2LQ6A

Solution structure of brd1 phd2 finger
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
79
Chain Sequence
MNIPPARWKLTCYLCKQKGVGASIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 1
publication title Solution structure of an atypical PHD finger in BRPF2 and its interaction with DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 11
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2012-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lq6A00
4BBQA 1FBVA 2QICA 1U6GB 2F6JA 2Y1NA 2VPDA 2VNFA 3ASLA 5D1MB 5TBNA 2LDRA 2AN6A 3HCUA 5AIUA 5I3LA 2KYUA 5LKTA 2G6QA 4FK5A 3ZVYA 4S3OB 2FSAA 5TRBA 3GV4A 3HCTA 4CA1A 2YT5A 3M62A 2M3HA 2I50A 5B79A 5G0FA 1CHCA 2CT2A 5B76A 4AYCB 5J3XA 2ECTA 4B86C 2UZGA 3M99A 3ZPV1 4N4FA 2HDPA 2K4DA 2EODA 2MA6A 2ECVA 1WILA 5AITA 5C11A 2ECWA 2D8SA 2H0DB 1DVPA 2ZETC 2G43A 1VYXA 3N9MA 3NG2A 2YHNA 4XI1A 1MM2A 3N9PA 4IC2A 2EA6A 2ECGA 3HTKC 1WEPA 2LRIC 3VK6A 2XB1A 2VPEA 3ZYQA 1JOCA 3HCSA 3KV5A 1JM7A 2MA5A 2KGGA 2MNZA 1X4JA 2G45A 3C5KA 4YC9A 2Y1MA 2KFTA 2M6MA 3O7AA 1XWHA 3PHDA 5LKXA 3RTRB 2LV9A 2K17A 5B8DA 4YBTA 3L1ZB 2YQMA 5H1UA 2KWJA 5D1KB 4YAXA 4A49A 1T1HA 2IDAA 4F52B 4A4BA 2YSJA 2PUYA 3O37A 2K16A 3ZNIA 2DX8A 2M85A 4YBMA 1WEOA 2KE1A 2Y43A 5FB1A 2KWNA 1Z60A 3T6RA 5B78A 5KH7A 3PUQA 2L43A 3U5PA 2LGLA 1JM7B 3EB5A 3O35A 4V3LC 1WEQA 4YABA 1WEWA 3MHHA 3M63A 2MD7B 3LRQA 2F42A 4PPEA 4B7YC 5G04B 4L7XA 2LGKA 2C2VS 2ECNA 1FP0A 2KR4A 4LADB 1IYMA 2E6RA 5H9MA 2VJEA 3ZPVE 2H0DA 4AP4A 4A0CD 3I2DA 1WFKA 1VFYA 2LQ6A 2RI7A 4CCGX 2NAAA 5LKUA 3N9LA 4N3WA 4YADA 1HYJA 3EB6A 1F62A 3SOUA 2MNYA 5TDWA 1WEUA 3SOWA 3DQVR 4UP5A 1G25A 4LKAA 4QF2A 3GL6A 3L1XA 3ZTGA 4R2YA 2VPGA 2FUIA 2VJEB 1WEEA 4WZ0A 1WGMA 5TABA 2L0BA 5B77A 2VJFA 2K1JA 5LKZA 4WA6A 5EYAF 2MD8C 4A4CA 3SHBA 4WZ2A 1WENA 3QZVA 4FJCA 5LCWB 2LXPC 4FO9A 4I7BA 3T7LA 5D1LB 2F6NA 4FIPA 4WZ3B 2BAYA 2CSYA 2VJFB 4P5OB 4YBSA 2YW8A 2YQLA 3RPGC 3N9QA 4MVTA 4X3GA 4NN2A 2YREA 2ECJA 2M1RA 2LXHC 4QF3A 3SOXA 1X4IA 2L5UA 3KQIA 1Z6UA 5KH9A 3U5MA 4AUQB 4O64A 4UI9B 2JMIA 4L58A 3KNVA 2EGPA 4UP0A 3KV6A 3O34A 1ZBDB 4LK9A 4IC3A 2MIQA 2RSDA 4YATA 1X4UA 3LQIA 5KH3A 2MUMA 3IHPA 1WE9A 1LDJB 2FUUA 4MSXA 3C6WA 5FB0A 2YSMA 4ZDTA 2YU4A 2QJ0A 5TDRA 3PURA 1WEVA 5DINA 4V3KC 1LDKC 3RPGB 2QIZA 2KU3A 1BORA 5G05B 4R8PK 4I7DA 1WEMA 4GNGA 2XEUA 1N87A 3L11A 4ZUXU 2JMJA 4GNFA 1MM3A 3MHSA 4GNEA 2VPBA 5FEYA 3N9OA 2PNXA 3LQJA 3U5OA 1WESA 4LJNA 2KWOA 2LGGA 