3RPGC

Bmi1/ring1b-ubch5c complex structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
TWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 D3
publication title Recognition of UbcH5c and the nucleosome by the Bmi1/Ring1b ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 17
structure length 101
sequence length 101
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3rpgC01
4P5OB 3N9PA 2FSAA 3SOWA 2ECIA 4N3WA 4LJNA 4WZ2A 3O36A 2G43A 3PURA 2JMIA 5C13A 3ZVZB 4A4BA 4FK5A 2OXQC 2FUUA 2LGLA 4YBSA 4B7YC 2ECNA 2UZGA 4V3LC 4X3GA 3L1XA 3NG2A 5B75A 2G6QA 5FB0A 5FB1A 5D1LB 5KH9A 2FUIA 4FJCA 2MT5A 4WA6A 4BBQA 2IDAA 2KWKA 5FEYA 4YC9A 2MD8C 2LDRA 2VP7A 2MA5A 4YADA 4MSXA 3EB6A 1RMDA 4AUQB 2VJFA 4XI1A 5TABA 3C5KA 1WENA 5H1UA 4CCGX 4QF3A 2KWJA 3RPGC 2CSYA 2LRIC 2VJEA 2CKLB 3LQJA 2MD7B 4I7CA 1F62A 1JM7B 2M6MA 2M3HA 1WEPA 4YATA 5DKAA 3HTKC 2KREA 3KV5A 3KNVA 2RI7A 3RPGB 4MVTA 3ZYQA 3KV6A 5KH7A 1U6GB 2PNXA 3O33A 2ECJA 4C9ZA 3DPLR 2Y1NA 4ZDTA 1VD4A 2KR4A 5D1KB 2EGPA 2YURA 3M62A 3HCTA 2YHOA 2VPEA 2YU4A 5H9MA 2ECTA 2ECWA 5B76A 3LQHA 2KIZA 5TDWA 5B8DA 2VNFA 3N9LA 2QIZA 3C6WA 5D1MB 2LXHC 2L0BA 4LADB 2YQMA 2K4DA 1T1HA 3ZPV1 5LKUA 4AVXA 3ASLA 1VFYA 5B79A 3GL6A 4UP0A 4YAXA 1IYMA 1JOCA 4GNFA 4O64A 2L80A 4IC2A 3QZVA 2QJ0A 2KYUA 4AP4A 1VYXA 2LV9A 2ECVA 3ZPVE 2YW8A 5LCWB 3MHHA 3O7AA 3ZVYA 4CA1A 2YT5A 3KQIA 1WE9A 2M1RA 2I50A 4GNDA 3PUQA 5AITA 2F6JA 3U5OA 2C2LA 4L7XA 4LKAA 1WEMA 1LDJB 4S3OB 2K16A 3SOXA 2AN6A 2PUYA 2JMDA 2YREA 1WESA 2KFTA 1N87A 3V43A 3IHPA 4AYCB 3N9QA 2YSJA 3T6RA 5KH3A 5G05B 4UI9B 1FBVA 1X4JA 4I7DA 2Y1MA 3N9OA 3U5NA 3O70A 3HCSA 2F6NA 5J3XA 5DINA 4IC3A 4V3KC 2CT2A 4LK9A 4PTBA 2KU3A 3RTRB 4PPEA 2YHNA 3O35A 2VPBA 1Z6UA 3MHSA 1Z2QA 4YABA 2H0DB 4I7BA 2BAYA 3LQIA 1X4IA 2LN0A 3PHDA 4A49A 4LLBA 2ZETC 4W4UA 2LXPC 4Q6FA 1MM2A 3SHBA 2LGVA 4ZUXU 2CKLA 3I2DA 1LDKC 2KE1A 1JM7A 2MNZA 5B78A 2LQ6A 1XWHA 4GNGA 2MIQA 3U5PA 4GB0A 2E6RA 1WEOA 2YUCA 5H1TA 5AIUA 5JG6A 2M85A 4ZQLA 4R8PK 2VPDA 2VJFB 4YBTA 2E6SA 4F52B 3HCUA 3M99A 2F42A 4WZ3B 2H0DA 1WFKA 2KGGA 1Z60A 2VJEB 4R7EA 4S3OC 2JRJA 1FP0A 2XEUA 3LRQA 4A4CA 1G25A 2L43A 1WGMA 2XB1A 2MNYA 3M63A 3DQVR 1E4UA 1WILA 3T7LA 1HYJA 1CHCA 2KWOA 4NN2A 2KWNA 1WEVA 2MA6A 3ZNIA 1WEQA 2NAAA 5EYAF 3SOUA 3ZTGA 4FO9A 5I3LA 1BORA 5G04B 1K2FA 2MUMA 1MM3A 2Y43A 4QF2A 4YBMA 4WZ0A 3FL2A 2JMJA 2CSZA 5C11A 1HYIA 5H1VA 5LKTA 5TBNA 3O37A 2YQLA 2HYED 4B86C 2KGIA 5TRBA 4BHWA 1WEUA 1X4UA 4TKPB 2K17A 3EB5A 3U5MA 2LGGA 2L75A 2EA6A 5B77A 2RSDA 3L1ZB 2LGKA 4L58A 3O34A 2DX8A 1WIMA 2G45A 5LKXA 4FIPA 2D8SA 2YSMA 3L11A 2YYRA 1V87A 3N9MA 1WEWA 2C2VS 3GV4A 4A0CD 1ZBDB 2L5UA 4N4FA 3N9NA 1WEEA 2ECGA 4AYCA 1DVPA 5LKZA 2K1JA 5TDRA 2EODA 3VK6A 2VPGA 2QICA 5G0FA 4R2YA 4UP5A 4GNEA 5FERA 2HDPA
