1WEWA

Solution structure of phd domain in dna-binding family protein aam98074
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
78
structure length
78
Chain Sequence
GSSGSSGEDPFQPEIKVRCVCGNSLETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding family protein
publication title Solution structure of PHD domain in DNA-binding family protein AAM98074
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 4
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wewA00
1Z2QA 2LGLA 2ZETC 2JMDA 4QF3A 2KWKA 4L7XA 2G43A 1WILA 3O35A 2VPGA 3EB6A 5J3XA 2KREA 2KWNA 4GNEA 1LDKC 2K17A 2KR4A 3RPGB 4FJCA 5H1TA 3SOUA 2MD7B 5H1VA 2HDPA 4UP5A 2EGPA 3GV4A 4WZ3B 3N9OA 1VYXA 5TBNA 5LKUA 1X4JA 4R8PK 2F42A 2AN6A 2L0BA 3I2DA 2KGIA 4W4UA 5C13A 3SOWA 2VJEA 5FB0A 4IC2A 2K16A 4V3LC 5G05B 5TDWA 4IC3A 4XI1A 4N3WA 5FB1A 3U5OA 1VD4A 3GL6A 3O37A 4S3OC 2YURA 2LXPC 2LGGA 2RSDA 1Z60A 3ZTGA 3HCUA 2YQMA 2JMJA 2KIZA 1JM7B 3KV6A 5FEYA 5TABA 4YATA 2JRJA 3ZPV1 2K1JA 4R7EA 5JG6A 2XB1A 5LKTA 1V87A 2QIZA 3LRQA 2EODA 2LXHC 1WFKA 5D1LB 1BORA 1Z6UA 2F6JA 5EYAF 2KFTA 1WEOA 2E6RA 4B86C 4LKAA 3SOXA 4F52B 2I50A 4AYCA 1CHCA 2H0DB 2E6SA 1WGMA 2YREA 2L80A 1WIMA 3ZVZB 5H9MA 3HCSA 4ZDTA 3ZVYA 1WESA 4I7CA 5TRBA 4B7YC 2CKLA 2QICA 5LKXA 3M99A 2YHNA 2L5UA 2YT5A 4CA1A 2KGGA 4AUQB 3KQIA 2OXQC 4MSXA 5DKAA 3T6RA 2YSMA 5B77A 5B76A 5G04B 3LQIA 3LQJA 4Q6FA 1LDJB 4YAXA 5B78A 2KWOA 1MM3A 3U5NA 4LADB 3O33A 2CT2A 2VP7A 5AIUA 3V43A 4YABA 1VFYA 2FUIA 1K2FA 2HYED 2VJFB 4V3KC 4PTBA 4UP0A 2MIQA 4LLBA 1MM2A 1T1HA 4GNGA 5C11A 2Y1NA 4FO9A 2LRIC 3U5PA 3VK6A 2M85A 3DQVR 3PHDA 3L1XA 1X4IA 2NAAA 2ECWA 3M63A 4R2YA 2RI7A 2YU4A 1G25A 2M6MA 2C2LA 2MNYA 2LN0A 3RTRB 3O36A 4AP4A 4FK5A 3RPGC 4A4CA 5LCWB 3SHBA 4A0CD 2MUMA 4PPEA 2JMIA 4TKPB 3FL2A 2XEUA 4L58A 2LGKA 1ZBDB 2LGVA 2VNFA 1JOCA 3O34A 1RMDA 3QZVA 1WENA 3DPLR 3N9QA 3N9MA 2FUUA 5AITA 1N87A 2ECTA 2CSYA 4A4BA 2UZGA 5FERA 4LJNA 1JM7A 2YYRA 2PUYA 3KNVA 3N9NA 4GB0A 4S3OB 3NG2A 1U6GB 5KH7A 4I7BA 2MT5A 2MD8C 4MVTA 4CCGX 2KU3A 1WEPA 5D1MB 2VJEB 2ECGA 3ZPVE 1HYJA 3L11A 2YHOA 2ECNA 5D1KB 2ECJA 1HYIA 2ECIA 4YBMA 4BBQA 3L1ZB 2YUCA 4GNFA 3ZYQA 1F62A 4BHWA 2VPEA 2C2VS 2H0DA 4ZQLA 5TDRA 4X3GA 2EA6A 2QJ0A 4ZUXU 2CSZA 3U5MA 3PUQA 2M3HA 4YADA 4YBTA 3KV5A 2F6NA 2FSAA 2LV9A 2D8SA 4WZ0A 4FIPA 5DINA 3HCTA 2YSJA 4P5OB 3EB5A 3O70A 1WEWA 3N9PA 5I3LA 3O7AA 2G6QA 2K4DA 2G45A 2YQLA 2KWJA 1DVPA 2MNZA 4UI9B 1XWHA 1WEUA 2VPBA 4A49A 