4GB0A 2MT5A 4ZQLA 3N9NA 2JRJA 2JMDA 3DPLR 2CKLA 3U5NA 2YYRA 2LGVA 3FL2A 5C13A 5H1TA 1K2FA 2YURA 1VD4A 4PTBA 4AVXA 4LLBA 2KREA 5B75A 2ECIA 2HYED 2KGIA 3V43A 5H1VA 2YUCA 4C9ZA 4I7CA 4GNDA 1WIMA 4BHWA 3O33A 4S3OC 2VP7A 2CKLB 2L80A 2E6SA 2LN0A 4W4UA 5FERA 2C2LA 2OXQC 4Q6FA 3O70A 4R7EA 2KWKA 5JG6A 2KIZA 1RMDA 1E4UA 1Z2QA 3O36A 1V87A 1HYIA 3ZVZB 2CSZA 2YHOA 2L75A 4TKPB 3LQHA 5DKAA 4AYCA
chains in the Genus database with same CATH superfamily
2DJAA 4BBQA 3FM8C 1FBVA 2QICA 1U6GB 2F6JA 2Y1NA 2VPDA 2VNFA 3ASLA 5D1MB 2CRWA 5TBNA 2LDRA 4F1PA 2XOYA 2AN6A 3HCUA 5AIUA 5I3LA 3PLWA 2B0OE 2KYUA 2G6QA 4FK5A 5LKTA 4OGCA 3ZVYA 4S3OB 2FSAA 5TRBA 3GV4A 3HCTA 4CA1A 2YT5A 3M62A 2M3HA 2FD4A 4O62A 2I50A 5B79A 5G0FA 1CHCA 2CT2A 5B76A 2CRRA 2L7PA 4AYCB 3T9KA 5J3XA 2ECTA 4B86C 2UZGA 3O47A 5SVIA 3FAOA 3M99A 3ZPV1 5K3QA 4N4FA 2HDPA 2K4DA 2EODA 2MA6A 2ECVA 2LAUA 1WILA 5AITA 5C11A 2ECWA 2D8SA 2H0DB 1DVPA 2ZETC 2G43A 1VYXA 3N9MA 3NG2A 5SVXA 2YHNA 4XI1A 1MM2A 3N9PA 4IC2A 2EA6A 2ECGA 3HTKC 1WEPA 2LRIC 3VK6A 2XB1A 2VPEA 3ZYQA 1JOCA 3HCSA 3KV5A 1JM7A 2MA5A 2KGGA 2MNZA 2XP0A 1X4JA 2G45A 3C5KA 4YC9A 4Z0OA 2Y1MA 2KFTA 2M6MA 3O7AA 1XWHA 3PHDA 5LKXA 3RTRB 2LV9A 2K17A 5B8DA 4YBTA 3L1ZB 2YVRA 2YQMA 5H1UA 2KWJA 3FEHA 2E61A 4YAXA 5D1KB 4A49A 1T1HA 2IDAA 4F52B 4A4BA 2YSJA 2PUYA 3O37A 2K16A 3ZNIA 2DX8A 2M85A 4YBMA 1WEOA 2KE1A 3LJUX 2Y43A 5FB1A 2KWNA 1Z60A 3T6RA 5B78A 2JUNA 5KH7A 3PUQA 2L43A 3U5PA 2LGLA 1JM7B 3EB5A 3O35A 4V3LC 1WEQA 4YABA 1WEWA 3MHHA 2P57A 3M63A 2MD7B 3LRQA 3FANA 3DDTA 2F42A 4PPEA 4B7YC 5G04B 4L7XA 2LGKA 2CSVA 2OWAA 2C2VS 2ECNA 1FP0A 2KR4A 4LADB 1IYMA 2E6RA 5H9MA 2VJEA 3ZPVE 2H0DA 4AP4A 4A0CD 3I2DA 1WFKA 1VFYA 2JM3A 2LQ6A 2RI7A 4CCGX 2NAAA 5LKUA 3N9LA 4N3WA 4YADA 1HYJA 3EB6A 1F62A 3SOUA 2MNYA 5TDWA 1WEUA 3SOWA 3JUEA 3DQVR 4UP5A 1G25A 4LKAA 4QF2A 3GL6A 3L1XA 3ZTGA 4R2YA 2VPGA 2FUIA 2VJEB 1WEEA 4WZ0A 1DCQA 1WGMA 5TABA 2L0BA 5B77A 2VJFA 2K1JA 5LKZA 4WA6A 5EYAF 2MD8C 3DWDA 4A4CA 3SHBA 3SUBA 4WZ2A 1WENA 3QZVA 4FJCA 5LCWB 2LXPC 3LVQE 4FO9A 4I7BA 3T7LA 4OGEA 5D1LB 2F6NA 2DSMA 4FIPA 4WZ3B 2CONA 2BAYA 2XOCA 2CSYA 2VJFB 4P5OB 4YBSA 2YW8A 2YQLA 3RPGC 3N9QA 4MVTA 4X3GA 4NN2A 2YREA 2ECJA 4H9DA 2M1RA 2LXHC 3H7HA 4QF3A 3SOXA 1X4IA 2L5UA 2FFWA 2IQJA 3KQIA 1Z6UA 5KH9A 3U5MA 4AUQB 4O64A 4UI9B 1MBMA 2JMIA 4L58A 3KNVA 2EGPA 4UP0A 3KV6A 3O34A 5SVYA 1ZBDB 4LK9A 4IC3A 2MIQA 2RSDA 4YATA 1X4UA 3LQIA 5KH3A 2MUMA 3IHPA 1WE9A 