2LQ6A

Solution structure of brd1 phd2 finger
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
79
Chain Sequence
b'MNIPPARWKLTCYLCKQKGVGASIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 1
publication title Solution structure of an atypical PHD finger in BRPF2 and its interaction with DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 11
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2012-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lq6A00
5TDWA 2LXPC 2Y1MA 4YBTA 5AIUA 3RTRB 3LQHA 3O36A 2VJFA 3NG2A 3HCTA 4R7EA 3N9OA 1JM7B 1VD4A 2KYUA 2D8SA 4S3OB 1FP0A 2KWKA 3DPLR 4N3WA 2LGLA 1N87A 2KWJA 3LQJA 2L0BA 2LGKA 1WFKA 2LGVA 4LKAA 1V87A 4I7CA 2LGGA 2ECJA 2VJFB 3RPGC 2VJEA 2KR4A 4O64A 4A49A 3MHHA 2JRJA 2MIQA 2H0DA 2HDPA 3N9QA 4YAXA 2L43A 4WZ3B 2KWNA 3ZNIA 1K2FA 2KWOA 2YUCA 4ZDTA 4R2YA 3MHSA 3O7AA 5EYAF 2YHOA 4X3GA 2OXQC 2QICA 2LRIC 3HCSA 2KREA 4TKPB 4A0CD 1X4JA 3KNVA 3PHDA 4AP4A 4F52B 4WA6A 2LN0A 2VJEB 1F62A 3ASLA 4W4UA 4LJNA 4C9ZA 1E4UA 4IC2A 4LADB 2JMIA 3PUQA 4A4CA 1X4UA 1VYXA 2CSYA 2RI7A 4UI9B 2VPDA 5B8DA 2MA6A 4FO9A 3O35A 1XWHA 1MM3A 3SHBA 2NAAA 5DINA 4ZUXU 5LKTA 1WILA 2HYED 4CCGX 2E6RA 3U5NA 2FUUA 2C2LA 5C13A 5TDRA 2ECNA 4YATA 4I7DA 4GNEA 2M6MA 4UP5A 2F6NA 2KFTA 2CKLA 1T1HA 4YBSA 5D1KB 3O70A 1Z2QA 4LK9A 2XEUA 2MA5A 4IC3A 2KGIA 4UP0A 5I3LA 1Z6UA 2MD8C 5B77A 3KQIA 2ECVA 4GNGA 3M99A 5FEYA 4MVTA 2YREA 4V3LC 2ECTA 1LDJB 3HTKC 2LQ6A 1FBVA 1IYMA 4A4BA 2CKLB 2L75A 5G04B 1WENA 4XI1A 4YADA 2FUIA 5D1MB 1Z60A 4MSXA 1WEMA 1WESA 3U5MA 5LKUA 5FB0A 4AYCB 4BHWA 2YSJA 2C2VS 2EA6A 2VP7A 5LKZA 1BORA 4WZ2A 5LCWB 3QZVA 3O37A 5G0FA 2MUMA 1HYIA 4QF3A 2UZGA 3N9MA 4B7YC 3M62A 2JMDA 2FSAA 1WEEA 5B76A 2G6QA 4S3OC 4N4FA 2ZETC 4I7BA 3M63A 2LV9A 2IDAA 4LLBA 2PNXA 2YURA 4GNDA 3C5KA 2M3HA 4AUQB 3V43A 5FB1A 4PPEA 3VK6A 3U5PA 1WEVA 2L5UA 5DKAA 2K17A 2MT5A 2CSZA 3GV4A 3ZYQA 4CA1A 4P5OB 3N9NA 3HCUA 2ECGA 3N9PA 4YBMA 5C11A 2VPGA 2VPEA 3T6RA 3ZPVE 5B75A 5D1LB 3EB5A 5J3XA 4YC9A 4PTBA 1MM2A 3RPGB 1WEQA 2XB1A 5KH3A 1G25A 2YU4A 1WEOA 4AVXA 3ZPV1 1WE9A 2KGGA 1RMDA 2E6SA 4GNFA 1WIMA 4AYCA 3LRQA 1DVPA 4YABA 4QF2A 2EODA 3O34A 4WZ0A 2L80A 1WEWA 2RSDA 2Y43A 5B79A 1CHCA 2Y1NA 2BAYA 2F6JA 4GB0A 2YQLA 3DQVR 4FIPA 5TRBA 5TABA 2QJ0A 2VPBA 2LDRA 1WEUA 2PUYA 3FL2A 2KE1A 5KH7A 2I50A 1ZBDB 5AITA 1VFYA 2MNYA 3L1ZB 2YYRA 3O33A 2M1RA 2YQMA 5FERA 1WEPA 4L58A 3KV5A 2KU3A 3ZTGA 3SOWA 4NN2A 2LXHC 1JOCA 1WGMA 