4LK9A 5H1UA 3ZNIA 2VPDA 4AYCB 3C5KA 1E4UA 4NN2A 2IDAA 1WEEA 2KE1A 3T7LA 3MHHA 1IYMA 4WZ2A 1FBVA 3PURA 2BAYA 2MA5A 3MHSA 4YC9A 2LQ6A 1FP0A 1WEVA 4AVXA 2L75A 2Y43A 2CKLB 3M62A 2VJFA 2ECVA 4GNDA 5KH9A 5G0FA 2PNXA 1X4UA 2L43A 4C9ZA 4QF2A 3ASLA 2Y1MA 3LQHA 2LDRA 1WE9A 2DX8A 3C6WA 4YBSA 4I7DA 5KH3A 2MA6A 5B8DA 2KYUA 1WEMA 2M1RA 5B79A 3IHPA 2YW8A 3N9LA 5LKZA 4N4FA 4WA6A 4O64A 5B75A 3HTKC 1WEQA
chains in the Genus database with same CATH superfamily
1Z2QA 2LGLA 2ZETC 2JMDA 4QF3A 3Q1DA 2KWKA 4L7XA 2G43A 1WILA 3O35A 2VPGA 3EB6A 3DWDA 5J3XA 2KREA 2KWNA 4GNEA 1LDKC 2K17A 2KR4A 3RPGB 4FJCA 2XOYA 5H1TA 3M7KA 3SOUA 2MD7B 5H1VA 2HDPA 4UP5A 2EGPA 3GV4A 4WZ3B 3N9OA 1VYXA 5TBNA 2CRWA 5LKUA 1X4JA 4R8PK 2F42A 2AN6A 2L0BA 3I2DA 2KGIA 4W4UA 5C13A 2L7PA 3SOWA 2VJEA 5FB0A 2JM3A 4IC2A 2K16A 4V3LC 5G05B 5TDWA 2IQJA 4IC3A 4XI1A 4N3WA 5FB1A 3U5OA 1VD4A 4Z0RA 3E2DA 3GL6A 3O37A 3JUEA 4S3OC 2YURA 2LXPC 2LGGA 2RSDA 1Z60A 3ZTGA 3HCUA 2YQMA 2JMJA 2KIZA 1JM7B 3KV6A 5FEYA 5TABA 4YATA 2JRJA 3ZPV1 2DSMA 2D8UA 2K1JA 4R7EA 5JG6A 2XB1A 5LKTA 1V87A 2QIZA 2EXUA 2DJAA 3LRQA 2EODA 2LXHC 1WFKA 4OGCA 5D1LB 1BORA 1Z6UA 2F6JA 5EYAF 2KFTA 1WEOA 2E6RA 4B86C 4LKAA 3SOXA 4F52B 2I50A 5SVIB 4AYCA 1CHCA 2H0DB 5SVXA 2E6SA 1WGMA 2CRRA 2YREA 2L80A 1WIMA 3ZVZB 5H9MA 3HCSA 4ZDTA 3ZVYA 1WESA 2EGMA 4I7CA 5TRBA 4B7YC 2CKLA 2QICA 3LVQE 5LKXA 3M99A 2YHNA 2L5UA 2YT5A 3T9KA 4CA1A 2KGGA 4AUQB 3KQIA 2OXQC 4MSXA 5DKAA 3T6RA 2YSMA 4OGEA 5B77A 5K3QA 5B76A 5G04B 4O62A 2B0OE 2YVRA 4QQ4A 3LQIA 2OWAA 3LQJA 4Q6FA 1LDJB 4YAXA 5B78A 3H7HA 2KWOA 1MM3A 3U5NA 4LADB 3O33A 2XP0A 2CT2A 2VP7A 5AIUA 3V43A 4YABA 1VFYA 2FUIA 1K2FA 3O47A 2HYED 2VJFB 4V3KC 4F1PA 4PTBA 4UP0A 3FEHA 2MIQA 3LVRE 4LLBA 1MM2A 1T1HA 4GNGA 5C11A 2FD4A 2Y1NA 4FO9A 2LRIC 3U5PA 2RR4A 3VK6A 2M85A 3DQVR 3PHDA 3L1XA 1X4IA 2NAAA 2ECWA 3M63A 4R2YA 2RI7A 2LAUA 2YU4A 1G25A 2M6MA 2C2LA 2MNYA 3PLWA 2FFWA 2LN0A 3RTRB 3LJUX 2M13A 3O36A 3KDEC 4AP4A 4FK5A 3RPGC 4A4CA 5LCWB 3SHBA 4A0CD 2MUMA 4PPEA 2JMIA 4TKPB 3FL2A 2XEUA 4L58A 2LGKA 1ZBDB 2LGVA 2VNFA 1JOCA 3O34A 1RMDA 3QZVA 1WENA 3DPLR 3N9QA 3N9MA 2FUUA 5AITA 1N87A 2ECTA 2CSYA 4A4BA 2UZGA 3SUBA 5FERA 4LJNA 1JM7A 2YYRA 2PUYA 2KKYA 2MKEA 3KNVA 3N9NA 4GB0A 4S3OB 5SVYA 3NG2A 1U6GB 3LDYA 1DCQA 5KH7A 3FAOA 4I7BA 2MT5A 2MD8C 4MVTA 4CCGX 2KU3A 3DDTA 1WEPA 5D1MB 2VJEB 2ECGA 3ZPVE 1HYJA 3FM8C 3L11A 2YHOA 2ECNA 5D1KB 2ECJA 1HYIA 2ECIA 4YBMA 4BBQA 2P57A 3L1ZB 2YUCA 