1WEWA

Solution structure of phd domain in dna-binding family protein aam98074
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
78
structure length
78
Chain Sequence
b'GSSGSSGEDPFQPEIKVRCVCGNSLETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding family protein
publication title Solution structure of PHD domain in DNA-binding family protein AAM98074
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 4
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wewA00
4O64A 4V3KC 2YHOA 3C6WA 1HYIA 4WZ0A 2KYUA 1WGMA 3N9NA 2C2VS 2E6RA 2MIQA 2LQ6A 2VJEA 2AN6A 2H0DB 2CKLB 2Y43A 2JMIA 2QJ0A 3ZTGA 3SOWA 1WEWA 2ECVA 4Q6FA 2FUUA 2LV9A 4YADA 1F62A 3L1XA 4IC3A 2RSDA 3KV5A 2ECNA 2ZETC 4NN2A 5TDWA 5H9MA 1WEQA 3GV4A 4LJNA 1VD4A 4I7DA 4UP0A 3ZNIA 4AYCA 2KWNA 3PUQA 1WEPA 3O70A 5G04B 3KV6A 1LDKC 4L58A 1V87A 2OXQC 5TABA 2KFTA 3L11A 3O34A 3O33A 3M62A 5H1TA 2NAAA 3LRQA 5LKUA 2UZGA 5C13A 5B75A 3SOXA 1MM2A 2M1RA 3N9MA 2CSZA 1T1HA 2YW8A 5KH7A 5LKZA 3RPGC 2G43A 4AVXA 3ZPV1 2YT5A 3LQJA 2VJFA 4R7EA 1Z6UA 4A4BA 4LKAA 4WZ2A 5H1VA 2L80A 2G6QA 2XB1A 1N87A 1WESA 4S3OB 1X4IA 1JM7B 5AITA 5FERA 2M3HA 3U5NA 3ZVZB 3ZYQA 2F42A 1WILA 2K1JA 4LLBA 5TBNA 2KGGA 5G05B 4WA6A 3EB6A 4A0CD 5B79A 2IDAA 2YSMA 4N3WA 5FB1A 1BORA 1K2FA 3O35A 3MHSA 2HDPA 4FO9A 3M63A 5D1KB 2YURA 4ZDTA 2ECWA 1WENA 1HYJA 1WIMA 4R8PK 4QF3A 2YHNA 2ECIA 2EODA 2MT5A 4I7CA 3ZPVE 2QIZA 2VPBA 5B77A 2LGKA 3M99A 1VYXA 2L43A 1Z60A 4L7XA 4AUQB 4QF2A 2MD8C 3HCSA 4YBMA 3ZVYA 5DKAA 5TRBA 4LK9A 2JRJA 3NG2A 4FJCA 4TKPB 4F52B 2CT2A 2C2LA 2YYRA 3DQVR 4A4CA 1U6GB 4B7YC 2FSAA 2VPDA 4GB0A 4CA1A 2KWOA 2H0DA 2CKLA 5LCWB 5H1UA 2LGGA 4GNDA 4S3OC 2YQMA 2I50A 5AIUA 2K4DA 5D1MB 2KWKA 3MHHA 2YU4A 2MA5A 5LKXA 5FB0A 3HCTA 1Z2QA 5TDRA 2L5UA 3PHDA 4FIPA 4YBTA 3I2DA 2PNXA 1WE9A 2F6JA 4BBQA 3C5KA 1VFYA 2M6MA 1X4JA 3HTKC 3U5MA 3N9LA 2E6SA 3V43A 1FBVA 2VJEB 5LKTA 1JOCA 2MNYA 5B78A 2DX8A 5D1LB 2K17A 4UP5A 2YSJA 4MSXA 2LN0A 4YBSA 4AP4A 2JMDA 2L0BA 4GNGA 4V3LC 1DVPA 5DINA 3O37A 5B76A 4YABA 2YREA 3LQHA 4FK5A 3EB5A 4WZ3B 1CHCA 2VPEA 3SHBA 5C11A 1JM7A 4PTBA 4YATA 2K16A 3SOUA 1WFKA 5JG6A 2KREA 3GL6A 2LXHC 2KWJA 3QZVA 4ZUXU 2PUYA 2RI7A 4W4UA 1E4UA 2VJFB 2KU3A 3N9PA 3PURA 1WEVA 2JMJA 4IC2A 1G25A 4PPEA 1LDJB 3U5OA 2G45A 2F6NA 1X4UA 2VNFA 3KNVA 2LRIC 2QICA 3U5PA 4C9ZA 3VK6A 4XI1A 4R2YA 5EYAF 3DPLR 5FEYA 3T7LA 5J3XA 3L1ZB 1MM3A 5KH3A 1WEMA 2M85A 3T6RA 3IHPA 1FP0A 2L75A 4A49A 4CCGX 2KR4A 