chains in the Genus database with same CATH superfamily
2CRRA 5SVYA 4P5OB 3N9PA 3FEHA 2FSAA 3SOWA 2ECIA 4N3WA 4LJNA 4WZ2A 3O36A 3LJUX 2G43A 3PURA 2JMIA 5C13A 3ZVZB 4A4BA 3E2DA 4FK5A 2OXQC 2FUUA 2LGLA 4YBSA 4B7YC 2ECNA 2UZGA 4V3LC 4X3GA 2XOYA 3L1XA 3NG2A 5B75A 2G6QA 5FB0A 2IQJA 5FB1A 5D1LB 5KH9A 2FUIA 4FJCA 2MT5A 4WA6A 4BBQA 2IDAA 2KWKA 3LDYA 5FEYA 4YC9A 3DDTA 2MD8C 2JM3A 3PLWA 2FFWA 2LDRA 2VP7A 2MA5A 4YADA 4MSXA 4F1PA 3EB6A 1RMDA 4AUQB 2VJFA 2MKEA 4XI1A 5TABA 3C5KA 1WENA 5H1UA 4CCGX 4QF3A 2KWJA 3RPGC 2CSYA 2LRIC 2VJEA 2CKLB 3LQJA 2MD7B 4I7CA 1F62A 1JM7B 3H7HA 2M6MA 2D8UA 2M3HA 1WEPA 2DSMA 4YATA 5DKAA 3HTKC 2KREA 3KV5A 3KNVA 2RI7A 3RPGB 4MVTA 3ZYQA 3KV6A 5KH7A 1U6GB 2PNXA 3O33A 2ECJA 4C9ZA 3DPLR 2Y1NA 4ZDTA 1VD4A 2KR4A 5D1KB 2EGPA 2YURA 3M62A 3HCTA 2DJAA 2YHOA 2YVRA 2VPEA 2YU4A 5H9MA 2ECTA 2ECWA 5B76A 3LQHA 2KIZA 5TDWA 5B8DA 2VNFA 5SVIB 3N9LA 2QIZA 3C6WA 5D1MB 2LXHC 2L0BA 4LADB 2YQMA 2K4DA 1T1HA 3ZPV1 5LKUA 4AVXA 3ASLA 1VFYA 5B79A 3GL6A 4UP0A 4YAXA 1IYMA 1JOCA 1DCQA 4GNFA 4O64A 2L80A 4IC2A 4H9DA 3QZVA 3T9KA 2QJ0A 2KYUA 3DWDA 3LVQE 4AP4A 1VYXA 2LV9A 2ECVA 3ZPVE 2YW8A 5LCWB 2KKYA 3MHHA 3O7AA 3ZVYA 4CA1A 2YT5A 3KQIA 2JUNA 1WE9A 2M1RA 2I50A 2M13A 4GNDA 3PUQA 5AITA 2F6JA 3U5OA 2C2LA 4L7XA 4LKAA 1WEMA 1LDJB 4S3OB 2K16A 3SOXA 4OGCA 3JUEA 2AN6A 2PUYA 2JMDA 2YREA 1WESA 2KFTA 1N87A 3V43A 3IHPA 4AYCB 3N9QA 2YSJA 3T6RA 3LVRE 2L7PA 5KH3A 5G05B 4UI9B 1FBVA 1X4JA 4I7DA 2Y1MA 3N9OA 3U5NA 3MDBC 3O70A 3HCSA 2F6NA 5J3XA 5DINA 4IC3A 4V3KC 2KKXA 2CT2A 4LK9A 4PTBA 2EGMA 2KU3A 3RTRB 4O62A 4PPEA 2YHNA 3O35A 2VPBA 1Z6UA 3MHSA 1Z2QA 4YABA 2H0DB 3M7KA 4I7BA 2RR4A 2BAYA 2CSVA 3LQIA 1X4IA 2LN0A 2OWAA 3PHDA 4A49A 4LLBA 2XOZA 2ZETC 4W4UA 2P57A 2LXPC 4Q6FA 1MM2A 3SHBA 2LGVA 4ZUXU 4Z0OA 2CKLA 3I2DA 1LDKC 2KE1A 1JM7A 2MNZA 5B78A 2LQ6A 3FJUB 1XWHA 4GNGA 2MIQA 3U5PA 4GB0A 2E6RA 5K3QA 1WEOA 3Q1DA 2YUCA 5H1TA 5AIUA 5JG6A 2M85A 4ZQLA 3KDEC 4R8PK 2VPDA 2VJFB 4YBTA 2E6SA 4QQ4A 4F52B 3HCUA 3M99A 2F42A 4WZ3B 2H0DA 1WFKA 2KGGA 1Z60A 2VJEB 4R7EA 4S3OC 2JRJA 5SVIA 1FP0A 2XEUA 3LRQA 4A4CA 2E61A 1G25A 2L43A 1WGMA 2XB1A 2MNYA 3M63A 3DQVR 1E4UA 1WILA 3T7LA 1HYJA 1CHCA 2KWOA 4NN2A 2KWNA 1WEVA 2MA6A 3ZNIA 4OGEA 1WEQA 2NAAA 5EYAF 3O47A 3SOUA 3ZTGA 2CRWA 4FO9A 5I3LA 1BORA 5G04B 2XP0A 2EXUA 1K2FA 2MUMA 1MM3A 2Y43A 4QF2A 4YBMA 3FANA 2LAUA 4WZ0A 3FL2A 3FM8C 2JMJA 2CSZA 5C11A 1HYIA 5H1VA 5SVXA 5LKTA 5TBNA 3O37A 2YQLA 2HYED 4B86C 2KGIA 5TRBA 1MBMA 4BHWA 1WEUA 3FAOA 1X4UA 4TKPB 2K17A 3EB5A 3U5MA 2LGGA 2L75A 2EA6A 5B77A 2RSDA 3L1ZB 2LGKA 4L58A 3SUBA 3O34A 2DX8A 1WIMA 2XOCA 2G45A 5LKXA 4FIPA 2D8SA 2YSMA 3L11A 2YYRA 1V87A 3N9MA 1WEWA 2C2VS 3GV4A 4A0CD 1ZBDB 2L5UA 4N4FA 3N9NA 1WEEA 2ECGA 4AYCA 2B0OE 1DVPA 5LKZA 2K1JA 5TDRA 2EODA 3VK6A 2CONA 2VPGA 2QICA 5G0FA 2FD4A 4R2YA 4Z0RA 4UP5A 4GNEA 5FERA 2HDPA
chains in the Genus database with same CATH topology
4P5OB 3N9PA 2FSAA 3SOWA 2ECIA 4N3WA 4LJNA 4WZ2A 3O36A 2G43A 3PURA 2JMIA 5C13A 3ZVZB 4A4BA 4FK5A 2OXQC 2FUUA 2LGLA 4YBSA 4B7YC 2ECNA 2UZGA 4V3LC 4X3GA 3L1XA 3NG2A 5B75A 2G6QA 5FB0A 5FB1A 5D1LB 5KH9A 2FUIA 4FJCA 2MT5A 4WA6A 4BBQA 2IDAA 2KWKA 5FEYA 4YC9A 2MD8C 2LDRA 2VP7A 2MA5A 4YADA 4MSXA 3EB6A 1RMDA 4AUQB 2VJFA 4XI1A 5TABA 3C5KA 1WENA 5H1UA 4CCGX 4QF3A 2KWJA 3RPGC 2CSYA 2LRIC 2VJEA 2CKLB 3LQJA 2MD7B 4I7CA 1F62A 1JM7B 2M6MA 2M3HA 1WEPA 4YATA 5DKAA 3HTKC 2KREA 3KV5A 3KNVA 2RI7A 3RPGB 4MVTA 3ZYQA 3KV6A 5KH7A 1U6GB 2PNXA 3O33A 2ECJA 4C9ZA 3DPLR 2Y1NA 4ZDTA 1VD4A 2KR4A 5D1KB 2EGPA 2YURA 3M62A 3HCTA 2YHOA 2VPEA 2YU4A 5H9MA 2ECTA 2ECWA 5B76A 3LQHA 2KIZA 5TDWA 5B8DA 2VNFA 3N9LA 2QIZA 3C6WA 5D1MB 2LXHC 2L0BA 4LADB 2YQMA 2K4DA 1T1HA 3ZPV1 5LKUA 4AVXA 3ASLA 1VFYA 5B79A 3GL6A 4UP0A 4YAXA 1IYMA 1JOCA 4GNFA 4O64A 2L80A 4IC2A 3QZVA 2QJ0A 2KYUA 4AP4A 1VYXA 2LV9A 2ECVA 3ZPVE 2YW8A 5LCWB 3MHHA 3O7AA 3ZVYA 4CA1A 2YT5A 3KQIA 1WE9A 2M1RA 2I50A 4GNDA 3PUQA 5AITA 2F6JA 3U5OA 2C2LA 4L7XA 4LKAA 1WEMA 1LDJB 4S3OB 2K16A 3SOXA 2AN6A 2PUYA 2JMDA 2YREA 1WESA 2KFTA 1N87A 3V43A 3IHPA 4AYCB 3N9QA 2YSJA 3T6RA 5KH3A 5G05B 4UI9B 1FBVA 1X4JA 4I7DA 2Y1MA 3N9OA 3U5NA 3O70A 3HCSA 2F6NA 5J3XA 5DINA 4IC3A 4V3KC 2CT2A 4LK9A 4PTBA 2KU3A 3RTRB 4PPEA 2YHNA 3O35A 2VPBA 1Z6UA 3MHSA 1Z2QA 4YABA 2H0DB 4I7BA 2BAYA 3LQIA 1X4IA 2LN0A 3PHDA 4A49A 4LLBA 2ZETC 4W4UA 2LXPC 4Q6FA 1MM2A 3SHBA 2LGVA 4ZUXU 2CKLA 3I2DA 1LDKC 2KE1A 1JM7A 2MNZA 5B78A 2LQ6A 1XWHA 4GNGA 2MIQA 3U5PA 4GB0A 2E6RA 1WEOA 2YUCA 5H1TA 5AIUA 5JG6A 2M85A 4ZQLA 4R8PK 2VPDA 2VJFB 4YBTA 2E6SA 4F52B 3HCUA 3M99A 2F42A 