4GNFA 3ZYQA 1F62A 5SVIA 4BHWA 2VPEA 2C2VS 2H0DA 4ZQLA 5TDRA 4X3GA 2EA6A 2QJ0A 4ZUXU 2CSZA 3U5MA 2CONA 3PUQA 2M3HA 2E61A 2XOCA 4YADA 4YBTA 3KV5A 2F6NA 2FSAA 2LV9A 2D8SA 4WZ0A 4FIPA 5DINA 2CSVA 3HCTA 2YSJA 4P5OB 3EB5A 3O70A 1WEWA 3N9PA 5I3LA 3O7AA 2G6QA 2K4DA 2G45A 1MBMA 2YQLA 2KWJA 1DVPA 2MNZA 4UI9B 1XWHA 1WEUA 2VPBA 4A49A 4LK9A 5H1UA 3ZNIA 2VPDA 4AYCB 3C5KA 1E4UA 4NN2A 2IDAA 1WEEA 2KE1A 3T7LA 3MHHA 2XOZA 1IYMA 4WZ2A 1FBVA 2KKXA 3FJUB 3PURA 2BAYA 2MA5A 3MHSA 4YC9A 2LQ6A 1FP0A 1WEVA 4AVXA 2L75A 2Y43A 2CKLB 3M62A 2VJFA 2ECVA 4GNDA 5KH9A 5G0FA 2PNXA 1X4UA 2L43A 4C9ZA 4QF2A 3ASLA 2Y1MA 3LQHA 2LDRA 1WE9A 2DX8A 3C6WA 4YBSA 4I7DA 5KH3A 2MA6A 5B8DA 2KYUA 1WEMA 2M1RA 4H9DA 5B79A 3IHPA 2YW8A 3N9LA 3MDBC 4Z0OA 5LKZA 4N4FA 4WA6A 4O64A 5B75A 3HTKC 2JUNA 3FANA 1WEQA
chains in the Genus database with same CATH topology
1Z2QA 2LGLA 2ZETC 2JMDA 4QF3A 2KWKA 4L7XA 2G43A 1WILA 3O35A 2VPGA 3EB6A 5J3XA 2KREA 2KWNA 4GNEA 1LDKC 2K17A 2KR4A 3RPGB 4FJCA 5H1TA 3SOUA 2MD7B 5H1VA 2HDPA 4UP5A 2EGPA 3GV4A 4WZ3B 3N9OA 1VYXA 5TBNA 5LKUA 1X4JA 4R8PK 2F42A 2AN6A 2L0BA 3I2DA 2KGIA 4W4UA 5C13A 3SOWA 2VJEA 5FB0A 4IC2A 2K16A 4V3LC 5G05B 5TDWA 4IC3A 4XI1A 4N3WA 5FB1A 3U5OA 1VD4A 3GL6A 3O37A 4S3OC 2YURA 2LXPC 2LGGA 2RSDA 1Z60A 3ZTGA 3HCUA 2YQMA 2JMJA 2KIZA 1JM7B 3KV6A 5FEYA 5TABA 4YATA 2JRJA 3ZPV1 2K1JA 4R7EA 5JG6A 2XB1A 5LKTA 1V87A 2QIZA 3LRQA 2EODA 2LXHC 1WFKA 5D1LB 1BORA 1Z6UA 2F6JA 5EYAF 2KFTA 1WEOA 2E6RA 4B86C 4LKAA 3SOXA 4F52B 2I50A 4AYCA 1CHCA 2H0DB 2E6SA 1WGMA 2YREA 2L80A 1WIMA 3ZVZB 5H9MA 3HCSA 4ZDTA 3ZVYA 1WESA 4I7CA 5TRBA 4B7YC 2CKLA 2QICA 5LKXA 3M99A 2YHNA 2L5UA 2YT5A 4CA1A 2KGGA 4AUQB 3KQIA 2OXQC 4MSXA 5DKAA 3T6RA 2YSMA 5B77A 5B76A 5G04B 3LQIA 3LQJA 4Q6FA 1LDJB 4YAXA 5B78A 2KWOA 1MM3A 3U5NA 4LADB 3O33A 2CT2A 2VP7A 5AIUA 3V43A 4YABA 1VFYA 2FUIA 1K2FA 2HYED 2VJFB 4V3KC 4PTBA 4UP0A 2MIQA 4LLBA 1MM2A 1T1HA 4GNGA 5C11A 2Y1NA 4FO9A 2LRIC 3U5PA 3VK6A 2M85A 3DQVR 3PHDA 3L1XA 1X4IA 2NAAA 2ECWA 3M63A 4R2YA 2RI7A 2YU4A 1G25A 2M6MA 2C2LA 2MNYA 2LN0A 3RTRB 3O36A 4AP4A 4FK5A 3RPGC 4A4CA 5LCWB 3SHBA 4A0CD 2MUMA 4PPEA 2JMIA 4TKPB 3FL2A 2XEUA 4L58A 2LGKA 1ZBDB 2LGVA 2VNFA 1JOCA 3O34A 1RMDA 3QZVA 1WENA 3DPLR 3N9QA 3N9MA 2FUUA 5AITA 1N87A 2ECTA 2CSYA 4A4BA 2UZGA 5FERA 4LJNA 1JM7A 2YYRA 2PUYA 3KNVA 3N9NA 4GB0A 4S3OB 3NG2A 1U6GB 5KH7A 4I7BA 2MT5A 2MD8C 4MVTA 4CCGX 2KU3A 1WEPA 5D1MB 2VJEB 2ECGA 3ZPVE 1HYJA 3L11A 2YHOA 