1LDJB 2FUUA 4MSXA 2RR4A 3C6WA 2MKEA 5FB0A 2YSMA 3E2DA 4ZDTA 2YU4A 2QJ0A 3PURA 5TDRA 1WEVA 5DINA 3MDBC 4V3KC 1LDKC 3RPGB 3KDEC 2QIZA 2KKYA 2KU3A 1BORA 5G05B 3LDYA 4R8PK 4I7DA 1WEMA 4GNGA 2XEUA 1N87A 3L11A 4ZUXU 2JMJA 4GNFA 1MM3A 3MHSA 4GNEA 2VPBA 5FEYA 2EXUA 3N9OA 2PNXA 3LQJA 3U5OA 1WESA 3Q1DA 4LJNA 2KWOA 2M13A 3LVRE 2LGGA 4GB0A 2MT5A 4ZQLA 3N9NA 2JRJA 2JMDA 2XOZA 3DPLR 2CKLA 3U5NA 2EGMA 2YYRA 2LGVA 3FL2A 5C13A 5H1TA 1K2FA 2YURA 1VD4A 4PTBA 4AVXA 4LLBA 4Z0RA 2KREA 5B75A 5SVIB 3FJUB 2ECIA 2HYED 4QQ4A 2KGIA 3V43A 2KKXA 5H1VA 2YUCA 4C9ZA 4I7CA 4GNDA 1WIMA 4BHWA 3O33A 4S3OC 2VP7A 2CKLB 2L80A 2E6SA 2LN0A 4W4UA 5FERA 2C2LA 2D8UA 2OXQC 4Q6FA 3O70A 4R7EA 2KWKA 5JG6A 2KIZA 1RMDA 1E4UA 1Z2QA 3O36A 1V87A 1HYIA 3ZVZB 2CSZA 3M7KA 2YHOA 2L75A 4TKPB 3LQHA 5DKAA 4AYCA
chains in the Genus database with same CATH topology
4BBQA 1FBVA 2QICA 1U6GB 2F6JA 2Y1NA 2VPDA 2VNFA 3ASLA 5D1MB 5TBNA 2LDRA 2AN6A 3HCUA 5AIUA 5I3LA 2KYUA 5LKTA 2G6QA 4FK5A 3ZVYA 4S3OB 2FSAA 5TRBA 3GV4A 3HCTA 4CA1A 2YT5A 3M62A 2M3HA 2I50A 5B79A 5G0FA 1CHCA 2CT2A 5B76A 4AYCB 5J3XA 2ECTA 4B86C 2UZGA 3M99A 3ZPV1 4N4FA 2HDPA 2K4DA 2EODA 2MA6A 2ECVA 1WILA 5AITA 5C11A 2ECWA 2D8SA 2H0DB 1DVPA 2ZETC 2G43A 1VYXA 3N9MA 3NG2A 2YHNA 4XI1A 1MM2A 3N9PA 4IC2A 2EA6A 2ECGA 3HTKC 1WEPA 2LRIC 3VK6A 2XB1A 2VPEA 3ZYQA 1JOCA 3HCSA 3KV5A 1JM7A 2MA5A 2KGGA 2MNZA 1X4JA 2G45A 3C5KA 4YC9A 2Y1MA 2KFTA 2M6MA 3O7AA 1XWHA 3PHDA 5LKXA 3RTRB 2LV9A 2K17A 5B8DA 4YBTA 3L1ZB 2YQMA 5H1UA 2KWJA 5D1KB 4YAXA 4A49A 1T1HA 2IDAA 4F52B 4A4BA 2YSJA 2PUYA 3O37A 2K16A 3ZNIA 2DX8A 2M85A 4YBMA 1WEOA 2KE1A 2Y43A 5FB1A 2KWNA 1Z60A 3T6RA 5B78A 5KH7A 3PUQA 2L43A 3U5PA 2LGLA 1JM7B 3EB5A 3O35A 4V3LC 1WEQA 4YABA 1WEWA 3MHHA 3M63A 2MD7B 3LRQA 2F42A 4PPEA 4B7YC 5G04B 4L7XA 2LGKA 2C2VS 2ECNA 1FP0A 2KR4A 4LADB 1IYMA 2E6RA 5H9MA 2VJEA 3ZPVE 2H0DA 4AP4A 4A0CD 3I2DA 1WFKA 1VFYA 2LQ6A 2RI7A 4CCGX 2NAAA 5LKUA 3N9LA 4N3WA 4YADA 1HYJA 3EB6A 1F62A 3SOUA 2MNYA 5TDWA 1WEUA 3SOWA 3DQVR 4UP5A 1G25A 4LKAA 4QF2A 3GL6A 3L1XA 3ZTGA 4R2YA 2VPGA 2FUIA 2VJEB 1WEEA 4WZ0A 1WGMA 5TABA 2L0BA 5B77A 2VJFA 2K1JA 5LKZA 4WA6A 5EYAF 2MD8C 4A4CA 3SHBA 4WZ2A 1WENA 3QZVA 4FJCA 5LCWB 2LXPC 4FO9A 4I7BA 3T7LA 5D1LB 2F6NA 4FIPA 4WZ3B 2BAYA 2CSYA 2VJFB 4P5OB 4YBSA 2YW8A 2YQLA 3RPGC 3N9QA 4MVTA 4X3GA 4NN2A 2YREA 2ECJA 2M1RA 2LXHC 4QF3A 3SOXA 1X4IA 2L5UA 3KQIA 1Z6UA 5KH9A 3U5MA 4AUQB 4O64A 4UI9B 2JMIA 4L58A 3KNVA 2EGPA 4UP0A 