2YUCA 2EA6A 2BAYA 4X3GA 3N9QA 4B86C 3O7AA 2ECGA 3HCUA 2FUIA 2HYED 4LADB 2D8SA 4ZQLA 2Y1MA 3KQIA 4GNFA 2KGIA 5I3LA 2MA6A 5B8DA 1RMDA 4GNEA 4YC9A 2VP7A 4MVTA 2Y1NA 5KH9A 2KE1A 3N9OA 4I7BA 1XWHA 4UI9B 3RPGB 3ASLA 2ECTA 2MNZA 5G0FA 2EGPA 3O36A 2LXPC 4P5OB 2MUMA 1ZBDB 4N4FA 2YQLA 4YAXA 3FL2A 4BHWA 2LGLA 2LDRA 1IYMA 2XEUA 3LQIA 3RTRB 2VPGA 2ECJA 2CSYA 2LGVA 1WEEA 1WEUA 2MD7B 4AYCB 2KIZA 1WEOA
chains in the Genus database with same CATH superfamily
2JM3A 4O64A 4V3KC 2YHOA 3C6WA 3LJUX 1HYIA 4WZ0A 2KYUA 1WGMA 3N9NA 2C2VS 2E6RA 2MIQA 2LQ6A 2VJEA 2AN6A 2H0DB 2CKLB 2Y43A 2B0OE 2JMIA 2QJ0A 2DJAA 3ZTGA 3SOWA 1WEWA 2ECVA 4Q6FA 2FUUA 3LDYA 2LV9A 4YADA 1F62A 3L1XA 4IC3A 2RSDA 3KV5A 2ECNA 2ZETC 4NN2A 5TDWA 2CRRA 5H9MA 1WEQA 2D8UA 3GV4A 4LJNA 1VD4A 4I7DA 4UP0A 5SVYA 3ZNIA 4AYCA 2KWNA 3PUQA 1WEPA 3O70A 5G04B 3KV6A 1LDKC 4L58A 1V87A 2OXQC 5TABA 2KFTA 3L11A 3DWDA 3O34A 3O33A 3M62A 5H1TA 2NAAA 3LRQA 5LKUA 2UZGA 5C13A 5B75A 3SOXA 1MM2A 2M1RA 3N9MA 4Z0OA 2CSZA 1T1HA 2YW8A 5KH7A 5LKZA 3RPGC 2G43A 4AVXA 3ZPV1 2YT5A 3LQJA 2VJFA 4R7EA 1Z6UA 4A4BA 4LKAA 4WZ2A 5H1VA 2L80A 2EGMA 2G6QA 2XB1A 1N87A 1WESA 4S3OB 2XOYA 1X4IA 1JM7B 5AITA 5FERA 2M3HA 2E61A 3U5NA 3ZVZB 3ZYQA 2F42A 2FFWA 5SVXA 1WILA 2K1JA 4LLBA 5TBNA 3E2DA 2KGGA 5G05B 4WA6A 3EB6A 4A0CD 5B79A 3JUEA 2IDAA 2YSMA 4N3WA 5FB1A 1BORA 1K2FA 3O35A 3LVQE 3MHSA 2HDPA 4FO9A 3M63A 5D1KB 2YURA 2L7PA 3PLWA 4ZDTA 2ECWA 1WENA 1HYJA 1WIMA 2M13A 4R8PK 3FANA 4QF3A 2YHNA 2ECIA 2EODA 2MT5A 4I7CA 3ZPVE 2QIZA 2EXUA 2VPBA 5B77A 2LGKA 3M99A 1VYXA 2L43A 1Z60A 3FM8C 4L7XA 4AUQB 4QF2A 2MD8C 3HCSA 4YBMA 3ZVYA 4QQ4A 3FEHA 3FAOA 5DKAA 5TRBA 4LK9A 2JRJA 3FJUB 3NG2A 4FJCA 4TKPB 4F52B 2CT2A 2C2LA 2YYRA 4O62A 3DQVR 4A4CA 1U6GB 2XOZA 4B7YC 2FSAA 2VPDA 4GB0A 4CA1A 2KWOA 2H0DA 2CKLA 5LCWB 5H1UA 3LVRE 2LGGA 2CONA 4GNDA 2OWAA 4S3OC 2YQMA 3M7KA 2I50A 5AIUA 2K4DA 3MDBC 2FD4A 5D1MB 2KWKA 3MHHA 2YU4A 2DSMA 2MA5A 3T9KA 5SVIB 5LKXA 5FB0A 3HCTA 2IQJA 1Z2QA 5TDRA 2L5UA 3PHDA 4FIPA 4YBTA 3I2DA 1DCQA 2PNXA 1WE9A 2F6JA 4BBQA 3C5KA 1VFYA 2M6MA 1X4JA 3HTKC 3U5MA 3N9LA 2E6SA 2XP0A 3V43A 1FBVA 2VJEB 5LKTA 1JOCA 2MNYA 5B78A 2DX8A 5D1LB 2K17A 4UP5A 4F1PA 2YSJA 4MSXA 2LN0A 3SUBA 4YBSA 4AP4A 2JMDA 2L0BA 4GNGA 4Z0RA 4V3LC 1DVPA 3Q1DA 5DINA 3O37A 5B76A 4YABA 2YREA 5SVIA 3LQHA 4FK5A 4OGCA 3EB5A 2XOCA 4WZ3B 1CHCA 2KKXA 2VPEA 1MBMA 3SHBA 5C11A 1JM7A 4PTBA 4YATA 2K16A 3SOUA 2RR4A 1WFKA 5JG6A 2KREA 4OGEA 2YVRA 