2ECWA 2JMJA 2KIZA 2YT5A 2YW8A 5G05B 5H1VA 2EGPA 2G45A 2K16A 3SOUA 4ZQLA 5B78A 3L11A 4V3KC 2K4DA 3L1XA 5H1TA 1U6GB 5JG6A 2CT2A 2QIZA 3LQIA 3GL6A 5H1UA 4L7XA 5KH9A 2YSMA 1LDKC 5LKXA 2H0DB 3I2DA 3SOXA 3C6WA 3T7LA 3N9LA 1X4IA 2ECIA 2G43A 4R8PK 2MNZA 3PURA 4Q6FA 3IHPA 4B86C 2K1JA 2YHNA 1HYJA 4FK5A 2VNFA 4FJCA 5H9MA 2MD7B 2F42A 3EB6A 3U5OA 3ZVYA 5TBNA 2M85A 1JM7A 2DX8A 2AN6A 3ZVZB 4BBQA 3KV6A
chains in the Genus database with same CATH superfamily
2B0OE 5TDWA 2LXPC 3PLWA 2Y1MA 4YBTA 5AIUA 3RTRB 3LQHA 3O36A 5SVIB 2VJFA 3NG2A 3HCTA 4R7EA 3N9OA 1JM7B 2CONA 2OWAA 1VD4A 3DWDA 2KYUA 2D8SA 4S3OB 1FP0A 2KWKA 4H9DA 3DPLR 1DCQA 4N3WA 2LGLA 1N87A 2KWJA 3LQJA 2L0BA 2LGKA 1WFKA 2LGVA 4LKAA 1V87A 4I7CA 2MKEA 2LGGA 2RR4A 2ECJA 3MDBC 2VJFB 3RPGC 3T9KA 2VJEA 2KR4A 4O64A 4A49A 3MHHA 2JRJA 2MIQA 2YVRA 2H0DA 2HDPA 3N9QA 4YAXA 3SUBA 2L43A 4WZ3B 2KWNA 3ZNIA 1K2FA 2KWOA 3FJUB 2YUCA 4ZDTA 4R2YA 3MHSA 3O7AA 5EYAF 2YHOA 4X3GA 2OXQC 2QICA 2LRIC 3HCSA 2KREA 4TKPB 4A0CD 1X4JA 3KNVA 3PHDA 4AP4A 4F52B 4WA6A 2LN0A 3JUEA 2VJEB 1F62A 3ASLA 4W4UA 4LJNA 3Q1DA 2XOZA 4C9ZA 1E4UA 4IC2A 4LADB 2JMIA 3PUQA 4A4CA 1X4UA 1VYXA 2CSYA 2RI7A 4UI9B 2VPDA 5B8DA 2MA6A 4FO9A 3O35A 1XWHA 2CRWA 1MM3A 3SHBA 2NAAA 5DINA 4ZUXU 5LKTA 1WILA 2HYED 4CCGX 2E6RA 3U5NA 3FANA 2FUUA 2C2LA 3FAOA 5C13A 5TDRA 2ECNA 4YATA 4I7DA 4GNEA 2M6MA 4UP5A 1MBMA 5SVXA 2F6NA 2KFTA 2CKLA 1T1HA 4YBSA 5D1KB 3O70A 2XOCA 1Z2QA 4LK9A 2XEUA 2MA5A 4IC3A 4OGCA 2KGIA 4UP0A 5I3LA 1Z6UA 2MD8C 5B77A 3KQIA 2ECVA 4GNGA 3M99A 5FEYA 4MVTA 2YREA 4V3LC 2ECTA 1LDJB 3HTKC 2LQ6A 1FBVA 5SVYA 1IYMA 4A4BA 2CKLB 2L75A 5G04B 1WENA 3FEHA 3LVRE 4XI1A 4YADA 2FUIA 5D1MB 1Z60A 4MSXA 1WEMA 1WESA 3U5MA 5LKUA 5FB0A 4AYCB 4BHWA 2YSJA 2JM3A 2C2VS 2EA6A 2VP7A 5LKZA 1BORA 4WZ2A 5LCWB 2D8UA 3QZVA 3O37A 5G0FA 2KKYA 2MUMA 2DSMA 1HYIA 4QF3A 2UZGA 3N9MA 4B7YC 3M62A 2JMDA 2FSAA 1WEEA 5B76A 2G6QA 4S3OC 4N4FA 2ZETC 4I7BA 4F1PA 3LDYA 3M63A 2LV9A 2IDAA 4LLBA 2PNXA 2YURA 4GNDA 3C5KA 2M3HA 4AUQB 3V43A 3FM8C 4PPEA 5FB1A 3VK6A 3U5PA 1WEVA 2L5UA 5DKAA 2K17A 2MT5A 2CSZA 3GV4A 3ZYQA 4CA1A 4P5OB 2CRRA 3N9NA 3HCUA 2ECGA 3N9PA 4YBMA 5C11A 4QQ4A 2VPGA 2VPEA 3T6RA 3ZPVE 5B75A 5D1LB 3EB5A 5J3XA 5K3QA 4YC9A 4PTBA 2M13A 1MM2A 3RPGB 3H7HA 1WEQA 2XB1A 5KH3A 1G25A 2YU4A 1WEOA 4AVXA 3ZPV1 1WE9A 2KGGA 4O62A 1RMDA 2E6SA 2P57A 2XP0A 4GNFA 1WIMA 4AYCA 3LRQA 1DVPA 4YABA 4QF2A 2EODA 3O34A 3LVQE 4WZ0A 2EXUA 2L80A 1WEWA 2RSDA 2Y43A 