3KV6A 3O34A 1ZBDB 4LK9A 4IC3A 2MIQA 2RSDA 4YATA 1X4UA 3LQIA 5KH3A 2MUMA 3IHPA 1WE9A 1LDJB 2FUUA 4MSXA 3C6WA 5FB0A 2YSMA 4ZDTA 2YU4A 2QJ0A 5TDRA 3PURA 1WEVA 5DINA 4V3KC 1LDKC 3RPGB 2QIZA 2KU3A 1BORA 5G05B 4R8PK 4I7DA 1WEMA 4GNGA 2XEUA 1N87A 3L11A 4ZUXU 2JMJA 4GNFA 1MM3A 3MHSA 4GNEA 2VPBA 5FEYA 3N9OA 2PNXA 3LQJA 3U5OA 1WESA 4LJNA 2KWOA 2LGGA 4GB0A 2MT5A 4ZQLA 3N9NA 2JRJA 2JMDA 3DPLR 2CKLA 3U5NA 2YYRA 2LGVA 3FL2A 5C13A 5H1TA 1K2FA 2YURA 1VD4A 4PTBA 4AVXA 4LLBA 2KREA 5B75A 2ECIA 2HYED 2KGIA 3V43A 5H1VA 2YUCA 4C9ZA 4I7CA 4GNDA 1WIMA 4BHWA 3O33A 4S3OC 2VP7A 2CKLB 2L80A 2E6SA 2LN0A 4W4UA 5FERA 2C2LA 2OXQC 4Q6FA 3O70A 4R7EA 2KWKA 5JG6A 2KIZA 1RMDA 1E4UA 1Z2QA 3O36A 1V87A 1HYIA 3ZVZB 2CSZA 2YHOA 2L75A 4TKPB 3LQHA 5DKAA 4AYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBQ A;  1FBV A;  2QIC A;  1U6G B;  2F6J A;  2Y1N A;  2VPD A;  2VNF A;  3ASL A;  5D1M B;  5TBN A;  2LDR A;  2AN6 A;  3HCU A;  5AIU A;  5I3L A;  2KYU A;  5LKT A;  2G6Q A;  4FK5 A;  3ZVY A;  4S3O B;  2FSA A;  5TRB A;  3GV4 A;  3HCT A;  4CA1 A;  2YT5 A;  3M62 A;  2M3H A;  2I50 A;  5B79 A;  5G0F A;  1CHC A;  2CT2 A;  5B76 A;  4AYC B;  5J3X A;  2ECT A;  4B86 C;  2UZG A;  3M99 A;  3ZPV 1;  4N4F A;  2HDP A;  2K4D A;  2EOD A;  2MA6 A;  2ECV A;  1WIL A;  5AIT A;  5C11 A;  2ECW A;  2D8S A;  2H0D B;  1DVP A;  2ZET C;  2G43 A;  1VYX A;  3N9M A;  3NG2 A;  2YHN A;  4XI1 A;  1MM2 A;  3N9P A;  4IC2 A;  2EA6 A;  2ECG A;  3HTK C;  1WEP A;  2LRI C;  3VK6 A;  2XB1 A;  2VPE A;  3ZYQ A;  1JOC A;  3HCS A;  3KV5 A;  1JM7 A;  2MA5 A;  2KGG A;  2MNZ A;  1X4J A;  2G45 A;  3C5K A;  4YC9 A;  2Y1M A;  2KFT A;  2M6M A;  3O7A A;  1XWH A;  3PHD A;  5LKX A;  3RTR B;  2LV9 A;  2K17 A;  5B8D A;  4YBT A;  3L1Z B;  2YQM A;  5H1U A;  2KWJ A;  5D1K B;  4YAX A;  4A49 A;  1T1H A;  2IDA A;  4F52 B;  4A4B A;  2YSJ A;  2PUY A;  3O37 A;  2K16 A;  3ZNI A;  2DX8 A;  2M85 A;  4YBM A;  1WEO A;  2KE1 A;  2Y43 A;  5FB1 A;  2KWN A;  1Z60 A;  3T6R A;  5B78 A;  5KH7 A;  3PUQ A;  2L43 A;  3U5P A;  2LGL A;  1JM7 B;  3EB5 A;  3O35 A;  4V3L C;  1WEQ A;  4YAB A;  1WEW A;  3MHH A;  3M63 A;  2MD7 B;  3LRQ A;  2F42 A;  4PPE A;  4B7Y C;  5G04 B;  4L7X A;  2LGK A;  2C2V S;  2ECN A;  1FP0 A;  2KR4 A;  4LAD B;  1IYM A;  2E6R A;  5H9M A;  2VJE A;  3ZPV E;  2H0D A;  4AP4 A;  4A0C D;  3I2D A;  1WFK A;  1VFY A;  2LQ6 A;  2RI7 A;  4CCG X;  2NAA A;  5LKU A;  3N9L A;  4N3W A;  4YAD