  1Z2Q A;  1JOC A;  5D1M B;  1VYX A;  2C2V S;  2K1J A;  3SUB A;  1DVP A;  2Y1N A;  2L5U A;  4FJC A;  4GNF A;  2FD4 A;  3U5O A;  4BHW A;  5FB1 A;  2MIQ A;  2LV9 A;  2VJF B;  2KKX A;  4WZ2 A;  4AUQ B;  4WZ0 A;  3H7H A;  5G05 B;  3PUR A;  3T7L A;  3T6R A;  2KIZ A;  1DCQ A;  2YVR A;  2KGG A;  1MM2 A;  4GND A;  2G6Q A;  2I50 A;  4S3O B;  3SHB A;  1HYJ A;  5B76 A;  3U5N A;  4LK9 A;  1X4I A;  2Y1M A;  2KU3 A;  1WE9 A;  2MT5 A;  1G25 A;  3O7A A;  1WEQ A;  4LAD B;  2YUC A;  3SOW A;  5H1U A;  3FJU B;  3LVQ E;  1JM7 B;  2XEU A;  2LXP C;  2YT5 A;  2DX8 A;  4F52 B;  2ECI A;  4UP0 A;  3KQI A;  1E4U A;  5KH7 A;  4I7D A;  4QQ4 A;  2QJ0 A;  3M62 A;  2MA6 A;  3Q1D A;  2JRJ A;  3ZPV 1;  3RPG C;  3M99 A;  3LDY A;  2VJE A;  2YU4 A;  2KWN A;  5AIT A;  2B0O E;  2DJA A;  3GL6 A;  1WEM A;  3DDT A;  3RTR B;  1WIM A;  5FB0 A;  4N4F A;  1N87 A;  2KGI A;  5C13 A;  4UP5 A;  2MUM A;  5I3L A;  2EXU A;  3LRQ A;  4C9Z A;  1VD4 A;  4CA1 A;  5B78 A;  4YBS A;  2YHN A;  3NG2 A;  3L11 A;  2CSY A;  3MHS A;  2CSV A;  2HDP A;  4IC2 A;  4YAT A;  2XOC A;  4YAD A;  2L0B A;  2EA6 A;  2Y43 A;  4V3L C;  4Z0O A;  2G43 A;  3N9M A;  3ZYQ A;  3C6W A;  4QF2 A;  2MA5 A;  4IC3 A;  4AYC A;  3VK6 A;  3V43 A;  3GV4 A;  4OGE A;  3FAO A;  3U5P A;  2D8U A;  3I2D A;  2VP7 A;  3O33 A;  3SOX A;  2L75 A;  2LAU A;  2ECV A;  2M13 A;  1WGM A;  4B7Y C;  1F62 A;  5G04 B;  4UI9 B;  2OXQ C;  2LQ6 A;  3O36 A;  2JMD A;  4S3O C;  2E6R A;  3JUE A;  3DWD A;  3ZPV E;  4GB0 A;  1WEE A;  3PLW A;  2ECN A;  4L58 A;  2EGM A;  2M1R A;  4A49 A;  1XWH A;  3N9P A;  3LQH A;  2L80 A;  2K16 A;  3LVR E;  3KV5 A;  2VPG A;  3IHP A;  4ZDT A;  5C11 A;  1IYM A;  1Z60 A;  3MHH A;  3L1X A;  2IDA A;  5LKZ A;  1LDJ B;  3KDE C;  4PPE A;  3L1Z B;  3O37 A;  1WEP A;  2L7P A;  2C2L A;  4V3K C;  4GNG A;  2CSZ A;  1FP0 A;  2XOZ A;  3PHD A;  4YBT A;  1WEV A;  2KWO A;  2LGV A;  1V87 A;  5AIU A;  4I7B A;  5SVY A;  2E61 A;  3MDB C;  1MM3 A;  1CHC A;  3DQV R;  4CCG X;  5B8D A;  2JMJ A;  4XI1 A;  5B79 A;  4O64 A;  2LGL A;  3EB6 A;  2EGP A;  2LN0 A;  2CKL A;  2M3H A;  2KKY A;  5DKA A;  3LQJ A;  2YUR A;  2PUY A;  5J3X A;  5LKT A;  2EOD A;  2MNZ A;  1Z6U A;  3HTK C;  2F6N A;  5TDW A;  2M85 A;  4R7E A;  4Q6F A;  5B75 A;  4BBQ A;  1WES A;  2AN6 A;  5TBN A;  5EYA F;  4B86 C;  4A0C D;  3RPG B;  3M7K A;  1JM7 A;  2MD7 B;  3LQI A;  3QZV A;  5SVX A;  1WEW A;  4L7X A;  2G45 A;  4ZQL A;  4OGC A;  1WEU A;  4YAB A;  2XP0 A;  3N9L A;  2YSJ A;  4FK5 A;  2KRE