5B79A 1CHCA 2Y1NA 2BAYA 2F6JA 2DJAA 4GB0A 2IQJA 2YQLA 3DQVR 4FIPA 5TRBA 5TABA 2QJ0A 2VPBA 2EGMA 2LDRA 1WEUA 2PUYA 3FL2A 2KE1A 5KH7A 3M7KA 2I50A 1ZBDB 2JUNA 5AITA 1VFYA 2FFWA 2MNYA 3L1ZB 2YYRA 3O33A 2M1RA 2YQMA 5FERA 1WEPA 4L58A 3KV5A 2KU3A 3ZTGA 3SOWA 4NN2A 2LXHC 1JOCA 1WGMA 2ECWA 2JMJA 2KIZA 2YT5A 4Z0RA 2YW8A 2XOYA 2L7PA 5G05B 5H1VA 2EGPA 2G45A 2K16A 3SOUA 4ZQLA 5B78A 3L11A 4V3KC 2K4DA 3L1XA 5H1TA 1U6GB 5JG6A 2CT2A 2QIZA 2LAUA 3LQIA 3GL6A 5H1UA 4L7XA 2YSMA 5KH9A 1LDKC 5LKXA 2E61A 2H0DB 3I2DA 3SOXA 3C6WA 3T7LA 3N9LA 1X4IA 2ECIA 2KKXA 4OGEA 2G43A 4R8PK 2MNZA 3LJUX 3PURA 4Q6FA 3IHPA 4B86C 2K1JA 2YHNA 1HYJA 3E2DA 4FK5A 2VNFA 3O47A 4FJCA 2FD4A 5H9MA 2MD7B 5SVIA 2F42A 3KDEC 3EB6A 3U5OA 3ZVYA 5TBNA 2M85A 1JM7A 2DX8A 2AN6A 2CSVA 4Z0OA 3ZVZB 4BBQA 3DDTA 3KV6A
chains in the Genus database with same CATH topology
5TDWA 2LXPC 2Y1MA 4YBTA 5AIUA 3RTRB 3LQHA 3O36A 2VJFA 3NG2A 3HCTA 4R7EA 3N9OA 1JM7B 1VD4A 2KYUA 2D8SA 4S3OB 1FP0A 2KWKA 3DPLR 4N3WA 2LGLA 1N87A 2KWJA 3LQJA 2L0BA 2LGKA 1WFKA 2LGVA 4LKAA 1V87A 4I7CA 2LGGA 2ECJA 2VJFB 3RPGC 2VJEA 2KR4A 4O64A 4A49A 3MHHA 2JRJA 2MIQA 2H0DA 2HDPA 3N9QA 4YAXA 2L43A 4WZ3B 2KWNA 3ZNIA 1K2FA 2KWOA 2YUCA 4ZDTA 4R2YA 3MHSA 3O7AA 5EYAF 2YHOA 4X3GA 2OXQC 2QICA 2LRIC 3HCSA 2KREA 4TKPB 4A0CD 1X4JA 3KNVA 3PHDA 4AP4A 4F52B 4WA6A 2LN0A 2VJEB 1F62A 3ASLA 4W4UA 4LJNA 4C9ZA 1E4UA 4IC2A 4LADB 2JMIA 3PUQA 4A4CA 1X4UA 1VYXA 2CSYA 2RI7A 4UI9B 2VPDA 5B8DA 2MA6A 4FO9A 3O35A 1XWHA 1MM3A 3SHBA 2NAAA 5DINA 4ZUXU 5LKTA 1WILA 2HYED 4CCGX 2E6RA 3U5NA 2FUUA 2C2LA 5C13A 5TDRA 2ECNA 4YATA 4I7DA 4GNEA 2M6MA 4UP5A 2F6NA 2KFTA 2CKLA 1T1HA 4YBSA 5D1KB 3O70A 1Z2QA 4LK9A 2XEUA 2MA5A 4IC3A 2KGIA 4UP0A 5I3LA 1Z6UA 2MD8C 5B77A 3KQIA 2ECVA 4GNGA 3M99A 5FEYA 4MVTA 2YREA 4V3LC 2ECTA 1LDJB 3HTKC 2LQ6A 1FBVA 1IYMA 4A4BA 2CKLB 2L75A 5G04B 1WENA 4XI1A 4YADA 2FUIA 5D1MB 1Z60A 4MSXA 1WEMA 1WESA 3U5MA 5LKUA 5FB0A 4AYCB 4BHWA 2YSJA 2C2VS 2EA6A 2VP7A 5LKZA 1BORA 4WZ2A 5LCWB 3QZVA 3O37A 5G0FA 2MUMA 1HYIA 4QF3A 2UZGA 3N9MA 4B7YC 3M62A 2JMDA 2FSAA 1WEEA 5B76A 2G6QA 4S3OC 4N4FA 2ZETC 4I7BA 3M63A 2LV9A 2IDAA 4LLBA 2PNXA 2YURA 4GNDA 3C5KA 2M3HA 4AUQB 3V43A 5FB1A 4PPEA 3VK6A 3U5PA 1WEVA 2L5UA 5DKAA 2K17A 2MT5A 2CSZA 3GV4A 3ZYQA 4CA1A 4P5OB 3N9NA 3HCUA 2ECGA 3N9PA 4YBMA 5C11A 2VPGA 2VPEA 3T6RA 3ZPVE 5B75A 5D1LB 3EB5A 5J3XA 4YC9A 4PTBA 1MM2A 3RPGB 1WEQA 2XB1A 5KH3A 1G25A 2YU4A 1WEOA 4AVXA 3ZPV1 1WE9A 2KGGA 