2P57A 3GL6A 2LXHC 2KWJA 3QZVA 4ZUXU 2PUYA 2RI7A 4W4UA 1E4UA 2VJFB 2KU3A 3N9PA 3PURA 1WEVA 2JMJA 4IC2A 2CSVA 1G25A 2JUNA 4PPEA 1LDJB 3U5OA 2G45A 2F6NA 1X4UA 2VNFA 3KNVA 2LRIC 2QICA 3U5PA 4C9ZA 3VK6A 4XI1A 4R2YA 5EYAF 3DPLR 5FEYA 3T7LA 5J3XA 3L1ZB 1MM3A 5KH3A 1WEMA 2M85A 3T6RA 3IHPA 1FP0A 2L75A 3DDTA 4A49A 4CCGX 5K3QA 2KR4A 2YUCA 2EA6A 2BAYA 4X3GA 3N9QA 4B86C 3O7AA 2ECGA 3HCUA 2FUIA 2HYED 4LADB 2D8SA 2KKYA 4ZQLA 2Y1MA 3KQIA 4GNFA 2KGIA 5I3LA 2MA6A 2CRWA 5B8DA 1RMDA 4GNEA 4YC9A 2VP7A 4MVTA 2Y1NA 5KH9A 2KE1A 3N9OA 4I7BA 1XWHA 4UI9B 3O47A 3RPGB 3ASLA 2ECTA 2MNZA 4H9DA 5G0FA 2EGPA 3O36A 2LXPC 2LAUA 3H7HA 4P5OB 2MUMA 3KDEC 1ZBDB 4N4FA 2YQLA 2MKEA 4YAXA 3FL2A 4BHWA 2LGLA 2LDRA 1IYMA 2XEUA 3LQIA 3RTRB 2VPGA 2ECJA 2CSYA 2LGVA 1WEEA 1WEUA 2MD7B 4AYCB 2KIZA 1WEOA
chains in the Genus database with same CATH topology
4O64A 4V3KC 2YHOA 3C6WA 1HYIA 4WZ0A 2KYUA 1WGMA 3N9NA 2C2VS 2E6RA 2MIQA 2LQ6A 2VJEA 2AN6A 2H0DB 2CKLB 2Y43A 2JMIA 2QJ0A 3ZTGA 3SOWA 1WEWA 2ECVA 4Q6FA 2FUUA 2LV9A 4YADA 1F62A 3L1XA 4IC3A 2RSDA 3KV5A 2ECNA 2ZETC 4NN2A 5TDWA 5H9MA 1WEQA 3GV4A 4LJNA 1VD4A 4I7DA 4UP0A 3ZNIA 4AYCA 2KWNA 3PUQA 1WEPA 3O70A 5G04B 3KV6A 1LDKC 4L58A 1V87A 2OXQC 5TABA 2KFTA 3L11A 3O34A 3O33A 3M62A 5H1TA 2NAAA 3LRQA 5LKUA 2UZGA 5C13A 5B75A 3SOXA 1MM2A 2M1RA 3N9MA 2CSZA 1T1HA 2YW8A 5KH7A 5LKZA 3RPGC 2G43A 4AVXA 3ZPV1 2YT5A 3LQJA 2VJFA 4R7EA 1Z6UA 4A4BA 4LKAA 4WZ2A 5H1VA 2L80A 2G6QA 2XB1A 1N87A 1WESA 4S3OB 1X4IA 1JM7B 5AITA 5FERA 2M3HA 3U5NA 3ZVZB 3ZYQA 2F42A 1WILA 2K1JA 4LLBA 5TBNA 2KGGA 5G05B 4WA6A 3EB6A 4A0CD 5B79A 2IDAA 2YSMA 4N3WA 5FB1A 1BORA 1K2FA 3O35A 3MHSA 2HDPA 4FO9A 3M63A 5D1KB 2YURA 4ZDTA 2ECWA 1WENA 1HYJA 1WIMA 4R8PK 4QF3A 2YHNA 2ECIA 2EODA 2MT5A 4I7CA 3ZPVE 2QIZA 2VPBA 5B77A 2LGKA 3M99A 1VYXA 2L43A 1Z60A 4L7XA 4AUQB 4QF2A 2MD8C 3HCSA 4YBMA 3ZVYA 5DKAA 5TRBA 4LK9A 2JRJA 3NG2A 4FJCA 4TKPB 4F52B 2CT2A 2C2LA 2YYRA 3DQVR 4A4CA 1U6GB 4B7YC 2FSAA 2VPDA 4GB0A 4CA1A 2KWOA 2H0DA 2CKLA 5LCWB 5H1UA 2LGGA 4GNDA 4S3OC 2YQMA 2I50A 5AIUA 2K4DA 5D1MB 2KWKA 3MHHA 2YU4A 2MA5A 5LKXA 5FB0A 3HCTA 1Z2QA 5TDRA 2L5UA 3PHDA 4FIPA 4YBTA 3I2DA 2PNXA 1WE9A 2F6JA 4BBQA 3C5KA 1VFYA 2M6MA 1X4JA 3HTKC 3U5MA 3N9LA 2E6SA 3V43A 1FBVA 2VJEB 5LKTA 1JOCA 2MNYA 5B78A 2DX8A 5D1LB 2K17A 4UP5A 2YSJA 4MSXA 2LN0A 4YBSA 4AP4A 2JMDA 2L0BA 4GNGA 4V3LC 1DVPA 5DINA 3O37A 5B76A 4YABA 2YREA 3LQHA 4FK5A 3EB5A 4WZ3B 1CHCA 2VPEA 3SHBA 5C11A 