2ECNA 5D1KB 2ECJA 1HYIA 2ECIA 4YBMA 4BBQA 3L1ZB 2YUCA 4GNFA 3ZYQA 1F62A 4BHWA 2VPEA 2C2VS 2H0DA 4ZQLA 5TDRA 4X3GA 2EA6A 2QJ0A 4ZUXU 2CSZA 3U5MA 3PUQA 2M3HA 4YADA 4YBTA 3KV5A 2F6NA 2FSAA 2LV9A 2D8SA 4WZ0A 4FIPA 5DINA 3HCTA 2YSJA 4P5OB 3EB5A 3O70A 1WEWA 3N9PA 5I3LA 3O7AA 2G6QA 2K4DA 2G45A 2YQLA 2KWJA 1DVPA 2MNZA 4UI9B 1XWHA 1WEUA 2VPBA 4A49A 4LK9A 5H1UA 3ZNIA 2VPDA 4AYCB 3C5KA 1E4UA 4NN2A 2IDAA 1WEEA 2KE1A 3T7LA 3MHHA 1IYMA 4WZ2A 1FBVA 3PURA 2BAYA 2MA5A 3MHSA 4YC9A 2LQ6A 1FP0A 1WEVA 4AVXA 2L75A 2Y43A 2CKLB 3M62A 2VJFA 2ECVA 4GNDA 5KH9A 5G0FA 2PNXA 1X4UA 2L43A 4C9ZA 4QF2A 3ASLA 2Y1MA 3LQHA 2LDRA 1WE9A 2DX8A 3C6WA 4YBSA 4I7DA 5KH3A 2MA6A 5B8DA 2KYUA 1WEMA 2M1RA 5B79A 3IHPA 2YW8A 3N9LA 5LKZA 4N4FA 4WA6A 4O64A 5B75A 3HTKC 1WEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2Q A;  2LGL A;  2ZET C;  2JMD A;  4QF3 A;  2KWK A;  4L7X A;  2G43 A;  1WIL A;  3O35 A;  2VPG A;  3EB6 A;  5J3X A;  2KRE A;  2KWN A;  4GNE A;  1LDK C;  2K17 A;  2KR4 A;  3RPG B;  4FJC A;  5H1T A;  3SOU A;  2MD7 B;  5H1V A;  2HDP A;  4UP5 A;  2EGP A;  3GV4 A;  4WZ3 B;  3N9O A;  1VYX A;  5TBN A;  5LKU A;  1X4J A;  4R8P K;  2F42 A;  2AN6 A;  2L0B A;  3I2D A;  2KGI A;  4W4U A;  5C13 A;  3SOW A;  2VJE A;  5FB0 A;  4IC2 A;  2K16 A;  4V3L C;  5G05 B;  5TDW A;  4IC3 A;  4XI1 A;  4N3W A;  5FB1 A;  3U5O A;  1VD4 A;  3GL6 A;  3O37 A;  4S3O C;  2YUR A;  2LXP C;  2LGG A;  2RSD A;  1Z60 A;  3ZTG A;  3HCU A;  2YQM A;  2JMJ A;  2KIZ A;  1JM7 B;  3KV6 A;  5FEY A;  5TAB A;  4YAT A;  2JRJ A;  3ZPV 1;  2K1J A;  4R7E A;  5JG6 A;  2XB1 A;  5LKT A;  1V87 A;  2QIZ A;  3LRQ A;  2EOD A;  2LXH C;  1WFK A;  5D1L B;  1BOR A;  1Z6U A;  2F6J A;  5EYA F;  2KFT A;  1WEO A;  2E6R A;  4B86 C;  4LKA A;  3SOX A;  4F52 B;  2I50 A;  4AYC A;  1CHC A;  2H0D B;  2E6S A;  1WGM A;  2YRE A;  2L80 A;  1WIM A;  3ZVZ B;  5H9M A;  3HCS A;  4ZDT A;  3ZVY A;  1WES A;  4I7C A;  5TRB A;  4B7Y C;  2CKL A;  2QIC A;  5LKX A;  3M99 A;  2YHN A;  2L5U A;  2YT5 A;  4CA1 A;  2KGG A;  4AUQ B;  3KQI A;  2OXQ C;  4MSX A;  5DKA A;  3T6R A;  2YSM A;  5B77 A;  5B76 A;  5G04 B;  3LQI A;  3LQJ A;  4Q6F A;  1LDJ B;  4YAX A;  5B78 A;  2KWO A;  1MM3 A;  3U5N A;  4LAD B;  3O33 A;  2CT2 A;  2VP7 A;  5AIU A;  3V43 A;  4YAB A;  1VFY A;  2FUI A;  1K2F A;  2HYE D;  2VJF B;  4V3K C;  4PTB A;  4UP0 A;  2MIQ A;  4LLB A;  1MM2 A;  1T1H A;  4GNG A;  5C11 A;  2Y1N A;  4FO9 A;  2LRI C;  3U5P