1RMDA 2E6SA 4GNFA 1WIMA 4AYCA 3LRQA 1DVPA 4YABA 4QF2A 2EODA 3O34A 4WZ0A 2L80A 1WEWA 2RSDA 2Y43A 5B79A 1CHCA 2Y1NA 2BAYA 2F6JA 4GB0A 2YQLA 3DQVR 4FIPA 5TRBA 5TABA 2QJ0A 2VPBA 2LDRA 1WEUA 2PUYA 3FL2A 2KE1A 5KH7A 2I50A 1ZBDB 5AITA 1VFYA 2MNYA 3L1ZB 2YYRA 3O33A 2M1RA 2YQMA 5FERA 1WEPA 4L58A 3KV5A 2KU3A 3ZTGA 3SOWA 4NN2A 2LXHC 1JOCA 1WGMA 2ECWA 2JMJA 2KIZA 2YT5A 2YW8A 5G05B 5H1VA 2EGPA 2G45A 2K16A 3SOUA 4ZQLA 5B78A 3L11A 4V3KC 2K4DA 3L1XA 5H1TA 1U6GB 5JG6A 2CT2A 2QIZA 3LQIA 3GL6A 5H1UA 4L7XA 5KH9A 2YSMA 1LDKC 5LKXA 2H0DB 3I2DA 3SOXA 3C6WA 3T7LA 3N9LA 1X4IA 2ECIA 2G43A 4R8PK 2MNZA 3PURA 4Q6FA 3IHPA 4B86C 2K1JA 2YHNA 1HYJA 4FK5A 2VNFA 4FJCA 5H9MA 2MD7B 2F42A 3EB6A 3U5OA 3ZVYA 5TBNA 2M85A 1JM7A 2DX8A 2AN6A 3ZVZB 4BBQA 3KV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TDW A;  2LXP C;  2Y1M A;  4YBT A;  5AIU A;  3RTR B;  3LQH A;  3O36 A;  2VJF A;  3NG2 A;  3HCT A;  4R7E A;  3N9O A;  1JM7 B;  1VD4 A;  2KYU A;  2D8S A;  4S3O B;  1FP0 A;  2KWK A;  3DPL R;  4N3W A;  2LGL A;  1N87 A;  2KWJ A;  3LQJ A;  2L0B A;  2LGK A;  1WFK A;  2LGV A;  4LKA A;  1V87 A;  4I7C A;  2LGG A;  2ECJ A;  2VJF B;  3RPG C;  2VJE A;  2KR4 A;  4O64 A;  4A49 A;  3MHH A;  2JRJ A;  2MIQ A;  2H0D A;  2HDP A;  3N9Q A;  4YAX A;  2L43 A;  4WZ3 B;  2KWN A;  3ZNI A;  1K2F A;  2KWO A;  2YUC A;  4ZDT A;  4R2Y A;  3MHS A;  3O7A A;  5EYA F;  2YHO A;  4X3G A;  2OXQ C;  2QIC A;  2LRI C;  3HCS A;  2KRE A;  4TKP B;  4A0C D;  1X4J A;  3KNV A;  3PHD A;  4AP4 A;  4F52 B;  4WA6 A;  2LN0 A;  2VJE B;  1F62 A;  3ASL A;  4W4U A;  4LJN A;  4C9Z A;  1E4U A;  4IC2 A;  4LAD B;  2JMI A;  3PUQ A;  4A4C A;  1X4U A;  1VYX A;  2CSY A;  2RI7 A;  4UI9 B;  2VPD A;  5B8D A;  2MA6 A;  4FO9 A;  3O35 A;  1XWH A;  1MM3 A;  3SHB A;  2NAA A;  5DIN A;  4ZUX U;  5LKT A;  1WIL A;  2HYE D;  4CCG X;  2E6R A;  3U5N A;  2FUU A;  2C2L A;  5C13 A;  5TDR A;  2ECN A;  4YAT A;  4I7D A;  4GNE A;  2M6M A;  4UP5 A;  2F6N A;  2KFT A;  2CKL A;  1T1H A;  4YBS A;  5D1K B;  3O70 A;  1Z2Q A;  4LK9 A;  2XEU A;  2MA5 A;  4IC3 A;  2KGI A;  4UP0 A;  5I3L A;  1Z6U A;  2MD8 C;  5B77 A;  3KQI A;  2ECV A;  4GNG A;  3M99 A;  5FEY A;  4MVT A;  2YRE A;  4V3L C;  2ECT A;  1LDJ B;  3HTK C;  2LQ6 A;  1FBV A;  1IYM A;  4A4B A;  2CKL B;  2L75 A;  5G04 B;  1WEN A;  4XI1 A;  4YAD A;  2FUI A;  5D1M B;  1Z60 A;  4MSX A;  1WEM A;  1WES A;  3U5M A;  5LKU A;  5FB0 A;  4AYC B;  4BHW A;  2YSJ A;  2C2V S;  2EA6 A;  2VP7 A;  5LKZ A;  1BOR A;  4WZ2 A;  5LCW B;  3QZV A;  3O37 A;  5G0F A;  2MUM A;  1HYI A;  4QF3 A;  2UZG A;  3N9M A;  4B7Y C;  3M62 A;  2JMD A;  2FSA A;  1WEE A;  5B76 A;  2G6Q A;  4S3O C;  4N4F A;  2ZET C;  4I7B A;  3M63 A;  2LV9 A;  2IDA A;  4LLB A;  2PNX A;  2YUR A;  4GND A;  3C5K A;  2M3H A;  4AUQ B;  3V43 A;  5FB1 A;  4PPE A;  3VK6 A;  3U5P A;  1WEV A;  2L5U A;  5DKA A;  2K17 A;  2MT5 A;  2CSZ A;  3GV4 A;  3ZYQ A;  4CA1 A;  4P5O B;  3N9N A;  3HCU A;  2ECG A;  3N9P A;  4YBM A;  5C11 A;  2VPG A;  2VPE A;  3T6R A;  3ZPV E;  5B75 A;  5D1L B;  3EB5 A;  5J3X A;  4YC9 A;  4PTB A;  1MM2 A;  3RPG B;  1WEQ A;  2XB1 A;  5KH3 A;  1G25 A;  2YU4 A;  1WEO A;  4AVX A;  3ZPV 1;  1WE9 A;  2KGG A;  1RMD A;  2E6S A;  4GNF A;  1WIM A;  4AYC A;  3LRQ A;  1DVP A;  4YAB A;  4QF2 A;  2EOD A;  3O34 A;  4WZ0 A;  2L80 A;  1WEW A;  2RSD A;  2Y43 A;  5B79 A;  1CHC A;  2Y1N A;  2BAY A;  2F6J A;  4GB0 A;  2YQL A;  3DQV R;  4FIP A;  5TRB A;  5TAB A;  2QJ0 A;  2VPB A;  2LDR A;  1WEU A;  2PUY A;  3FL2 A;  2KE1 A;  5KH7 A;  2I50 A;  1ZBD B;  5AIT A;  1VFY A;  2MNY A;  3L1Z B;  2YYR A;  3O33 A;  2M1R A;  2YQM A;  5FER A;  1WEP A;  4L58 A;  3KV5 A;  2KU3 A;  3ZTG A;  3SOW A;  4NN2 A;  2LXH C;  1JOC A;  1WGM A;  2ECW A;  2JMJ A;  2KIZ A;  2YT5 A;  2YW8 A;  5G05 B;  5H1V A;  2EGP A;  2G45 A;  2K16 A;  3SOU A;  4ZQL A;  5B78 A;  3L11 A;  4V3K C;  2K4D A;  3L1X A;  5H1T A;  1U6G B;  5JG6 A;  2CT2 A;  2QIZ A;  3LQI A;  3GL6 A;  5H1U A;  4L7X A;  5KH9 A;  2YSM A;  1LDK C;  5LKX A;  2H0D B;  3I2D A;  3SOX A;  3C6W A;  3T7L A;  3N9L A;  1X4I A;  2ECI A;  2G43 A;  4R8P K;  2MNZ A;  3PUR A;  4Q6F A;  3IHP A;  4B86 C;  2K1J A;  2YHN A;  1HYJ A;  4FK5 A;  2VNF A;  4FJC A;  5H9M A;  2MD7 B;  2F42 A;  3EB6 A;  3U5O A;  3ZVY A;  5TBN A;  2M85 A;  1JM7 A;  2DX8 A;  2AN6 A;  3ZVZ B;  4BBQ A;  3KV6 A; 
#chains in the Genus database with same CATH topology
 2B0O E;  5TDW A;  2LXP C;  3PLW A;  2Y1M A;  4YBT A;  5AIU A;  3RTR B;  3LQH A;  3O36 A;  5SVI B;  2VJF A;  3NG2 A;  3HCT A;  4R7E A;  3N9O A;  1JM7 B;  2CON A;  2OWA A;  1VD4 A;  3DWD A;  2KYU A;  2D8S A;  4S3O B;  1FP0 A;  2KWK A;  4H9D A;  3DPL R;  1DCQ A;  4N3W A;  2LGL A;  1N87 A;  2KWJ A;  3LQJ A;  2L0B A;  2LGK A;  1WFK A;  2LGV A;  4LKA A;  1V87 A;  4I7C A;  2MKE A;  2LGG A;  2RR4 A;  2ECJ A;  3MDB C;  2VJF B;  3RPG C;  3T9K A;  2VJE A;  