A;  1HYJ A;  3EB6 A;  1F62 A;  3SOU A;  2MNY A;  5TDW A;  1WEU A;  3SOW A;  3DQV R;  4UP5 A;  1G25 A;  4LKA A;  4QF2 A;  3GL6 A;  3L1X A;  3ZTG A;  4R2Y A;  2VPG A;  2FUI A;  2VJE B;  1WEE A;  4WZ0 A;  1WGM A;  5TAB A;  2L0B A;  5B77 A;  2VJF A;  2K1J A;  5LKZ A;  4WA6 A;  5EYA F;  2MD8 C;  4A4C A;  3SHB A;  4WZ2 A;  1WEN A;  3QZV A;  4FJC A;  5LCW B;  2LXP C;  4FO9 A;  4I7B A;  3T7L A;  5D1L B;  2F6N A;  4FIP A;  4WZ3 B;  2BAY A;  2CSY A;  2VJF B;  4P5O B;  4YBS A;  2YW8 A;  2YQL A;  3RPG C;  3N9Q A;  4MVT A;  4X3G A;  4NN2 A;  2YRE A;  2ECJ A;  2M1R A;  2LXH C;  4QF3 A;  3SOX A;  1X4I A;  2L5U A;  3KQI A;  1Z6U A;  5KH9 A;  3U5M A;  4AUQ B;  4O64 A;  4UI9 B;  2JMI A;  4L58 A;  3KNV A;  2EGP A;  4UP0 A;  3KV6 A;  3O34 A;  1ZBD B;  4LK9 A;  4IC3 A;  2MIQ A;  2RSD A;  4YAT A;  1X4U A;  3LQI A;  5KH3 A;  2MUM A;  3IHP A;  1WE9 A;  1LDJ B;  2FUU A;  4MSX A;  3C6W A;  5FB0 A;  2YSM A;  4ZDT A;  2YU4 A;  2QJ0 A;  5TDR A;  3PUR A;  1WEV A;  5DIN A;  4V3K C;  1LDK C;  3RPG B;  2QIZ A;  2KU3 A;  1BOR A;  5G05 B;  4R8P K;  4I7D A;  1WEM A;  4GNG A;  2XEU A;  1N87 A;  3L11 A;  4ZUX U;  2JMJ A;  4GNF A;  1MM3 A;  3MHS A;  4GNE A;  2VPB A;  5FEY A;  3N9O A;  2PNX A;  3LQJ A;  3U5O A;  1WES A;  4LJN A;  2KWO A;  2LGG A;  4GB0 A;  2MT5 A;  4ZQL A;  3N9N A;  2JRJ A;  2JMD A;  3DPL R;  2CKL A;  3U5N A;  2YYR A;  2LGV A;  3FL2 A;  5C13 A;  5H1T A;  1K2F A;  2YUR A;  1VD4 A;  4PTB A;  4AVX A;  4LLB A;  2KRE A;  5B75 A;  2ECI A;  2HYE D;  2KGI A;  3V43 A;  5H1V A;  2YUC A;  4C9Z A;  4I7C A;  4GND A;  1WIM A;  4BHW A;  3O33 A;  4S3O C;  2VP7 A;  2CKL B;  2L80 A;  2E6S A;  2LN0 A;  4W4U A;  5FER A;  2C2L A;  2OXQ C;  4Q6F A;  3O70 A;  4R7E A;  2KWK A;  5JG6 A;  2KIZ A;  1RMD A;  1E4U A;  1Z2Q A;  3O36 A;  1V87 A;  1HYI A;  3ZVZ B;  2CSZ A;  2YHO A;  2L75 A;  4TKP B;  3LQH A;  5DKA A;  4AYC A; 
#chains in the Genus database with same CATH topology
 2DJA A;  4BBQ A;  3FM8 C;  1FBV A;  2QIC A;  1U6G B;  2F6J A;  2Y1N A;  2VPD A;  2VNF A;  3ASL A;  5D1M B;  2CRW A;  5TBN A;  2LDR A;  4F1P A;  2XOY A;  2AN6 A;  3HCU A;  5AIU A;  5I3L A;  3PLW A;  2B0O E;  2KYU A;  2G6Q A;  4FK5 A;  5LKT A;  4OGC A;  3ZVY A;  4S3O B;  2FSA A;  5TRB A;  3GV4 A;  3HCT A;  4CA1 A;  2YT5 A;  3M62 A;  2M3H A;  2FD4 A;  4O62 A;  2I50 A;  5B79 A;  5G0F A;  1CHC A;  2CT2 A;  5B76 A;  2CRR A;  2L7P A;  4AYC B;  3T9K A;  5J3X