A;  3VK6 A;  2M85 A;  3DQV R;  3PHD A;  3L1X A;  1X4I A;  2NAA A;  2ECW A;  3M63 A;  4R2Y A;  2RI7 A;  2YU4 A;  1G25 A;  2M6M A;  2C2L A;  2MNY A;  2LN0 A;  3RTR B;  3O36 A;  4AP4 A;  4FK5 A;  3RPG C;  4A4C A;  5LCW B;  3SHB A;  4A0C D;  2MUM A;  4PPE A;  2JMI A;  4TKP B;  3FL2 A;  2XEU A;  4L58 A;  2LGK A;  1ZBD B;  2LGV A;  2VNF A;  1JOC A;  3O34 A;  1RMD A;  3QZV A;  1WEN A;  3DPL R;  3N9Q A;  3N9M A;  2FUU A;  5AIT A;  1N87 A;  2ECT A;  2CSY A;  4A4B A;  2UZG A;  5FER A;  4LJN A;  1JM7 A;  2YYR A;  2PUY A;  3KNV A;  3N9N A;  4GB0 A;  4S3O B;  3NG2 A;  1U6G B;  5KH7 A;  4I7B A;  2MT5 A;  2MD8 C;  4MVT A;  4CCG X;  2KU3 A;  1WEP A;  5D1M B;  2VJE B;  2ECG A;  3ZPV E;  1HYJ A;  3L11 A;  2YHO A;  2ECN A;  5D1K B;  2ECJ A;  1HYI A;  2ECI A;  4YBM A;  4BBQ A;  3L1Z B;  2YUC A;  4GNF A;  3ZYQ A;  1F62 A;  4BHW A;  2VPE A;  2C2V S;  2H0D A;  4ZQL A;  5TDR A;  4X3G A;  2EA6 A;  2QJ0 A;  4ZUX U;  2CSZ A;  3U5M A;  3PUQ A;  2M3H A;  4YAD A;  4YBT A;  3KV5 A;  2F6N A;  2FSA A;  2LV9 A;  2D8S A;  4WZ0 A;  4FIP A;  5DIN A;  3HCT A;  2YSJ A;  4P5O B;  3EB5 A;  3O70 A;  1WEW A;  3N9P A;  5I3L A;  3O7A A;  2G6Q A;  2K4D A;  2G45 A;  2YQL A;  2KWJ A;  1DVP A;  2MNZ A;  4UI9 B;  1XWH A;  1WEU A;  2VPB A;  4A49 A;  4LK9 A;  5H1U A;  3ZNI A;  2VPD A;  4AYC B;  3C5K A;  1E4U A;  4NN2 A;  2IDA A;  1WEE A;  2KE1 A;  3T7L A;  3MHH A;  1IYM A;  4WZ2 A;  1FBV A;  3PUR A;  2BAY A;  2MA5 A;  3MHS A;  4YC9 A;  2LQ6 A;  1FP0 A;  1WEV A;  4AVX A;  2L75 A;  2Y43 A;  2CKL B;  3M62 A;  2VJF A;  2ECV A;  4GND A;  5KH9 A;  5G0F A;  2PNX A;  1X4U A;  2L43 A;  4C9Z A;  4QF2 A;  3ASL A;  2Y1M A;  3LQH A;  2LDR A;  1WE9 A;  2DX8 A;  3C6W A;  4YBS A;  4I7D A;  5KH3 A;  2MA6 A;  5B8D A;  2KYU A;  1WEM A;  2M1R A;  5B79 A;  3IHP A;  2YW8 A;  3N9L A;  5LKZ A;  4N4F A;  4WA6 A;  4O64 A;  5B75 A;  3HTK C;  1WEQ A; 
#chains in the Genus database with same CATH topology
 1Z2Q A;  2LGL A;  2ZET C;  2JMD A;  4QF3 A;  3Q1D A;  2KWK A;  4L7X A;  2G43 A;  1WIL A;  3O35 A;  2VPG A;  3EB6 A;  3DWD A;  5J3X A;  2KRE A;  2KWN A;  4GNE A;  1LDK C;  2K17 A;  2KR4 A;  3RPG B;  4FJC A;  2XOY A;  5H1T A;  3M7K A;  3SOU A;  2MD7 B;  5H1V A;  2HDP A;  4UP5 A;  2EGP A;  3GV4 A;  4WZ3 B;  3N9O A;  1VYX A;  5TBN A;  2CRW A;  5LKU A;  1X4J A;  4R8P K;  2F42 A;  2AN6 A;  2L0B A;  3I2D A;  2KGI A;  4W4U A;  5C13 A;  2L7P A;  3SOW A;  