1JM7A 4PTBA 4YATA 2K16A 3SOUA 1WFKA 5JG6A 2KREA 3GL6A 2LXHC 2KWJA 3QZVA 4ZUXU 2PUYA 2RI7A 4W4UA 1E4UA 2VJFB 2KU3A 3N9PA 3PURA 1WEVA 2JMJA 4IC2A 1G25A 4PPEA 1LDJB 3U5OA 2G45A 2F6NA 1X4UA 2VNFA 3KNVA 2LRIC 2QICA 3U5PA 4C9ZA 3VK6A 4XI1A 4R2YA 5EYAF 3DPLR 5FEYA 3T7LA 5J3XA 3L1ZB 1MM3A 5KH3A 1WEMA 2M85A 3T6RA 3IHPA 1FP0A 2L75A 4A49A 4CCGX 2KR4A 2YUCA 2EA6A 2BAYA 4X3GA 3N9QA 4B86C 3O7AA 2ECGA 3HCUA 2FUIA 2HYED 4LADB 2D8SA 4ZQLA 2Y1MA 3KQIA 4GNFA 2KGIA 5I3LA 2MA6A 5B8DA 1RMDA 4GNEA 4YC9A 2VP7A 4MVTA 2Y1NA 5KH9A 2KE1A 3N9OA 4I7BA 1XWHA 4UI9B 3RPGB 3ASLA 2ECTA 2MNZA 5G0FA 2EGPA 3O36A 2LXPC 4P5OB 2MUMA 1ZBDB 4N4FA 2YQLA 4YAXA 3FL2A 4BHWA 2LGLA 2LDRA 1IYMA 2XEUA 3LQIA 3RTRB 2VPGA 2ECJA 2CSYA 2LGVA 1WEEA 1WEUA 2MD7B 4AYCB 2KIZA 1WEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O64 A;  4V3K C;  2YHO A;  3C6W A;  1HYI A;  4WZ0 A;  2KYU A;  1WGM A;  3N9N A;  2C2V S;  2E6R A;  2MIQ A;  2LQ6 A;  2VJE A;  2AN6 A;  2H0D B;  2CKL B;  2Y43 A;  2JMI A;  2QJ0 A;  3ZTG A;  3SOW A;  1WEW A;  2ECV A;  4Q6F A;  2FUU A;  2LV9 A;  4YAD A;  1F62 A;  3L1X A;  4IC3 A;  2RSD A;  3KV5 A;  2ECN A;  2ZET C;  4NN2 A;  5TDW A;  5H9M A;  1WEQ A;  3GV4 A;  4LJN A;  1VD4 A;  4I7D A;  4UP0 A;  3ZNI A;  4AYC A;  2KWN A;  3PUQ A;  1WEP A;  3O70 A;  5G04 B;  3KV6 A;  1LDK C;  4L58 A;  1V87 A;  2OXQ C;  5TAB A;  2KFT A;  3L11 A;  3O34 A;  3O33 A;  3M62 A;  5H1T A;  2NAA A;  3LRQ A;  5LKU A;  2UZG A;  5C13 A;  5B75 A;  3SOX A;  1MM2 A;  2M1R A;  3N9M A;  2CSZ A;  1T1H A;  2YW8 A;  5KH7 A;  5LKZ A;  3RPG C;  2G43 A;  4AVX A;  3ZPV 1;  2YT5 A;  3LQJ A;  2VJF A;  4R7E A;  1Z6U A;  4A4B A;  4LKA A;  4WZ2 A;  5H1V A;  2L80 A;  2G6Q A;  2XB1 A;  1N87 A;  1WES A;  4S3O B;  1X4I A;  1JM7 B;  5AIT A;  5FER A;  2M3H A;  3U5N A;  3ZVZ B;  3ZYQ A;  2F42 A;  1WIL A;  2K1J A;  4LLB A;  5TBN A;  2KGG A;  5G05 B;  4WA6 A;  3EB6 A;  4A0C D;  5B79 A;  2IDA A;  2YSM A;  4N3W A;  5FB1 A;  1BOR A;  1K2F A;  3O35 A;  3MHS A;  2HDP A;  4FO9 A;  3M63 A;  5D1K B;  2YUR A;  4ZDT A;  2ECW A;  1WEN A;  1HYJ A;  1WIM A;  4R8P K;  4QF3 A;  2YHN A;  2ECI A;  2EOD A;  2MT5 A;  4I7C A;  3ZPV E;  2QIZ A;  2VPB A;  5B77 A;  2LGK A;  3M99 A;  1VYX A;  2L43 A;  1Z60 A;  4L7X A;  4AUQ B;  4QF2 A;  2MD8 C;  3HCS A;  4YBM A;  3ZVY A;  5DKA A;  5TRB A;  4LK9 A;  2JRJ A;  3NG2 A;  4FJC A;  4TKP B;  4F52 B;  2CT2 A;  2C2L A;  2YYR A;  3DQV R;  4A4C A;  