A;  4W4U A;  5KH3 A;  3HCS A;  3ZVY A;  2KE1 A;  2QIC A;  3SOU A;  5LKX A;  4AP4 A;  5FER A;  2ECT A;  2PNX A;  1T1H A;  3ZTG A;  2LRI C;  4A4B A;  3FM8 C;  2RR4 A;  2D8S A;  2FFW A;  1X4J A;  2K17 A;  5SVI A;  2HYE D;  4Z0R A;  2KYU A;  4LJN A;  3O34 A;  2CON A;  2FSA A;  2OWA A;  2CRR A;  2VPD A;  2H0D A;  1HYI A;  3ZVZ B;  3C5K A;  5TAB A;  4YBM A;  3N9Q A;  4ZUX U;  3O70 A;  2VJE B;  5G0F A;  2KFT A;  5D1L B;  5LKU A;  5H1T A;  1MBM A;  2XB1 A;  3HCU A;  2MNY A;  4X3G A;  2RSD A;  2KR4 A;  3O35 A;  2CKL B;  1FBV A;  2P57 A;  3O47 A;  3M63 A;  4QF3 A;  4FO9 A;  2ECW A;  2JM3 A;  4WA6 A;  4PTB A;  2L43 A;  4O62 A;  5LCW B;  5H9M A;  2YSM A;  2VPB A;  2VPE A;  3N9N A;  2LGK A;  2YQL A;  1WIL A;  5JG6 A;  2UZG A;  2VJF A;  2LGG A;  2MKE A;  4I7C A;  4LKA A;  2F42 A;  2ECG A;  4WZ3 B;  2ECJ A;  1BOR A;  3KV6 A;  3FEH A;  4YC9 A;  5H1V A;  1LDK C;  3T9K A;  3FAN A;  2CRW A;  5B77 A;  3HCT A;  3E2D A;  4YAX A;  2YQM A;  1ZBD B;  3U5M A;  4AYC B;  4H9D A;  4MVT A;  2LXH C;  2RI7 A;  3LJU X;  1WFK A;  2BAY A;  1RMD A;  4GNE A;  4AVX A;  1VFY A;  3PUQ A;  1WEO A;  2XOY A;  2IQJ A;  4MSX A;  5D1K B;  2YYR A;  4A4C A;  5SVI B;  4FIP A;  2KWJ A;  5FEY A;  3DPL R;  1K2F A;  1X4U A;  2QIZ A;  4P5O B;  3FL2 A;  5TRB A;  2K4D A;  4R8P K;  2YRE A;  2H0D B;  2JUN A;  2F6J A;  2E6S A;  2M6M A; 
#chains in the Genus database with same CATH homology
 2FUU A;  2YHO A;  3ASL A;  2NAA A;  3EB5 A;  2JMI A;  2KWK A;  2MD8 C;  2LDR A;  1U6G B;  2ZET C;  3N9O A;  5KH9 A;  2YW8 A;  5TDR A;  2VNF A;  4R2Y A;  4LLB A;  4NN2 A;  1WEN A;  3KNV A;  4N3W A;  2CT2 A;  5DIN A;  3ZNI A;  4TKP B;  2FUI A;  1Z2Q A;  1JOC A;  5D1M B;  1VYX A;  2C2V S;  2K1J A;  1DVP A;  2Y1N A;  2L5U A;  4FJC A;  4GNF A;  3U5O A;  4BHW A;  5FB1 A;  2MIQ A;  2LV9 A;  2VJF B;  4WZ2 A;  4AUQ B;  4WZ0 A;  5G05 B;  3PUR A;  3T7L A;  3T6R A;  2KIZ A;  2KGG A;  1MM2 A;  4GND A;  2G6Q A;  2I50 A;  4S3O B;  3SHB A;  1HYJ A;  5B76 A;  3U5N A;  4LK9 A;  1X4I A;  2Y1M A;  2KU3 A;  1WE9 A;  2MT5 A;  1G25 A;  3O7A A;  1WEQ A;  4LAD B;  2YUC A;  3SOW A;  5H1U A;  1JM7 B;  2XEU A;  2LXP C;  2YT5 A;  2DX8 A;  4F52 B;  2ECI A;  4UP0 A;  3KQI A;  1E4U A;  5KH7 A;  4I7D A;  2QJ0 A;  3M62 A;  2MA6 A;  2JRJ A;  3ZPV 1;  3RPG C;  3M99 A;  2VJE A;  2YU4 A;  2KWN A;  5AIT A;  3GL6 A;  1WEM A;  3RTR B;  1WIM A;  5FB0 A;  4N4F A;  1N87 A;  2KGI A;  5C13 A;  4UP5 A;  2MUM A;  5I3L A;  3LRQ A;  4C9Z A;  1VD4 A;  