2VJE A;  5FB0 A;  2JM3 A;  4IC2 A;  2K16 A;  4V3L C;  5G05 B;  5TDW A;  2IQJ A;  4IC3 A;  4XI1 A;  4N3W A;  5FB1 A;  3U5O A;  1VD4 A;  4Z0R A;  3E2D A;  3GL6 A;  3O37 A;  3JUE A;  4S3O C;  2YUR A;  2LXP C;  2LGG A;  2RSD A;  1Z60 A;  3ZTG A;  3HCU A;  2YQM A;  2JMJ A;  2KIZ A;  1JM7 B;  3KV6 A;  5FEY A;  5TAB A;  4YAT A;  2JRJ A;  3ZPV 1;  2DSM A;  2D8U A;  2K1J A;  4R7E A;  5JG6 A;  2XB1 A;  5LKT A;  1V87 A;  2QIZ A;  2EXU A;  2DJA A;  3LRQ A;  2EOD A;  2LXH C;  1WFK A;  4OGC A;  5D1L B;  1BOR A;  1Z6U A;  2F6J A;  5EYA F;  2KFT A;  1WEO A;  2E6R A;  4B86 C;  4LKA A;  3SOX A;  4F52 B;  2I50 A;  5SVI B;  4AYC A;  1CHC A;  2H0D B;  5SVX A;  2E6S A;  1WGM A;  2CRR A;  2YRE A;  2L80 A;  1WIM A;  3ZVZ B;  5H9M A;  3HCS A;  4ZDT A;  3ZVY A;  1WES A;  2EGM A;  4I7C A;  5TRB A;  4B7Y C;  2CKL A;  2QIC A;  3LVQ E;  5LKX A;  3M99 A;  2YHN A;  2L5U A;  2YT5 A;  3T9K A;  4CA1 A;  2KGG A;  4AUQ B;  3KQI A;  2OXQ C;  4MSX A;  5DKA A;  3T6R A;  2YSM A;  4OGE A;  5B77 A;  5K3Q A;  5B76 A;  5G04 B;  4O62 A;  2B0O E;  2YVR A;  4QQ4 A;  3LQI A;  2OWA A;  3LQJ A;  4Q6F A;  1LDJ B;  4YAX A;  5B78 A;  3H7H A;  2KWO A;  1MM3 A;  3U5N A;  4LAD B;  3O33 A;  2XP0 A;  2CT2 A;  2VP7 A;  5AIU A;  3V43 A;  4YAB A;  1VFY A;  2FUI A;  1K2F A;  3O47 A;  2HYE D;  2VJF B;  4V3K C;  4F1P A;  4PTB A;  4UP0 A;  3FEH A;  2MIQ A;  3LVR E;  4LLB A;  1MM2 A;  1T1H A;  4GNG A;  5C11 A;  2FD4 A;  2Y1N A;  4FO9 A;  2LRI C;  3U5P A;  2RR4 A;  3VK6 A;  2M85 A;  3DQV R;  3PHD A;  3L1X A;  1X4I A;  2NAA A;  2ECW A;  3M63 A;  4R2Y A;  2RI7 A;  2LAU A;  2YU4 A;  1G25 A;  2M6M A;  2C2L A;  2MNY A;  3PLW A;  2FFW A;  2LN0 A;  3RTR B;  3LJU X;  2M13 A;  3O36 A;  3KDE C;  4AP4 A;  4FK5 A;  3RPG C;  4A4C A;  5LCW B;  3SHB A;  4A0C D;  2MUM A;  4PPE A;  2JMI A;  4TKP B;  3FL2 A;  2XEU A;  4L58 A;  2LGK A;  1ZBD B;  2LGV A;  2VNF A;  1JOC A;  3O34 A;  1RMD A;  3QZV A;  1WEN A;  3DPL R;  3N9Q A;  3N9M A;  2FUU A;  5AIT A;  1N87 A;  2ECT A;  2CSY A;  4A4B A;  2UZG A;  3SUB A;  5FER A;  4LJN A;  1JM7 A;  2YYR A;  2PUY A;  2KKY A;  2MKE A;  3KNV A;  3N9N A;  4GB0 A;  4S3O B;  5SVY A;  3NG2 A;  1U6G B;  3LDY A;  1DCQ A;  5KH7 A;  3FAO A;  4I7B A;  2MT5 A;  2MD8 C;  4MVT A;  4CCG X;  2KU3 A;  3DDT A;  1WEP A;  5D1M B;  2VJE B;  2ECG A;  3ZPV E;  1HYJ A;  3FM8 C;  3L11 A;  2YHO A;  2ECN A;  5D1K B;  2ECJ A;  1HYI A;  2ECI A;  4YBM A;  