4WZ3B 2H0DA 1WFKA 2KGGA 1Z60A 2VJEB 4R7EA 4S3OC 2JRJA 1FP0A 2XEUA 3LRQA 4A4CA 1G25A 2L43A 1WGMA 2XB1A 2MNYA 3M63A 3DQVR 1E4UA 1WILA 3T7LA 1HYJA 1CHCA 2KWOA 4NN2A 2KWNA 1WEVA 2MA6A 3ZNIA 1WEQA 2NAAA 5EYAF 3SOUA 3ZTGA 4FO9A 5I3LA 1BORA 5G04B 1K2FA 2MUMA 1MM3A 2Y43A 4QF2A 4YBMA 4WZ0A 3FL2A 2JMJA 2CSZA 5C11A 1HYIA 5H1VA 5LKTA 5TBNA 3O37A 2YQLA 2HYED 4B86C 2KGIA 5TRBA 4BHWA 1WEUA 1X4UA 4TKPB 2K17A 3EB5A 3U5MA 2LGGA 2L75A 2EA6A 5B77A 2RSDA 3L1ZB 2LGKA 4L58A 3O34A 2DX8A 1WIMA 2G45A 5LKXA 4FIPA 2D8SA 2YSMA 3L11A 2YYRA 1V87A 3N9MA 1WEWA 2C2VS 3GV4A 4A0CD 1ZBDB 2L5UA 4N4FA 3N9NA 1WEEA 2ECGA 4AYCA 1DVPA 5LKZA 2K1JA 5TDRA 2EODA 3VK6A 2VPGA 2QICA 5G0FA 4R2YA 4UP5A 4GNEA 5FERA 2HDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5O B;  3N9P A;  2FSA A;  3SOW A;  2ECI A;  4N3W A;  4LJN A;  4WZ2 A;  3O36 A;  2G43 A;  3PUR A;  2JMI A;  5C13 A;  3ZVZ B;  4A4B A;  4FK5 A;  2OXQ C;  2FUU A;  2LGL A;  4YBS A;  4B7Y C;  2ECN A;  2UZG A;  4V3L C;  4X3G A;  3L1X A;  3NG2 A;  5B75 A;  2G6Q A;  5FB0 A;  5FB1 A;  5D1L B;  5KH9 A;  2FUI A;  4FJC A;  2MT5 A;  4WA6 A;  4BBQ A;  2IDA A;  2KWK A;  5FEY A;  4YC9 A;  2MD8 C;  2LDR A;  2VP7 A;  2MA5 A;  4YAD A;  4MSX A;  3EB6 A;  1RMD A;  4AUQ B;  2VJF A;  4XI1 A;  5TAB A;  3C5K A;  1WEN A;  5H1U A;  4CCG X;  4QF3 A;  2KWJ A;  3RPG C;  2CSY A;  2LRI C;  2VJE A;  2CKL B;  3LQJ A;  2MD7 B;  4I7C A;  1F62 A;  1JM7 B;  2M6M A;  2M3H A;  1WEP A;  4YAT A;  5DKA A;  3HTK C;  2KRE A;  3KV5 A;  3KNV A;  2RI7 A;  3RPG B;  4MVT A;  3ZYQ A;  3KV6 A;  5KH7 A;  1U6G B;  2PNX A;  3O33 A;  2ECJ A;  4C9Z A;  3DPL R;  2Y1N A;  4ZDT A;  1VD4 A;  2KR4 A;  5D1K B;  2EGP A;  2YUR A;  3M62 A;  3HCT A;  2YHO A;  2VPE A;  2YU4 A;  5H9M A;  2ECT A;  2ECW A;  5B76 A;  3LQH A;  2KIZ A;  5TDW A;  5B8D A;  2VNF A;  3N9L A;  2QIZ A;  3C6W A;  5D1M B;  2LXH C;  2L0B A;  4LAD B;  2YQM A;  2K4D A;  1T1H A;  3ZPV 1;  5LKU A;  4AVX A;  3ASL A;  1VFY A;  5B79 A;  3GL6 A;  4UP0 A;  4YAX A;  1IYM A;  1JOC A;  4GNF A;  4O64 A;  2L80 A;  4IC2 A;  3QZV A;  2QJ0 A;  2KYU A;  4AP4 A;  1VYX A;  2LV9 A;  2ECV A;  3ZPV E;  2YW8 A;  5LCW B;  3MHH A;  3O7A A;  3ZVY A;  4CA1 A;  2YT5 A;  3KQI A;  1WE9 A;  2M1R A;  2I50 A;  4GND A;  3PUQ A;  5AIT A;  2F6J A;  3U5O A;  2C2L A;  4L7X A;  4LKA A;  1WEM A;  1LDJ B;  4S3O B;  2K16 A;  3SOX A;  2AN6 A;  2PUY A;  2JMD A;  2YRE A;  1WES A;  2KFT A;  