1U6G B;  4B7Y C;  2FSA A;  2VPD A;  4GB0 A;  4CA1 A;  2KWO A;  2H0D A;  2CKL A;  5LCW B;  5H1U A;  2LGG A;  4GND A;  4S3O C;  2YQM A;  2I50 A;  5AIU A;  2K4D A;  5D1M B;  2KWK A;  3MHH A;  2YU4 A;  2MA5 A;  5LKX A;  5FB0 A;  3HCT A;  1Z2Q A;  5TDR A;  2L5U A;  3PHD A;  4FIP A;  4YBT A;  3I2D A;  2PNX A;  1WE9 A;  2F6J A;  4BBQ A;  3C5K A;  1VFY A;  2M6M A;  1X4J A;  3HTK C;  3U5M A;  3N9L A;  2E6S A;  3V43 A;  1FBV A;  2VJE B;  5LKT A;  1JOC A;  2MNY A;  5B78 A;  2DX8 A;  5D1L B;  2K17 A;  4UP5 A;  2YSJ A;  4MSX A;  2LN0 A;  4YBS A;  4AP4 A;  2JMD A;  2L0B A;  4GNG A;  4V3L C;  1DVP A;  5DIN A;  3O37 A;  5B76 A;  4YAB A;  2YRE A;  3LQH A;  4FK5 A;  3EB5 A;  4WZ3 B;  1CHC A;  2VPE A;  3SHB A;  5C11 A;  1JM7 A;  4PTB A;  4YAT A;  2K16 A;  3SOU A;  1WFK A;  5JG6 A;  2KRE A;  3GL6 A;  2LXH C;  2KWJ A;  3QZV A;  4ZUX U;  2PUY A;  2RI7 A;  4W4U A;  1E4U A;  2VJF B;  2KU3 A;  3N9P A;  3PUR A;  1WEV A;  2JMJ A;  4IC2 A;  1G25 A;  4PPE A;  1LDJ B;  3U5O A;  2G45 A;  2F6N A;  1X4U A;  2VNF A;  3KNV A;  2LRI C;  2QIC A;  3U5P A;  4C9Z A;  3VK6 A;  4XI1 A;  4R2Y A;  5EYA F;  3DPL R;  5FEY A;  3T7L A;  5J3X A;  3L1Z B;  1MM3 A;  5KH3 A;  1WEM A;  2M85 A;  3T6R A;  3IHP A;  1FP0 A;  2L75 A;  4A49 A;  4CCG X;  2KR4 A;  2YUC A;  2EA6 A;  2BAY A;  4X3G A;  3N9Q A;  4B86 C;  3O7A A;  2ECG A;  3HCU A;  2FUI A;  2HYE D;  4LAD B;  2D8S A;  4ZQL A;  2Y1M A;  3KQI A;  4GNF A;  2KGI A;  5I3L A;  2MA6 A;  5B8D A;  1RMD A;  4GNE A;  4YC9 A;  2VP7 A;  4MVT A;  2Y1N A;  5KH9 A;  2KE1 A;  3N9O A;  4I7B A;  1XWH A;  4UI9 B;  3RPG B;  3ASL A;  2ECT A;  2MNZ A;  5G0F A;  2EGP A;  3O36 A;  2LXP C;  4P5O B;  2MUM A;  1ZBD B;  4N4F A;  2YQL A;  4YAX A;  3FL2 A;  4BHW A;  2LGL A;  2LDR A;  1IYM A;  2XEU A;  3LQI A;  3RTR B;  2VPG A;  2ECJ A;  2CSY A;  2LGV A;  1WEE A;  1WEU A;  2MD7 B;  4AYC B;  2KIZ A;  1WEO A; 
#chains in the Genus database with same CATH topology
 2JM3 A;  4O64 A;  4V3K C;  2YHO A;  3C6W A;  3LJU X;  1HYI A;  4WZ0 A;  2KYU A;  1WGM A;  3N9N A;  2C2V S;  2E6R A;  2MIQ A;  2LQ6 A;  2VJE A;  2AN6 A;  2H0D B;  2CKL B;  2Y43 A;  2B0O E;  2JMI A;  2QJ0 A;  2DJA A;  3ZTG A;  3SOW A;  1WEW A;  2ECV A;  4Q6F A;  2FUU A;  3LDY A;  2LV9 A;  4YAD A;  1F62 A;  3L1X A;  4IC3 A;  2RSD A;  3KV5 A;  2ECN A;  2ZET C;  4NN2 A;  5TDW A;  2CRR A;  5H9M A;  1WEQ A;  2D8U A;  3GV4 A;  4LJN A;  1VD4 A;  4I7D A;  