A;  2ECT A;  4B86 C;  2UZG A;  3O47 A;  5SVI A;  3FAO A;  3M99 A;  3ZPV 1;  5K3Q A;  4N4F A;  2HDP A;  2K4D A;  2EOD A;  2MA6 A;  2ECV A;  2LAU A;  1WIL A;  5AIT A;  5C11 A;  2ECW A;  2D8S A;  2H0D B;  1DVP A;  2ZET C;  2G43 A;  1VYX A;  3N9M A;  3NG2 A;  5SVX A;  2YHN A;  4XI1 A;  1MM2 A;  3N9P A;  4IC2 A;  2EA6 A;  2ECG A;  3HTK C;  1WEP A;  2LRI C;  3VK6 A;  2XB1 A;  2VPE A;  3ZYQ A;  1JOC A;  3HCS A;  3KV5 A;  1JM7 A;  2MA5 A;  2KGG A;  2MNZ A;  2XP0 A;  1X4J A;  2G45 A;  3C5K A;  4YC9 A;  4Z0O A;  2Y1M A;  2KFT A;  2M6M A;  3O7A A;  1XWH A;  3PHD A;  5LKX A;  3RTR B;  2LV9 A;  2K17 A;  5B8D A;  4YBT A;  3L1Z B;  2YVR A;  2YQM A;  5H1U A;  2KWJ A;  3FEH A;  2E61 A;  4YAX A;  5D1K B;  4A49 A;  1T1H A;  2IDA A;  4F52 B;  4A4B A;  2YSJ A;  2PUY A;  3O37 A;  2K16 A;  3ZNI A;  2DX8 A;  2M85 A;  4YBM A;  1WEO A;  2KE1 A;  3LJU X;  2Y43 A;  5FB1 A;  2KWN A;  1Z60 A;  3T6R A;  5B78 A;  2JUN A;  5KH7 A;  3PUQ A;  2L43 A;  3U5P A;  2LGL A;  1JM7 B;  3EB5 A;  3O35 A;  4V3L C;  1WEQ A;  4YAB A;  1WEW A;  3MHH A;  2P57 A;  3M63 A;  2MD7 B;  3LRQ A;  3FAN A;  3DDT A;  2F42 A;  4PPE A;  4B7Y C;  5G04 B;  4L7X A;  2LGK A;  2CSV A;  2OWA A;  2C2V S;  2ECN A;  1FP0 A;  2KR4 A;  4LAD B;  1IYM A;  2E6R A;  5H9M A;  2VJE A;  3ZPV E;  2H0D A;  4AP4 A;  4A0C D;  3I2D A;  1WFK A;  1VFY A;  2JM3 A;  2LQ6 A;  2RI7 A;  4CCG X;  2NAA A;  5LKU A;  3N9L A;  4N3W A;  4YAD A;  1HYJ A;  3EB6 A;  1F62 A;  3SOU A;  2MNY A;  5TDW A;  1WEU A;  3SOW A;  3JUE A;  3DQV R;  4UP5 A;  1G25 A;  4LKA A;  4QF2 A;  3GL6 A;  3L1X A;  3ZTG A;  4R2Y A;  2VPG A;  2FUI A;  2VJE B;  1WEE A;  4WZ0 A;  1DCQ A;  1WGM A;  5TAB A;  2L0B A;  5B77 A;  2VJF A;  2K1J A;  5LKZ A;  4WA6 A;  5EYA F;  2MD8 C;  3DWD A;  4A4C A;  3SHB A;  3SUB A;  4WZ2 A;  1WEN A;  3QZV A;  4FJC A;  5LCW B;  2LXP C;  3LVQ E;  4FO9 A;  4I7B A;  3T7L A;  4OGE A;  5D1L B;  2F6N A;  2DSM A;  4FIP A;  4WZ3 B;  2CON A;  2BAY A;  2XOC A;  2CSY A;  2VJF B;  4P5O B;  4YBS A;  2YW8 A;  2YQL A;  3RPG C;  3N9Q A;  4MVT A;  4X3G A;  4NN2 A;  2YRE A;  2ECJ A;  4H9D A;  2M1R A;  2LXH C;  3H7H A;  4QF3 A;  3SOX A;  1X4I A;  2L5U A;  2FFW A;  2IQJ A;  3KQI A;  1Z6U A;  5KH9 A;  3U5M A;  4AUQ B;  4O64 A;  4UI9 B;  1MBM A;  2JMI A;  4L58 A;  3KNV A;  2EGP A;  4UP0 A;  3KV6 A;  3O34 A;  5SVY A;  1ZBD B;  4LK9 A;  4IC3 A;  2MIQ A;  2RSD A;  4YAT A;  1X4U A;  3LQI A;  