1N87 A;  3V43 A;  3IHP A;  4AYC B;  3N9Q A;  2YSJ A;  3T6R A;  5KH3 A;  5G05 B;  4UI9 B;  1FBV A;  1X4J A;  4I7D A;  2Y1M A;  3N9O A;  3U5N A;  3O70 A;  3HCS A;  2F6N A;  5J3X A;  5DIN A;  4IC3 A;  4V3K C;  2CT2 A;  4LK9 A;  4PTB A;  2KU3 A;  3RTR B;  4PPE A;  2YHN A;  3O35 A;  2VPB A;  1Z6U A;  3MHS A;  1Z2Q A;  4YAB A;  2H0D B;  4I7B A;  2BAY A;  3LQI A;  1X4I A;  2LN0 A;  3PHD A;  4A49 A;  4LLB A;  2ZET C;  4W4U A;  2LXP C;  4Q6F A;  1MM2 A;  3SHB A;  2LGV A;  4ZUX U;  2CKL A;  3I2D A;  1LDK C;  2KE1 A;  1JM7 A;  2MNZ A;  5B78 A;  2LQ6 A;  1XWH A;  4GNG A;  2MIQ A;  3U5P A;  4GB0 A;  2E6R A;  1WEO A;  2YUC A;  5H1T A;  5AIU A;  5JG6 A;  2M85 A;  4ZQL A;  4R8P K;  2VPD A;  2VJF B;  4YBT A;  2E6S A;  4F52 B;  3HCU A;  3M99 A;  2F42 A;  4WZ3 B;  2H0D A;  1WFK A;  2KGG A;  1Z60 A;  2VJE B;  4R7E A;  4S3O C;  2JRJ A;  1FP0 A;  2XEU A;  3LRQ A;  4A4C A;  1G25 A;  2L43 A;  1WGM A;  2XB1 A;  2MNY A;  3M63 A;  3DQV R;  1E4U A;  1WIL A;  3T7L A;  1HYJ A;  1CHC A;  2KWO A;  4NN2 A;  2KWN A;  1WEV A;  2MA6 A;  3ZNI A;  1WEQ A;  2NAA A;  5EYA F;  3SOU A;  3ZTG A;  4FO9 A;  5I3L A;  1BOR A;  5G04 B;  1K2F A;  2MUM A;  1MM3 A;  2Y43 A;  4QF2 A;  4YBM A;  4WZ0 A;  3FL2 A;  2JMJ A;  2CSZ A;  5C11 A;  1HYI A;  5H1V A;  5LKT A;  5TBN A;  3O37 A;  2YQL A;  2HYE D;  4B86 C;  2KGI A;  5TRB A;  4BHW A;  1WEU A;  1X4U A;  4TKP B;  2K17 A;  3EB5 A;  3U5M A;  2LGG A;  2L75 A;  2EA6 A;  5B77 A;  2RSD A;  3L1Z B;  2LGK A;  4L58 A;  3O34 A;  2DX8 A;  1WIM A;  2G45 A;  5LKX A;  4FIP A;  2D8S A;  2YSM A;  3L11 A;  2YYR A;  1V87 A;  3N9M A;  1WEW A;  2C2V S;  3GV4 A;  4A0C D;  1ZBD B;  2L5U A;  4N4F A;  3N9N A;  1WEE A;  2ECG A;  4AYC A;  1DVP A;  5LKZ A;  2K1J A;  5TDR A;  2EOD A;  3VK6 A;  2VPG A;  2QIC A;  5G0F A;  4R2Y A;  4UP5 A;  4GNE A;  5FER A;  2HDP A; 
#chains in the Genus database with same CATH topology
 2CRR A;  5SVY A;  4P5O B;  3N9P A;  3FEH A;  2FSA A;  3SOW A;  2ECI A;  4N3W A;  4LJN A;  4WZ2 A;  3O36 A;  3LJU X;  2G43 A;  3PUR A;  2JMI A;  5C13 A;  3ZVZ B;  4A4B A;  3E2D A;  4FK5 A;  2OXQ C;  2FUU A;  2LGL A;  4YBS A;  4B7Y C;  2ECN A;  2UZG A;  4V3L C;  4X3G A;  2XOY A;  3L1X A;  3NG2 A;  5B75 A;  2G6Q A;  5FB0 A;  2IQJ A;  5FB1 A;  5D1L B;  5KH9 A;  2FUI A;  4FJC A;  2MT5 A;  4WA6 A;  4BBQ A;  2IDA A;  2KWK A;  3LDY A;  5FEY A;  4YC9 A;  3DDT A;  2MD8 C;  2JM3 A;  3PLW