4UP0 A;  5SVY A;  3ZNI A;  4AYC A;  2KWN A;  3PUQ A;  1WEP A;  3O70 A;  5G04 B;  3KV6 A;  1LDK C;  4L58 A;  1V87 A;  2OXQ C;  5TAB A;  2KFT A;  3L11 A;  3DWD A;  3O34 A;  3O33 A;  3M62 A;  5H1T A;  2NAA A;  3LRQ A;  5LKU A;  2UZG A;  5C13 A;  5B75 A;  3SOX A;  1MM2 A;  2M1R A;  3N9M A;  4Z0O A;  2CSZ A;  1T1H A;  2YW8 A;  5KH7 A;  5LKZ A;  3RPG C;  2G43 A;  4AVX A;  3ZPV 1;  2YT5 A;  3LQJ A;  2VJF A;  4R7E A;  1Z6U A;  4A4B A;  4LKA A;  4WZ2 A;  5H1V A;  2L80 A;  2EGM A;  2G6Q A;  2XB1 A;  1N87 A;  1WES A;  4S3O B;  2XOY A;  1X4I A;  1JM7 B;  5AIT A;  5FER A;  2M3H A;  2E61 A;  3U5N A;  3ZVZ B;  3ZYQ A;  2F42 A;  2FFW A;  5SVX A;  1WIL A;  2K1J A;  4LLB A;  5TBN A;  3E2D A;  2KGG A;  5G05 B;  4WA6 A;  3EB6 A;  4A0C D;  5B79 A;  3JUE A;  2IDA A;  2YSM A;  4N3W A;  5FB1 A;  1BOR A;  1K2F A;  3O35 A;  3LVQ E;  3MHS A;  2HDP A;  4FO9 A;  3M63 A;  5D1K B;  2YUR A;  2L7P A;  3PLW A;  4ZDT A;  2ECW A;  1WEN A;  1HYJ A;  1WIM A;  2M13 A;  4R8P K;  3FAN A;  4QF3 A;  2YHN A;  2ECI A;  2EOD A;  2MT5 A;  4I7C A;  3ZPV E;  2QIZ A;  2EXU A;  2VPB A;  5B77 A;  2LGK A;  3M99 A;  1VYX A;  2L43 A;  1Z60 A;  3FM8 C;  4L7X A;  4AUQ B;  4QF2 A;  2MD8 C;  3HCS A;  4YBM A;  3ZVY A;  4QQ4 A;  3FEH A;  3FAO A;  5DKA A;  5TRB A;  4LK9 A;  2JRJ A;  3FJU B;  3NG2 A;  4FJC A;  4TKP B;  4F52 B;  2CT2 A;  2C2L A;  2YYR A;  4O62 A;  3DQV R;  4A4C A;  1U6G B;  2XOZ A;  4B7Y C;  2FSA A;  2VPD A;  4GB0 A;  4CA1 A;  2KWO A;  2H0D A;  2CKL A;  5LCW B;  5H1U A;  3LVR E;  2LGG A;  2CON A;  4GND A;  2OWA A;  4S3O C;  2YQM A;  3M7K A;  2I50 A;  5AIU A;  2K4D A;  3MDB C;  2FD4 A;  5D1M B;  2KWK A;  3MHH A;  2YU4 A;  2DSM A;  2MA5 A;  3T9K A;  5SVI B;  5LKX A;  5FB0 A;  3HCT A;  2IQJ A;  1Z2Q A;  5TDR A;  2L5U A;  3PHD A;  4FIP A;  4YBT A;  3I2D A;  1DCQ A;  2PNX A;  1WE9 A;  2F6J A;  4BBQ A;  3C5K A;  1VFY A;  2M6M A;  1X4J A;  3HTK C;  3U5M A;  3N9L A;  2E6S A;  2XP0 A;  3V43 A;  1FBV A;  2VJE B;  5LKT A;  1JOC A;  2MNY A;  5B78 A;  2DX8 A;  5D1L B;  2K17 A;  4UP5 A;  4F1P A;  2YSJ A;  4MSX A;  2LN0 A;  3SUB A;  4YBS A;  4AP4 A;  2JMD A;  2L0B A;  4GNG A;  4Z0R A;  4V3L C;  1DVP A;  3Q1D A;  5DIN A;  3O37 A;  5B76 A;  4YAB A;  2YRE A;  5SVI A;  3LQH A;  4FK5 A;  4OGC A;  3EB5 A;  2XOC A;  4WZ3 B;  1CHC A;  2KKX A;  2VPE A;  1MBM A;  3SHB A;  5C11 A;  1JM7 A;  4PTB A;  4YAT A;  2K16 A;  3SOU A;  2RR4 A;  1WFK A;  