4CA1 A;  5B78 A;  4YBS A;  2YHN A;  3NG2 A;  3L11 A;  2CSY A;  3MHS A;  2HDP A;  4IC2 A;  4YAT A;  4YAD A;  2L0B A;  2EA6 A;  2Y43 A;  4V3L C;  2G43 A;  3N9M A;  3ZYQ A;  3C6W A;  4QF2 A;  2MA5 A;  4IC3 A;  4AYC A;  3VK6 A;  3V43 A;  3GV4 A;  3U5P A;  3I2D A;  2VP7 A;  3O33 A;  3SOX A;  2L75 A;  4B7Y C;  2ECV A;  1F62 A;  1WGM A;  5G04 B;  4UI9 B;  2OXQ C;  2LQ6 A;  3O36 A;  2JMD A;  4S3O C;  2E6R A;  3ZPV E;  4GB0 A;  1WEE A;  2ECN A;  4L58 A;  2M1R A;  4A49 A;  1XWH A;  3N9P A;  3LQH A;  2L80 A;  2K16 A;  3KV5 A;  2VPG A;  3IHP A;  4ZDT A;  5C11 A;  1IYM A;  1Z60 A;  3MHH A;  3L1X A;  2IDA A;  5LKZ A;  1LDJ B;  4PPE A;  3L1Z B;  3O37 A;  1WEP A;  2C2L A;  4V3K C;  4GNG A;  2CSZ A;  1FP0 A;  3PHD A;  4YBT A;  1WEV A;  2KWO A;  2LGV A;  1V87 A;  5AIU A;  4I7B A;  1MM3 A;  1CHC A;  3DQV R;  4CCG X;  5B8D A;  2JMJ A;  4XI1 A;  5B79 A;  4O64 A;  2LGL A;  3EB6 A;  2EGP A;  2LN0 A;  2CKL A;  2M3H A;  5DKA A;  3LQJ A;  2YUR A;  2PUY A;  5J3X A;  5LKT A;  2EOD A;  2MNZ A;  1Z6U A;  3HTK C;  2F6N A;  5TDW A;  2M85 A;  4R7E A;  4Q6F A;  5B75 A;  4BBQ A;  1WES A;  2AN6 A;  5TBN A;  5EYA F;  4B86 C;  4A0C D;  3RPG B;  1JM7 A;  2MD7 B;  3LQI A;  3QZV A;  1WEW A;  4L7X A;  2G45 A;  4ZQL A;  1WEU A;  4YAB A;  3N9L A;  2YSJ A;  4FK5 A;  2KRE A;  4W4U A;  5KH3 A;  3HCS A;  3ZVY A;  2KE1 A;  2QIC A;  3SOU A;  5LKX A;  4AP4 A;  5FER A;  2ECT A;  2PNX A;  1T1H A;  3ZTG A;  2LRI C;  4A4B A;  2D8S A;  1X4J A;  2K17 A;  2HYE D;  2KYU A;  4LJN A;  3O34 A;  2FSA A;  2VPD A;  2H0D A;  1HYI A;  3ZVZ B;  3C5K A;  5TAB A;  4YBM A;  3N9Q A;  4ZUX U;  3O70 A;  2VJE B;  5G0F A;  2KFT A;  5D1L B;  5LKU A;  5H1T A;  2XB1 A;  3HCU A;  4X3G A;  2MNY A;  2RSD A;  2KR4 A;  3O35 A;  2CKL B;  1FBV A;  3M63 A;  4QF3 A;  4FO9 A;  2ECW A;  4WA6 A;  4PTB A;  2L43 A;  5LCW B;  5H9M A;  2YSM A;  2VPB A;  2VPE A;  3N9N A;  2LGK A;  2YQL A;  1WIL A;  5JG6 A;  2UZG A;  2VJF A;  2LGG A;  4I7C A;  4LKA A;  2F42 A;  2ECG A;  4WZ3 B;  2ECJ A;  1BOR A;  3KV6 A;  4YC9 A;  5H1V A;  1LDK C;  5B77 A;  3HCT A;  4YAX A;  2YQM A;  1ZBD B;  3U5M A;  4AYC B;  4MVT A;  2LXH C;  2RI7 A;  1WFK A;  2BAY A;  1RMD A;  4GNE A;  4AVX A;  1VFY A;  3PUQ A;  1WEO A;  4MSX A;  5D1K B;  2YYR A;  4A4C A;  4FIP A;  2KWJ A;  5FEY A;  3DPL R;  1K2F A;  1X4U A;  2QIZ A;  4P5O B;  3FL2 A;  5TRB A;  2K4D A;  4R8P K;  2YRE A;  2H0D B;  2F6J A;  2E6S A;  2M6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...