A;  2FFW A;  2LDR A;  2VP7 A;  2MA5 A;  4YAD A;  4MSX A;  4F1P A;  3EB6 A;  1RMD A;  4AUQ B;  2VJF A;  2MKE A;  4XI1 A;  5TAB A;  3C5K A;  1WEN A;  5H1U A;  4CCG X;  4QF3 A;  2KWJ A;  3RPG C;  2CSY A;  2LRI C;  2VJE A;  2CKL B;  3LQJ A;  2MD7 B;  4I7C A;  1F62 A;  1JM7 B;  3H7H A;  2M6M A;  2D8U A;  2M3H A;  1WEP A;  2DSM A;  4YAT A;  5DKA A;  3HTK C;  2KRE A;  3KV5 A;  3KNV A;  2RI7 A;  3RPG B;  4MVT A;  3ZYQ A;  3KV6 A;  5KH7 A;  1U6G B;  2PNX A;  3O33 A;  2ECJ A;  4C9Z A;  3DPL R;  2Y1N A;  4ZDT A;  1VD4 A;  2KR4 A;  5D1K B;  2EGP A;  2YUR A;  3M62 A;  3HCT A;  2DJA A;  2YHO A;  2YVR A;  2VPE A;  2YU4 A;  5H9M A;  2ECT A;  2ECW A;  5B76 A;  3LQH A;  2KIZ A;  5TDW A;  5B8D A;  2VNF A;  5SVI B;  3N9L A;  2QIZ A;  3C6W A;  5D1M B;  2LXH C;  2L0B A;  4LAD B;  2YQM A;  2K4D A;  1T1H A;  3ZPV 1;  5LKU A;  4AVX A;  3ASL A;  1VFY A;  5B79 A;  3GL6 A;  4UP0 A;  4YAX A;  1IYM A;  1JOC A;  1DCQ A;  4GNF A;  4O64 A;  2L80 A;  4IC2 A;  4H9D A;  3QZV A;  3T9K A;  2QJ0 A;  2KYU A;  3DWD A;  3LVQ E;  4AP4 A;  1VYX A;  2LV9 A;  2ECV A;  3ZPV E;  2YW8 A;  5LCW B;  2KKY A;  3MHH A;  3O7A A;  3ZVY A;  4CA1 A;  2YT5 A;  3KQI A;  2JUN A;  1WE9 A;  2M1R A;  2I50 A;  2M13 A;  4GND A;  3PUQ A;  5AIT A;  2F6J A;  3U5O A;  2C2L A;  4L7X A;  4LKA A;  1WEM A;  1LDJ B;  4S3O B;  2K16 A;  3SOX A;  4OGC A;  3JUE A;  2AN6 A;  2PUY A;  2JMD A;  2YRE A;  1WES A;  2KFT A;  1N87 A;  3V43 A;  3IHP A;  4AYC B;  3N9Q A;  2YSJ A;  3T6R A;  3LVR E;  2L7P A;  5KH3 A;  5G05 B;  4UI9 B;  1FBV A;  1X4J A;  4I7D A;  2Y1M A;  3N9O A;  3U5N A;  3MDB C;  3O70 A;  3HCS A;  2F6N A;  5J3X A;  5DIN A;  4IC3 A;  4V3K C;  2KKX A;  2CT2 A;  4LK9 A;  4PTB A;  2EGM A;  2KU3 A;  3RTR B;  4O62 A;  4PPE A;  2YHN A;  3O35 A;  2VPB A;  1Z6U A;  3MHS A;  1Z2Q A;  4YAB A;  2H0D B;  3M7K A;  4I7B A;  2RR4 A;  2BAY A;  2CSV A;  3LQI A;  1X4I A;  2LN0 A;  2OWA A;  3PHD A;  4A49 A;  4LLB A;  2XOZ A;  2ZET C;  4W4U A;  2P57 A;  2LXP C;  4Q6F A;  1MM2 A;  3SHB A;  2LGV A;  4ZUX U;  4Z0O A;  2CKL A;  3I2D A;  1LDK C;  2KE1 A;  1JM7 A;  2MNZ A;  5B78 A;  2LQ6 A;  3FJU B;  1XWH A;  4GNG A;  2MIQ A;  3U5P A;  4GB0 A;  2E6R A;  5K3Q A;  1WEO A;  3Q1D A;  2YUC A;  5H1T A;  5AIU A;  5JG6 A;  2M85 A;  4ZQL A;  3KDE C;  4R8P K;  2VPD A;  2VJF B;  4YBT A;  2E6S A;  4QQ4 A;  4F52 B;  3HCU A;  3M99 A;  2F42 A;  4WZ3 B;  2H0D A;  1WFK A;  2KGG