5JG6 A;  2KRE A;  4OGE A;  2YVR A;  2P57 A;  3GL6 A;  2LXH C;  2KWJ A;  3QZV A;  4ZUX U;  2PUY A;  2RI7 A;  4W4U A;  1E4U A;  2VJF B;  2KU3 A;  3N9P A;  3PUR A;  1WEV A;  2JMJ A;  4IC2 A;  2CSV A;  1G25 A;  2JUN A;  4PPE A;  1LDJ B;  3U5O A;  2G45 A;  2F6N A;  1X4U A;  2VNF A;  3KNV A;  2LRI C;  2QIC A;  3U5P A;  4C9Z A;  3VK6 A;  4XI1 A;  4R2Y A;  5EYA F;  3DPL R;  5FEY A;  3T7L A;  5J3X A;  3L1Z B;  1MM3 A;  5KH3 A;  1WEM A;  2M85 A;  3T6R A;  3IHP A;  1FP0 A;  2L75 A;  3DDT A;  4A49 A;  4CCG X;  5K3Q A;  2KR4 A;  2YUC A;  2EA6 A;  2BAY A;  4X3G A;  3N9Q A;  4B86 C;  3O7A A;  2ECG A;  3HCU A;  2FUI A;  2HYE D;  4LAD B;  2D8S A;  2KKY A;  4ZQL A;  2Y1M A;  3KQI A;  4GNF A;  2KGI A;  5I3L A;  2MA6 A;  2CRW A;  5B8D A;  1RMD A;  4GNE A;  4YC9 A;  2VP7 A;  4MVT A;  2Y1N A;  5KH9 A;  2KE1 A;  3N9O A;  4I7B A;  1XWH A;  4UI9 B;  3O47 A;  3RPG B;  3ASL A;  2ECT A;  2MNZ A;  4H9D A;  5G0F A;  2EGP A;  3O36 A;  2LXP C;  2LAU A;  3H7H A;  4P5O B;  2MUM A;  3KDE C;  1ZBD B;  4N4F A;  2YQL A;  2MKE A;  4YAX A;  3FL2 A;  4BHW A;  2LGL A;  2LDR A;  1IYM A;  2XEU A;  3LQI A;  3RTR B;  2VPG A;  2ECJ A;  2CSY A;  2LGV A;  1WEE A;  1WEU A;  2MD7 B;  4AYC B;  2KIZ A;  1WEO A; 
#chains in the Genus database with same CATH homology
 4O64 A;  4V3K C;  2YHO A;  3C6W A;  1HYI A;  4WZ0 A;  2KYU A;  1WGM A;  3N9N A;  2C2V S;  2E6R A;  2MIQ A;  2LQ6 A;  2VJE A;  2AN6 A;  2H0D B;  2CKL B;  2Y43 A;  2JMI A;  2QJ0 A;  3ZTG A;  3SOW A;  1WEW A;  2ECV A;  4Q6F A;  2FUU A;  2LV9 A;  4YAD A;  1F62 A;  3L1X A;  4IC3 A;  2RSD A;  3KV5 A;  2ECN A;  2ZET C;  4NN2 A;  5TDW A;  5H9M A;  1WEQ A;  3GV4 A;  4LJN A;  1VD4 A;  4I7D A;  4UP0 A;  3ZNI A;  4AYC A;  2KWN A;  3PUQ A;  1WEP A;  3O70 A;  5G04 B;  3KV6 A;  1LDK C;  4L58 A;  1V87 A;  2OXQ C;  5TAB A;  2KFT A;  3L11 A;  3O34 A;  3O33 A;  3M62 A;  5H1T A;  2NAA A;  3LRQ A;  5LKU A;  2UZG A;  5C13 A;  5B75 A;  3SOX A;  1MM2 A;  2M1R A;  3N9M A;  2CSZ A;  1T1H A;  2YW8 A;  5KH7 A;  5LKZ A;  3RPG C;  2G43 A;  4AVX A;  3ZPV 1;  2YT5 A;  3LQJ A;  2VJF A;  4R7E A;  1Z6U A;  4A4B A;  4LKA A;  4WZ2 A;  5H1V A;  2L80 A;  2G6Q A;  2XB1 A;  1N87 A;  1WES A;  4S3O B;  1X4I A;  1JM7 B;  5AIT A;  5FER A;  2M3H A;  3U5N A;  3ZVZ B;  3ZYQ A;  2F42 A;  1WIL A;  2K1J A;  4LLB A;  5TBN A;  2KGG A;  5G05 B;  4WA6 A;  3EB6 A;  4A0C D;  5B79 A;  2IDA A;  2YSM A;  4N3W A;  5FB1 