5KH3 A;  2MUM A;  3IHP A;  1WE9 A;  1LDJ B;  2FUU A;  4MSX A;  2RR4 A;  3C6W A;  2MKE A;  5FB0 A;  2YSM A;  3E2D A;  4ZDT A;  2YU4 A;  2QJ0 A;  3PUR A;  5TDR A;  1WEV A;  5DIN A;  3MDB C;  4V3K C;  1LDK C;  3RPG B;  3KDE C;  2QIZ A;  2KKY A;  2KU3 A;  1BOR A;  5G05 B;  3LDY A;  4R8P K;  4I7D A;  1WEM A;  4GNG A;  2XEU A;  1N87 A;  3L11 A;  4ZUX U;  2JMJ A;  4GNF A;  1MM3 A;  3MHS A;  4GNE A;  2VPB A;  5FEY A;  2EXU A;  3N9O A;  2PNX A;  3LQJ A;  3U5O A;  1WES A;  3Q1D A;  4LJN A;  2KWO A;  2M13 A;  3LVR E;  2LGG A;  4GB0 A;  2MT5 A;  4ZQL A;  3N9N A;  2JRJ A;  2JMD A;  2XOZ A;  3DPL R;  2CKL A;  3U5N A;  2EGM A;  2YYR A;  2LGV A;  3FL2 A;  5C13 A;  5H1T A;  1K2F A;  2YUR A;  1VD4 A;  4PTB A;  4AVX A;  4LLB A;  4Z0R A;  2KRE A;  5B75 A;  5SVI B;  3FJU B;  2ECI A;  2HYE D;  4QQ4 A;  2KGI A;  3V43 A;  2KKX A;  5H1V A;  2YUC A;  4C9Z A;  4I7C A;  4GND A;  1WIM A;  4BHW A;  3O33 A;  4S3O C;  2VP7 A;  2CKL B;  2L80 A;  2E6S A;  2LN0 A;  4W4U A;  5FER A;  2C2L A;  2D8U A;  2OXQ C;  4Q6F A;  3O70 A;  4R7E A;  2KWK A;  5JG6 A;  2KIZ A;  1RMD A;  1E4U A;  1Z2Q A;  3O36 A;  1V87 A;  1HYI A;  3ZVZ B;  2CSZ A;  3M7K A;  2YHO A;  2L75 A;  4TKP B;  3LQH A;  5DKA A;  4AYC A; 
#chains in the Genus database with same CATH homology
 4BBQ A;  1FBV A;  2QIC A;  1U6G B;  2F6J A;  2Y1N A;  2VPD A;  2VNF A;  3ASL A;  5D1M B;  5TBN A;  2LDR A;  2AN6 A;  3HCU A;  5AIU A;  5I3L A;  2KYU A;  5LKT A;  2G6Q A;  4FK5 A;  3ZVY A;  4S3O B;  2FSA A;  5TRB A;  3GV4 A;  3HCT A;  4CA1 A;  2YT5 A;  3M62 A;  2M3H A;  2I50 A;  5B79 A;  5G0F A;  1CHC A;  2CT2 A;  5B76 A;  4AYC B;  5J3X A;  2ECT A;  4B86 C;  2UZG A;  3M99 A;  3ZPV 1;  4N4F A;  2HDP A;  2K4D A;  2EOD A;  2MA6 A;  2ECV A;  1WIL A;  5AIT A;  5C11 A;  2ECW A;  2D8S A;  2H0D B;  1DVP A;  2ZET C;  2G43 A;  1VYX A;  3N9M A;  3NG2 A;  2YHN A;  4XI1 A;  1MM2 A;  3N9P A;  4IC2 A;  2EA6 A;  2ECG A;  3HTK C;  1WEP A;  2LRI C;  3VK6 A;  2XB1 A;  2VPE A;  3ZYQ A;  1JOC A;  3HCS A;  3KV5 A;  1JM7 A;  2MA5 A;  2KGG A;  2MNZ A;  1X4J A;  2G45 A;  3C5K A;  4YC9 A;  2Y1M A;  2KFT A;  2M6M A;  3O7A A;  1XWH A;  3PHD A;  5LKX A;  3RTR B;  2LV9 A;  2K17 A;  5B8D A;  4YBT A;  3L1Z B;  2YQM A;  5H1U A;  2KWJ A;  5D1K B;  4YAX A;  4A49 A;  1T1H A;  2IDA A;  4F52 B;  4A4B A;  2YSJ A;  2PUY A;  3O37 A;  2K16 A;  3ZNI A;  2DX8 A;  2M85 A;  4YBM A;  1WEO A;  2KE1 A;  2Y43 