4BBQ A;  2P57 A;  3L1Z B;  2YUC A;  4GNF A;  3ZYQ A;  1F62 A;  5SVI A;  4BHW A;  2VPE A;  2C2V S;  2H0D A;  4ZQL A;  5TDR A;  4X3G A;  2EA6 A;  2QJ0 A;  4ZUX U;  2CSZ A;  3U5M A;  2CON A;  3PUQ A;  2M3H A;  2E61 A;  2XOC A;  4YAD A;  4YBT A;  3KV5 A;  2F6N A;  2FSA A;  2LV9 A;  2D8S A;  4WZ0 A;  4FIP A;  5DIN A;  2CSV A;  3HCT A;  2YSJ A;  4P5O B;  3EB5 A;  3O70 A;  1WEW A;  3N9P A;  5I3L A;  3O7A A;  2G6Q A;  2K4D A;  2G45 A;  1MBM A;  2YQL A;  2KWJ A;  1DVP A;  2MNZ A;  4UI9 B;  1XWH A;  1WEU A;  2VPB A;  4A49 A;  4LK9 A;  5H1U A;  3ZNI A;  2VPD A;  4AYC B;  3C5K A;  1E4U A;  4NN2 A;  2IDA A;  1WEE A;  2KE1 A;  3T7L A;  3MHH A;  2XOZ A;  1IYM A;  4WZ2 A;  1FBV A;  2KKX A;  3FJU B;  3PUR A;  2BAY A;  2MA5 A;  3MHS A;  4YC9 A;  2LQ6 A;  1FP0 A;  1WEV A;  4AVX A;  2L75 A;  2Y43 A;  2CKL B;  3M62 A;  2VJF A;  2ECV A;  4GND A;  5KH9 A;  5G0F A;  2PNX A;  1X4U A;  2L43 A;  4C9Z A;  4QF2 A;  3ASL A;  2Y1M A;  3LQH A;  2LDR A;  1WE9 A;  2DX8 A;  3C6W A;  4YBS A;  4I7D A;  5KH3 A;  2MA6 A;  5B8D A;  2KYU A;  1WEM A;  2M1R A;  4H9D A;  5B79 A;  3IHP A;  2YW8 A;  3N9L A;  3MDB C;  4Z0O A;  5LKZ A;  4N4F A;  4WA6 A;  4O64 A;  5B75 A;  3HTK C;  2JUN A;  3FAN A;  1WEQ A; 
#chains in the Genus database with same CATH homology
 1Z2Q A;  2LGL A;  2ZET C;  2JMD A;  4QF3 A;  2KWK A;  4L7X A;  2G43 A;  1WIL A;  3O35 A;  2VPG A;  3EB6 A;  5J3X A;  2KRE A;  2KWN A;  4GNE A;  1LDK C;  2K17 A;  2KR4 A;  3RPG B;  4FJC A;  5H1T A;  3SOU A;  2MD7 B;  5H1V A;  2HDP A;  4UP5 A;  2EGP A;  3GV4 A;  4WZ3 B;  3N9O A;  1VYX A;  5TBN A;  5LKU A;  1X4J A;  4R8P K;  2F42 A;  2AN6 A;  2L0B A;  3I2D A;  2KGI A;  4W4U A;  5C13 A;  3SOW A;  2VJE A;  5FB0 A;  4IC2 A;  2K16 A;  4V3L C;  5G05 B;  5TDW A;  4IC3 A;  4XI1 A;  4N3W A;  5FB1 A;  3U5O A;  1VD4 A;  3GL6 A;  3O37 A;  4S3O C;  2YUR A;  2LXP C;  2LGG A;  2RSD A;  1Z60 A;  3ZTG A;  3HCU A;  2YQM A;  2JMJ A;  2KIZ A;  1JM7 B;  3KV6 A;  5FEY A;  5TAB A;  4YAT A;  2JRJ A;  3ZPV 1;  2K1J A;  4R7E A;  5JG6 A;  2XB1 A;  5LKT A;  1V87 A;  2QIZ A;  3LRQ A;  2EOD A;  2LXH C;  1WFK A;  5D1L B;  1BOR A;  1Z6U A;  2F6J A;  5EYA F;  2KFT A;  1WEO A;  2E6R A;  4B86 C;  4LKA A;  3SOX A;  4F52 B;  2I50 A;  4AYC A;  1CHC A;  2H0D B;  2E6S A;  1WGM A;  2YRE A;  2L80 A;  1WIM A;  3ZVZ B;  5H9M A;  3HCS A;  4ZDT A;  3ZVY A;  1WES A;  4I7C A;  5TRB A;  4B7Y C;  2CKL A;  2QIC