2KR4 A;  4O64 A;  4A49 A;  3MHH A;  2JRJ A;  2MIQ A;  2YVR A;  2H0D A;  2HDP A;  3N9Q A;  4YAX A;  3SUB A;  2L43 A;  4WZ3 B;  2KWN A;  3ZNI A;  1K2F A;  2KWO A;  3FJU B;  2YUC A;  4ZDT A;  4R2Y A;  3MHS A;  3O7A A;  5EYA F;  2YHO A;  4X3G A;  2OXQ C;  2QIC A;  2LRI C;  3HCS A;  2KRE A;  4TKP B;  4A0C D;  1X4J A;  3KNV A;  3PHD A;  4AP4 A;  4F52 B;  4WA6 A;  2LN0 A;  3JUE A;  2VJE B;  1F62 A;  3ASL A;  4W4U A;  4LJN A;  3Q1D A;  2XOZ A;  4C9Z A;  1E4U A;  4IC2 A;  4LAD B;  2JMI A;  3PUQ A;  4A4C A;  1X4U A;  1VYX A;  2CSY A;  2RI7 A;  4UI9 B;  2VPD A;  5B8D A;  2MA6 A;  4FO9 A;  3O35 A;  1XWH A;  2CRW A;  1MM3 A;  3SHB A;  2NAA A;  5DIN A;  4ZUX U;  5LKT A;  1WIL A;  2HYE D;  4CCG X;  2E6R A;  3U5N A;  3FAN A;  2FUU A;  2C2L A;  3FAO A;  5C13 A;  5TDR A;  2ECN A;  4YAT A;  4I7D A;  4GNE A;  2M6M A;  4UP5 A;  1MBM A;  5SVX A;  2F6N A;  2KFT A;  2CKL A;  1T1H A;  4YBS A;  5D1K B;  3O70 A;  2XOC A;  1Z2Q A;  4LK9 A;  2XEU A;  2MA5 A;  4IC3 A;  4OGC A;  2KGI A;  4UP0 A;  5I3L A;  1Z6U A;  2MD8 C;  5B77 A;  3KQI A;  2ECV A;  4GNG A;  3M99 A;  5FEY A;  4MVT A;  2YRE A;  4V3L C;  2ECT A;  1LDJ B;  3HTK C;  2LQ6 A;  1FBV A;  5SVY A;  1IYM A;  4A4B A;  2CKL B;  2L75 A;  5G04 B;  1WEN A;  3FEH A;  3LVR E;  4XI1 A;  4YAD A;  2FUI A;  5D1M B;  1Z60 A;  4MSX A;  1WEM A;  1WES A;  3U5M A;  5LKU A;  5FB0 A;  4AYC B;  4BHW A;  2YSJ A;  2JM3 A;  2C2V S;  2EA6 A;  2VP7 A;  5LKZ A;  1BOR A;  4WZ2 A;  5LCW B;  2D8U A;  3QZV A;  3O37 A;  5G0F A;  2KKY A;  2MUM A;  2DSM A;  1HYI A;  4QF3 A;  2UZG A;  3N9M A;  4B7Y C;  3M62 A;  2JMD A;  2FSA A;  1WEE A;  5B76 A;  2G6Q A;  4S3O C;  4N4F A;  2ZET C;  4I7B A;  4F1P A;  3LDY A;  3M63 A;  2LV9 A;  2IDA A;  4LLB A;  2PNX A;  2YUR A;  4GND A;  3C5K A;  2M3H A;  4AUQ B;  3V43 A;  3FM8 C;  4PPE A;  5FB1 A;  3VK6 A;  3U5P A;  1WEV A;  2L5U A;  5DKA A;  2K17 A;  2MT5 A;  2CSZ A;  3GV4 A;  3ZYQ A;  4CA1 A;  4P5O B;  2CRR A;  3N9N A;  3HCU A;  2ECG A;  3N9P A;  4YBM A;  5C11 A;  4QQ4 A;  2VPG A;  2VPE A;  3T6R A;  3ZPV E;  5B75 A;  5D1L B;  3EB5 A;  5J3X A;  5K3Q A;  4YC9 A;  4PTB A;  2M13 A;  1MM2 A;  3RPG B;  3H7H A;  1WEQ A;  2XB1 A;  5KH3 A;  1G25 A;  2YU4 A;  1WEO A;  4AVX A;  3ZPV 1;  1WE9 A;  2KGG A;  4O62 A;  1RMD A;  2E6S A;  2P57 A;  2XP0 A;  4GNF A;  1WIM A;  4AYC A;  3LRQ A;  1DVP A;  4YAB A;  4QF2 A;  2EOD A;  3O34 A;  3LVQ E;  4WZ0 A;  2EXU A;  