A;  1BOR A;  1K2F A;  3O35 A;  3MHS A;  2HDP A;  4FO9 A;  3M63 A;  5D1K B;  2YUR A;  4ZDT A;  2ECW A;  1WEN A;  1HYJ A;  1WIM A;  4R8P K;  4QF3 A;  2YHN A;  2ECI A;  2EOD A;  2MT5 A;  4I7C A;  3ZPV E;  2QIZ A;  2VPB A;  5B77 A;  2LGK A;  3M99 A;  1VYX A;  2L43 A;  1Z60 A;  4L7X A;  4AUQ B;  4QF2 A;  2MD8 C;  3HCS A;  4YBM A;  3ZVY A;  5DKA A;  5TRB A;  4LK9 A;  2JRJ A;  3NG2 A;  4FJC A;  4TKP B;  4F52 B;  2CT2 A;  2C2L A;  2YYR A;  3DQV R;  4A4C A;  1U6G B;  4B7Y C;  2FSA A;  2VPD A;  4GB0 A;  4CA1 A;  2KWO A;  2H0D A;  2CKL A;  5LCW B;  5H1U A;  2LGG A;  4GND A;  4S3O C;  2YQM A;  2I50 A;  5AIU A;  2K4D A;  5D1M B;  2KWK A;  3MHH A;  2YU4 A;  2MA5 A;  5LKX A;  5FB0 A;  3HCT A;  1Z2Q A;  5TDR A;  2L5U A;  3PHD A;  4FIP A;  4YBT A;  3I2D A;  2PNX A;  1WE9 A;  2F6J A;  4BBQ A;  3C5K A;  1VFY A;  2M6M A;  1X4J A;  3HTK C;  3U5M A;  3N9L A;  2E6S A;  3V43 A;  1FBV A;  2VJE B;  5LKT A;  1JOC A;  2MNY A;  5B78 A;  2DX8 A;  5D1L B;  2K17 A;  4UP5 A;  2YSJ A;  4MSX A;  2LN0 A;  4YBS A;  4AP4 A;  2JMD A;  2L0B A;  4GNG A;  4V3L C;  1DVP A;  5DIN A;  3O37 A;  5B76 A;  4YAB A;  2YRE A;  3LQH A;  4FK5 A;  3EB5 A;  4WZ3 B;  1CHC A;  2VPE A;  3SHB A;  5C11 A;  1JM7 A;  4PTB A;  4YAT A;  2K16 A;  3SOU A;  1WFK A;  5JG6 A;  2KRE A;  3GL6 A;  2LXH C;  2KWJ A;  3QZV A;  4ZUX U;  2PUY A;  2RI7 A;  4W4U A;  1E4U A;  2VJF B;  2KU3 A;  3N9P A;  3PUR A;  1WEV A;  2JMJ A;  4IC2 A;  1G25 A;  4PPE A;  1LDJ B;  3U5O A;  2G45 A;  2F6N A;  1X4U A;  2VNF A;  3KNV A;  2LRI C;  2QIC A;  3U5P A;  4C9Z A;  3VK6 A;  4XI1 A;  4R2Y A;  5EYA F;  3DPL R;  5FEY A;  3T7L A;  5J3X A;  3L1Z B;  1MM3 A;  5KH3 A;  1WEM A;  2M85 A;  3T6R A;  3IHP A;  1FP0 A;  2L75 A;  4A49 A;  4CCG X;  2KR4 A;  2YUC A;  2EA6 A;  2BAY A;  4X3G A;  3N9Q A;  4B86 C;  3O7A A;  2ECG A;  3HCU A;  2FUI A;  2HYE D;  4LAD B;  2D8S A;  4ZQL A;  2Y1M A;  3KQI A;  4GNF A;  2KGI A;  5I3L A;  2MA6 A;  5B8D A;  1RMD A;  4GNE A;  4YC9 A;  2VP7 A;  4MVT A;  2Y1N A;  5KH9 A;  2KE1 A;  3N9O A;  4I7B A;  1XWH A;  4UI9 B;  3RPG B;  3ASL A;  2ECT A;  2MNZ A;  5G0F A;  2EGP A;  3O36 A;  2LXP C;  4P5O B;  2MUM A;  1ZBD B;  4N4F A;  2YQL A;  4YAX A;  3FL2 A;  4BHW A;  2LGL A;  2LDR A;  1IYM A;  2XEU A;  3LQI A;  3RTR B;  2VPG A;  2ECJ A;  2CSY A;  2LGV A;  1WEE A;  1WEU A;  2MD7 B;  4AYC B;  2KIZ A;  1WEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...