A;  5FB1 A;  2KWN A;  1Z60 A;  3T6R A;  5B78 A;  5KH7 A;  3PUQ A;  2L43 A;  3U5P A;  2LGL A;  1JM7 B;  3EB5 A;  3O35 A;  4V3L C;  1WEQ A;  4YAB A;  1WEW A;  3MHH A;  3M63 A;  2MD7 B;  3LRQ A;  2F42 A;  4PPE A;  4B7Y C;  5G04 B;  4L7X A;  2LGK A;  2C2V S;  2ECN A;  1FP0 A;  2KR4 A;  4LAD B;  1IYM A;  2E6R A;  5H9M A;  2VJE A;  3ZPV E;  2H0D A;  4AP4 A;  4A0C D;  3I2D A;  1WFK A;  1VFY A;  2LQ6 A;  2RI7 A;  4CCG X;  2NAA A;  5LKU A;  3N9L A;  4N3W A;  4YAD A;  1HYJ A;  3EB6 A;  1F62 A;  3SOU A;  2MNY A;  5TDW A;  1WEU A;  3SOW A;  3DQV R;  4UP5 A;  1G25 A;  4LKA A;  4QF2 A;  3GL6 A;  3L1X A;  3ZTG A;  4R2Y A;  2VPG A;  2FUI A;  2VJE B;  1WEE A;  4WZ0 A;  1WGM A;  5TAB A;  2L0B A;  5B77 A;  2VJF A;  2K1J A;  5LKZ A;  4WA6 A;  5EYA F;  2MD8 C;  4A4C A;  3SHB A;  4WZ2 A;  1WEN A;  3QZV A;  4FJC A;  5LCW B;  2LXP C;  4FO9 A;  4I7B A;  3T7L A;  5D1L B;  2F6N A;  4FIP A;  4WZ3 B;  2BAY A;  2CSY A;  2VJF B;  4P5O B;  4YBS A;  2YW8 A;  2YQL A;  3RPG C;  3N9Q A;  4MVT A;  4X3G A;  4NN2 A;  2YRE A;  2ECJ A;  2M1R A;  2LXH C;  4QF3 A;  3SOX A;  1X4I A;  2L5U A;  3KQI A;  1Z6U A;  5KH9 A;  3U5M A;  4AUQ B;  4O64 A;  4UI9 B;  2JMI A;  4L58 A;  3KNV A;  2EGP A;  4UP0 A;  3KV6 A;  3O34 A;  1ZBD B;  4LK9 A;  4IC3 A;  2MIQ A;  2RSD A;  4YAT A;  1X4U A;  3LQI A;  5KH3 A;  2MUM A;  3IHP A;  1WE9 A;  1LDJ B;  2FUU A;  4MSX A;  3C6W A;  5FB0 A;  2YSM A;  4ZDT A;  2YU4 A;  2QJ0 A;  5TDR A;  3PUR A;  1WEV A;  5DIN A;  4V3K C;  1LDK C;  3RPG B;  2QIZ A;  2KU3 A;  1BOR A;  5G05 B;  4R8P K;  4I7D A;  1WEM A;  4GNG A;  2XEU A;  1N87 A;  3L11 A;  4ZUX U;  2JMJ A;  4GNF A;  1MM3 A;  3MHS A;  4GNE A;  2VPB A;  5FEY A;  3N9O A;  2PNX A;  3LQJ A;  3U5O A;  1WES A;  4LJN A;  2KWO A;  2LGG A;  4GB0 A;  2MT5 A;  4ZQL A;  3N9N A;  2JRJ A;  2JMD A;  3DPL R;  2CKL A;  3U5N A;  2YYR A;  2LGV A;  3FL2 A;  5C13 A;  5H1T A;  1K2F A;  2YUR A;  1VD4 A;  4PTB A;  4AVX A;  4LLB A;  2KRE A;  5B75 A;  2ECI A;  2HYE D;  2KGI A;  3V43 A;  5H1V A;  2YUC A;  4C9Z A;  4I7C A;  4GND A;  1WIM A;  4BHW A;  3O33 A;  4S3O C;  2VP7 A;  2CKL B;  2L80 A;  2E6S A;  2LN0 A;  4W4U A;  5FER A;  2C2L A;  2OXQ C;  4Q6F A;  3O70 A;  4R7E A;  2KWK A;  5JG6 A;  2KIZ A;  1RMD A;  1E4U A;  1Z2Q A;  3O36 A;  1V87 A;  1HYI A;  3ZVZ B;  2CSZ A;  2YHO A;  2L75 A;  4TKP B;  3LQH A;  5DKA A;  4AYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...