2L80 A;  1WEW A;  2RSD A;  2Y43 A;  5B79 A;  1CHC A;  2Y1N A;  2BAY A;  2F6J A;  2DJA A;  4GB0 A;  2IQJ A;  2YQL A;  3DQV R;  4FIP A;  5TRB A;  5TAB A;  2QJ0 A;  2VPB A;  2EGM A;  2LDR A;  1WEU A;  2PUY A;  3FL2 A;  2KE1 A;  5KH7 A;  3M7K A;  2I50 A;  1ZBD B;  2JUN A;  5AIT A;  1VFY A;  2FFW A;  2MNY A;  3L1Z B;  2YYR A;  3O33 A;  2M1R A;  2YQM A;  5FER A;  1WEP A;  4L58 A;  3KV5 A;  2KU3 A;  3ZTG A;  3SOW A;  4NN2 A;  2LXH C;  1JOC A;  1WGM A;  2ECW A;  2JMJ A;  2KIZ A;  2YT5 A;  4Z0R A;  2YW8 A;  2XOY A;  2L7P A;  5G05 B;  5H1V A;  2EGP A;  2G45 A;  2K16 A;  3SOU A;  4ZQL A;  5B78 A;  3L11 A;  4V3K C;  2K4D A;  3L1X A;  5H1T A;  1U6G B;  5JG6 A;  2CT2 A;  2QIZ A;  2LAU A;  3LQI A;  3GL6 A;  5H1U A;  4L7X A;  2YSM A;  5KH9 A;  1LDK C;  5LKX A;  2E61 A;  2H0D B;  3I2D A;  3SOX A;  3C6W A;  3T7L A;  3N9L A;  1X4I A;  2ECI A;  2KKX A;  4OGE A;  2G43 A;  4R8P K;  2MNZ A;  3LJU X;  3PUR A;  4Q6F A;  3IHP A;  4B86 C;  2K1J A;  2YHN A;  1HYJ A;  3E2D A;  4FK5 A;  2VNF A;  3O47 A;  4FJC A;  2FD4 A;  5H9M A;  2MD7 B;  5SVI A;  2F42 A;  3KDE C;  3EB6 A;  3U5O A;  3ZVY A;  5TBN A;  2M85 A;  1JM7 A;  2DX8 A;  2AN6 A;  2CSV A;  4Z0O A;  3ZVZ B;  4BBQ A;  3DDT A;  3KV6 A; 
#chains in the Genus database with same CATH homology
 5TDW A;  2LXP C;  2Y1M A;  4YBT A;  5AIU A;  3RTR B;  3LQH A;  3O36 A;  2VJF A;  3NG2 A;  3HCT A;  4R7E A;  3N9O A;  1JM7 B;  1VD4 A;  2KYU A;  2D8S A;  4S3O B;  1FP0 A;  2KWK A;  3DPL R;  4N3W A;  2LGL A;  1N87 A;  2KWJ A;  3LQJ A;  2L0B A;  2LGK A;  1WFK A;  2LGV A;  4LKA A;  1V87 A;  4I7C A;  2LGG A;  2ECJ A;  2VJF B;  3RPG C;  2VJE A;  2KR4 A;  4O64 A;  4A49 A;  3MHH A;  2JRJ A;  2MIQ A;  2H0D A;  2HDP A;  3N9Q A;  4YAX A;  2L43 A;  4WZ3 B;  2KWN A;  3ZNI A;  1K2F A;  2KWO A;  2YUC A;  4ZDT A;  4R2Y A;  3MHS A;  3O7A A;  5EYA F;  2YHO A;  4X3G A;  2OXQ C;  2QIC A;  2LRI C;  3HCS A;  2KRE A;  4TKP B;  4A0C D;  1X4J A;  3KNV A;  3PHD A;  4AP4 A;  4F52 B;  4WA6 A;  2LN0 A;  2VJE B;  1F62 A;  3ASL A;  4W4U A;  4LJN A;  4C9Z A;  1E4U A;  4IC2 A;  4LAD B;  2JMI A;  3PUQ A;  4A4C A;  1X4U A;  1VYX A;  2CSY A;  2RI7 A;  4UI9 B;  2VPD A;  5B8D A;  2MA6 A;  4FO9 A;  3O35 A;  1XWH A;  1MM3 A;  3SHB A;  2NAA A;  5DIN A;  4ZUX U;  5LKT A;  1WIL A;  2HYE D;  4CCG X;  2E6R A;  3U5N A;  2FUU A;  2C2L A;  5C13 A;  5TDR A;  2ECN A;  4YAT A;  4I7D A;  4GNE A;  2M6M A;  4UP5 