A;  5LKX A;  3M99 A;  2YHN A;  2L5U A;  2YT5 A;  4CA1 A;  2KGG A;  4AUQ B;  3KQI A;  2OXQ C;  4MSX A;  5DKA A;  3T6R A;  2YSM A;  5B77 A;  5B76 A;  5G04 B;  3LQI A;  3LQJ A;  4Q6F A;  1LDJ B;  4YAX A;  5B78 A;  2KWO A;  1MM3 A;  3U5N A;  4LAD B;  3O33 A;  2CT2 A;  2VP7 A;  5AIU A;  3V43 A;  4YAB A;  1VFY A;  2FUI A;  1K2F A;  2HYE D;  2VJF B;  4V3K C;  4PTB A;  4UP0 A;  2MIQ A;  4LLB A;  1MM2 A;  1T1H A;  4GNG A;  5C11 A;  2Y1N A;  4FO9 A;  2LRI C;  3U5P A;  3VK6 A;  2M85 A;  3DQV R;  3PHD A;  3L1X A;  1X4I A;  2NAA A;  2ECW A;  3M63 A;  4R2Y A;  2RI7 A;  2YU4 A;  1G25 A;  2M6M A;  2C2L A;  2MNY A;  2LN0 A;  3RTR B;  3O36 A;  4AP4 A;  4FK5 A;  3RPG C;  4A4C A;  5LCW B;  3SHB A;  4A0C D;  2MUM A;  4PPE A;  2JMI A;  4TKP B;  3FL2 A;  2XEU A;  4L58 A;  2LGK A;  1ZBD B;  2LGV A;  2VNF A;  1JOC A;  3O34 A;  1RMD A;  3QZV A;  1WEN A;  3DPL R;  3N9Q A;  3N9M A;  2FUU A;  5AIT A;  1N87 A;  2ECT A;  2CSY A;  4A4B A;  2UZG A;  5FER A;  4LJN A;  1JM7 A;  2YYR A;  2PUY A;  3KNV A;  3N9N A;  4GB0 A;  4S3O B;  3NG2 A;  1U6G B;  5KH7 A;  4I7B A;  2MT5 A;  2MD8 C;  4MVT A;  4CCG X;  2KU3 A;  1WEP A;  5D1M B;  2VJE B;  2ECG A;  3ZPV E;  1HYJ A;  3L11 A;  2YHO A;  2ECN A;  5D1K B;  2ECJ A;  1HYI A;  2ECI A;  4YBM A;  4BBQ A;  3L1Z B;  2YUC A;  4GNF A;  3ZYQ A;  1F62 A;  4BHW A;  2VPE A;  2C2V S;  2H0D A;  4ZQL A;  5TDR A;  4X3G A;  2EA6 A;  2QJ0 A;  4ZUX U;  2CSZ A;  3U5M A;  3PUQ A;  2M3H A;  4YAD A;  4YBT A;  3KV5 A;  2F6N A;  2FSA A;  2LV9 A;  2D8S A;  4WZ0 A;  4FIP A;  5DIN A;  3HCT A;  2YSJ A;  4P5O B;  3EB5 A;  3O70 A;  1WEW A;  3N9P A;  5I3L A;  3O7A A;  2G6Q A;  2K4D A;  2G45 A;  2YQL A;  2KWJ A;  1DVP A;  2MNZ A;  4UI9 B;  1XWH A;  1WEU A;  2VPB A;  4A49 A;  4LK9 A;  5H1U A;  3ZNI A;  2VPD A;  4AYC B;  3C5K A;  1E4U A;  4NN2 A;  2IDA A;  1WEE A;  2KE1 A;  3T7L A;  3MHH A;  1IYM A;  4WZ2 A;  1FBV A;  3PUR A;  2BAY A;  2MA5 A;  3MHS A;  4YC9 A;  2LQ6 A;  1FP0 A;  1WEV A;  4AVX A;  2L75 A;  2Y43 A;  2CKL B;  3M62 A;  2VJF A;  2ECV A;  4GND A;  5KH9 A;  5G0F A;  2PNX A;  1X4U A;  2L43 A;  4C9Z A;  4QF2 A;  3ASL A;  2Y1M A;  3LQH A;  2LDR A;  1WE9 A;  2DX8 A;  3C6W A;  4YBS A;  4I7D A;  5KH3 A;  2MA6 A;  5B8D A;  2KYU A;  1WEM A;  2M1R A;  5B79 A;  3IHP A;  2YW8 A;  3N9L A;  5LKZ A;  4N4F A;  4WA6 A;  4O64 A;  5B75 A;  3HTK C;  1WEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...