A;  1Z60 A;  2VJE B;  4R7E A;  4S3O C;  2JRJ A;  5SVI A;  1FP0 A;  2XEU A;  3LRQ A;  4A4C A;  2E61 A;  1G25 A;  2L43 A;  1WGM A;  2XB1 A;  2MNY A;  3M63 A;  3DQV R;  1E4U A;  1WIL A;  3T7L A;  1HYJ A;  1CHC A;  2KWO A;  4NN2 A;  2KWN A;  1WEV A;  2MA6 A;  3ZNI A;  4OGE A;  1WEQ A;  2NAA A;  5EYA F;  3O47 A;  3SOU A;  3ZTG A;  2CRW A;  4FO9 A;  5I3L A;  1BOR A;  5G04 B;  2XP0 A;  2EXU A;  1K2F A;  2MUM A;  1MM3 A;  2Y43 A;  4QF2 A;  4YBM A;  3FAN A;  2LAU A;  4WZ0 A;  3FL2 A;  3FM8 C;  2JMJ A;  2CSZ A;  5C11 A;  1HYI A;  5H1V A;  5SVX A;  5LKT A;  5TBN A;  3O37 A;  2YQL A;  2HYE D;  4B86 C;  2KGI A;  5TRB A;  1MBM A;  4BHW A;  1WEU A;  3FAO A;  1X4U A;  4TKP B;  2K17 A;  3EB5 A;  3U5M A;  2LGG A;  2L75 A;  2EA6 A;  5B77 A;  2RSD A;  3L1Z B;  2LGK A;  4L58 A;  3SUB A;  3O34 A;  2DX8 A;  1WIM A;  2XOC A;  2G45 A;  5LKX A;  4FIP A;  2D8S A;  2YSM A;  3L11 A;  2YYR A;  1V87 A;  3N9M A;  1WEW A;  2C2V S;  3GV4 A;  4A0C D;  1ZBD B;  2L5U A;  4N4F A;  3N9N A;  1WEE A;  2ECG A;  4AYC A;  2B0O E;  1DVP A;  5LKZ A;  2K1J A;  5TDR A;  2EOD A;  3VK6 A;  2CON A;  2VPG A;  2QIC A;  5G0F A;  2FD4 A;  4R2Y A;  4Z0R A;  4UP5 A;  4GNE A;  5FER A;  2HDP A; 
#chains in the Genus database with same CATH homology
 4P5O B;  3N9P A;  2FSA A;  3SOW A;  2ECI A;  4N3W A;  4LJN A;  4WZ2 A;  3O36 A;  2G43 A;  3PUR A;  2JMI A;  5C13 A;  3ZVZ B;  4A4B A;  4FK5 A;  2OXQ C;  2FUU A;  2LGL A;  4YBS A;  4B7Y C;  2ECN A;  2UZG A;  4V3L C;  4X3G A;  3L1X A;  3NG2 A;  5B75 A;  2G6Q A;  5FB0 A;  5FB1 A;  5D1L B;  5KH9 A;  2FUI A;  4FJC A;  2MT5 A;  4WA6 A;  4BBQ A;  2IDA A;  2KWK A;  5FEY A;  4YC9 A;  2MD8 C;  2LDR A;  2VP7 A;  2MA5 A;  4YAD A;  4MSX A;  3EB6 A;  1RMD A;  4AUQ B;  2VJF A;  4XI1 A;  5TAB A;  3C5K A;  1WEN A;  5H1U A;  4CCG X;  4QF3 A;  2KWJ A;  3RPG C;  2CSY A;  2LRI C;  2VJE A;  2CKL B;  3LQJ A;  2MD7 B;  4I7C A;  1F62 A;  1JM7 B;  2M6M A;  2M3H A;  1WEP A;  4YAT A;  5DKA A;  3HTK C;  2KRE A;  3KV5 A;  3KNV A;  2RI7 A;  3RPG B;  4MVT A;  3ZYQ A;  3KV6 A;  5KH7 A;  1U6G B;  2PNX A;  3O33 A;  2ECJ A;  4C9Z A;  3DPL R;  2Y1N A;  4ZDT A;  1VD4 A;  2KR4 A;  5D1K B;  2EGP A;  2YUR A;  3M62 A;  3HCT A;  2YHO A;  2VPE A;  2YU4 A;  5H9M A;  2ECT A;  2ECW A;  5B76 A;  3LQH A;  2KIZ A;  5TDW A;  5B8D A;  2VNF A;  3N9L A;  2QIZ A;  3C6W A;  5D1M B;  2LXH C;  2L0B A;  4LAD B;  2YQM A;  2K4D A;  