A;  2F6N A;  2KFT A;  2CKL A;  1T1H A;  4YBS A;  5D1K B;  3O70 A;  1Z2Q A;  4LK9 A;  2XEU A;  2MA5 A;  4IC3 A;  2KGI A;  4UP0 A;  5I3L A;  1Z6U A;  2MD8 C;  5B77 A;  3KQI A;  2ECV A;  4GNG A;  3M99 A;  5FEY A;  4MVT A;  2YRE A;  4V3L C;  2ECT A;  1LDJ B;  3HTK C;  2LQ6 A;  1FBV A;  1IYM A;  4A4B A;  2CKL B;  2L75 A;  5G04 B;  1WEN A;  4XI1 A;  4YAD A;  2FUI A;  5D1M B;  1Z60 A;  4MSX A;  1WEM A;  1WES A;  3U5M A;  5LKU A;  5FB0 A;  4AYC B;  4BHW A;  2YSJ A;  2C2V S;  2EA6 A;  2VP7 A;  5LKZ A;  1BOR A;  4WZ2 A;  5LCW B;  3QZV A;  3O37 A;  5G0F A;  2MUM A;  1HYI A;  4QF3 A;  2UZG A;  3N9M A;  4B7Y C;  3M62 A;  2JMD A;  2FSA A;  1WEE A;  5B76 A;  2G6Q A;  4S3O C;  4N4F A;  2ZET C;  4I7B A;  3M63 A;  2LV9 A;  2IDA A;  4LLB A;  2PNX A;  2YUR A;  4GND A;  3C5K A;  2M3H A;  4AUQ B;  3V43 A;  5FB1 A;  4PPE A;  3VK6 A;  3U5P A;  1WEV A;  2L5U A;  5DKA A;  2K17 A;  2MT5 A;  2CSZ A;  3GV4 A;  3ZYQ A;  4CA1 A;  4P5O B;  3N9N A;  3HCU A;  2ECG A;  3N9P A;  4YBM A;  5C11 A;  2VPG A;  2VPE A;  3T6R A;  3ZPV E;  5B75 A;  5D1L B;  3EB5 A;  5J3X A;  4YC9 A;  4PTB A;  1MM2 A;  3RPG B;  1WEQ A;  2XB1 A;  5KH3 A;  1G25 A;  2YU4 A;  1WEO A;  4AVX A;  3ZPV 1;  1WE9 A;  2KGG A;  1RMD A;  2E6S A;  4GNF A;  1WIM A;  4AYC A;  3LRQ A;  1DVP A;  4YAB A;  4QF2 A;  2EOD A;  3O34 A;  4WZ0 A;  2L80 A;  1WEW A;  2RSD A;  2Y43 A;  5B79 A;  1CHC A;  2Y1N A;  2BAY A;  2F6J A;  4GB0 A;  2YQL A;  3DQV R;  4FIP A;  5TRB A;  5TAB A;  2QJ0 A;  2VPB A;  2LDR A;  1WEU A;  2PUY A;  3FL2 A;  2KE1 A;  5KH7 A;  2I50 A;  1ZBD B;  5AIT A;  1VFY A;  2MNY A;  3L1Z B;  2YYR A;  3O33 A;  2M1R A;  2YQM A;  5FER A;  1WEP A;  4L58 A;  3KV5 A;  2KU3 A;  3ZTG A;  3SOW A;  4NN2 A;  2LXH C;  1JOC A;  1WGM A;  2ECW A;  2JMJ A;  2KIZ A;  2YT5 A;  2YW8 A;  5G05 B;  5H1V A;  2EGP A;  2G45 A;  2K16 A;  3SOU A;  4ZQL A;  5B78 A;  3L11 A;  4V3K C;  2K4D A;  3L1X A;  5H1T A;  1U6G B;  5JG6 A;  2CT2 A;  2QIZ A;  3LQI A;  3GL6 A;  5H1U A;  4L7X A;  5KH9 A;  2YSM A;  1LDK C;  5LKX A;  2H0D B;  3I2D A;  3SOX A;  3C6W A;  3T7L A;  3N9L A;  1X4I A;  2ECI A;  2G43 A;  4R8P K;  2MNZ A;  3PUR A;  4Q6F A;  3IHP A;  4B86 C;  2K1J A;  2YHN A;  1HYJ A;  4FK5 A;  2VNF A;  4FJC A;  5H9M A;  2MD7 B;  2F42 A;  3EB6 A;  3U5O A;  3ZVY A;  5TBN A;  2M85 A;  1JM7 A;  2DX8 A;  2AN6 A;  3ZVZ B;  4BBQ A;  3KV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...