1T1H A;  3ZPV 1;  5LKU A;  4AVX A;  3ASL A;  1VFY A;  5B79 A;  3GL6 A;  4UP0 A;  4YAX A;  1IYM A;  1JOC A;  4GNF A;  4O64 A;  2L80 A;  4IC2 A;  3QZV A;  2QJ0 A;  2KYU A;  4AP4 A;  1VYX A;  2LV9 A;  2ECV A;  3ZPV E;  2YW8 A;  5LCW B;  3MHH A;  3O7A A;  3ZVY A;  4CA1 A;  2YT5 A;  3KQI A;  1WE9 A;  2M1R A;  2I50 A;  4GND A;  3PUQ A;  5AIT A;  2F6J A;  3U5O A;  2C2L A;  4L7X A;  4LKA A;  1WEM A;  1LDJ B;  4S3O B;  2K16 A;  3SOX A;  2AN6 A;  2PUY A;  2JMD A;  2YRE A;  1WES A;  2KFT A;  1N87 A;  3V43 A;  3IHP A;  4AYC B;  3N9Q A;  2YSJ A;  3T6R A;  5KH3 A;  5G05 B;  4UI9 B;  1FBV A;  1X4J A;  4I7D A;  2Y1M A;  3N9O A;  3U5N A;  3O70 A;  3HCS A;  2F6N A;  5J3X A;  5DIN A;  4IC3 A;  4V3K C;  2CT2 A;  4LK9 A;  4PTB A;  2KU3 A;  3RTR B;  4PPE A;  2YHN A;  3O35 A;  2VPB A;  1Z6U A;  3MHS A;  1Z2Q A;  4YAB A;  2H0D B;  4I7B A;  2BAY A;  3LQI A;  1X4I A;  2LN0 A;  3PHD A;  4A49 A;  4LLB A;  2ZET C;  4W4U A;  2LXP C;  4Q6F A;  1MM2 A;  3SHB A;  2LGV A;  4ZUX U;  2CKL A;  3I2D A;  1LDK C;  2KE1 A;  1JM7 A;  2MNZ A;  5B78 A;  2LQ6 A;  1XWH A;  4GNG A;  2MIQ A;  3U5P A;  4GB0 A;  2E6R A;  1WEO A;  2YUC A;  5H1T A;  5AIU A;  5JG6 A;  2M85 A;  4ZQL A;  4R8P K;  2VPD A;  2VJF B;  4YBT A;  2E6S A;  4F52 B;  3HCU A;  3M99 A;  2F42 A;  4WZ3 B;  2H0D A;  1WFK A;  2KGG A;  1Z60 A;  2VJE B;  4R7E A;  4S3O C;  2JRJ A;  1FP0 A;  2XEU A;  3LRQ A;  4A4C A;  1G25 A;  2L43 A;  1WGM A;  2XB1 A;  2MNY A;  3M63 A;  3DQV R;  1E4U A;  1WIL A;  3T7L A;  1HYJ A;  1CHC A;  2KWO A;  4NN2 A;  2KWN A;  1WEV A;  2MA6 A;  3ZNI A;  1WEQ A;  2NAA A;  5EYA F;  3SOU A;  3ZTG A;  4FO9 A;  5I3L A;  1BOR A;  5G04 B;  1K2F A;  2MUM A;  1MM3 A;  2Y43 A;  4QF2 A;  4YBM A;  4WZ0 A;  3FL2 A;  2JMJ A;  2CSZ A;  5C11 A;  1HYI A;  5H1V A;  5LKT A;  5TBN A;  3O37 A;  2YQL A;  2HYE D;  4B86 C;  2KGI A;  5TRB A;  4BHW A;  1WEU A;  1X4U A;  4TKP B;  2K17 A;  3EB5 A;  3U5M A;  2LGG A;  2L75 A;  2EA6 A;  5B77 A;  2RSD A;  3L1Z B;  2LGK A;  4L58 A;  3O34 A;  2DX8 A;  1WIM A;  2G45 A;  5LKX A;  4FIP A;  2D8S A;  2YSM A;  3L11 A;  2YYR A;  1V87 A;  3N9M A;  1WEW A;  2C2V S;  3GV4 A;  4A0C D;  1ZBD B;  2L5U A;  4N4F A;  3N9N A;  1WEE A;  2ECG A;  4AYC A;  1DVP A;  5LKZ A;  2K1J A;  5TDR A;  2EOD A;  3VK6 A;  2VPG A;  2QIC A;  5G0F A;  4R2Y A;  4UP5 A;  4GNE A;  5FER A;  2HDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...