3RPGC

Bmi1/ring1b-ubch5c complex structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
TWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of UbcH5c and the nucleosome by the Bmi1/Ring1b ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 D3
total genus 17
structure length 101
sequence length 101
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3rpgC01
2YU4A 3ZVZB 1JM7B 2FSAA 4GNDA 4R7EA 2F6NA 2Y43A 5KH7A 2JRJA 2ECVA 2G43A 1JOCA 5D1LB 2LGKA 2E6SA 4FJCA 4MVTA 2M85A 5FB1A 4AYCB 5C11A 2YSMA 2VJFA 1VFYA 5I3LA 2ECNA 3HCTA 2M6MA 3EB5A 2QJ0A 5G05B 2RSDA 3C5KA 4QF2A 3U5PA 3SOUA 2VPEA 2VPDA 4V3KC 5D1KB 2VP7A 3DPLR 3L1XA 4LLBA 1WGMA 2F6JA 2C2LA 2QIZA 4L7XA 1WEPA 4WZ3B 4ZUXU 2H0DA 2PUYA 4WZ0A 1X4UA 4O64A 1FBVA 4BBQA 4ZQLA 2L43A 2YURA 4GNEA 3KV6A 1WEEA 4YBSA 2MA6A 2XEUA 2KYUA 1VYXA 4QF3A 2LRIC 1CHCA 2F42A 3HTKC 3V43A 4I7BA 4P5OB 2EGPA 1BORA 1Z6UA 1WEVA 2E6RA 4UP5A 4AVXA 3U5MA 3I2DA 2QICA 5LCWB 3LRQA 2MD7B 5G04B 4CA1A 2LQ6A 4N4FA 5H1VA 2YHNA 2HYED 3M63A 3LQIA 4UP0A 4NN2A 2YW8A 4AYCA 3O34A 2JMJA 2KWJA 2LXHC 3N9NA 4IC3A 3M99A 5JG6A 1MM2A 2KWNA 4A4BA 4FO9A 4BHWA 5G0FA 3L1ZB 4W4UA 3RPGB 2OXQC 2MT5A 3SOXA 2YQMA 2KREA 2LV9A 2PNXA 2G45A 5B76A 2KE1A 3N9LA 2MIQA 3HCSA 4AP4A 4FIPA 2YQLA 3ZTGA 4PPEA 4MSXA 4AUQB 3GL6A 5D1MB 2CSZA 1X4JA 1HYJA 5FB0A 1IYMA 4YADA 2L5UA 4X3GA 4A0CD 2JMIA 4N3WA 4GB0A 4A4CA 2EA6A 2KIZA 1HYIA 5FEYA 4V3LC 4I7DA 3N9QA 2CKLA 3O7AA 2NAAA 3ZNIA 2CSYA 4B7YC 2EODA 1RMDA 1JM7A 5H1TA 1WEUA 2RI7A 1WENA 1N87A 3GV4A 3PHDA 2LDRA 2M1RA 2ECGA 4FK5A 3RTRB 2HDPA 2ECTA 5B77A 1WEMA 1V87A 2ZETC 3T7LA 3QZVA 2VJFB 3PURA 5DKAA 4YAXA 2VJEB 2G6QA 5J3XA 1F62A 4WA6A 3O36A 3N9PA 3L11A 4LKAA 5TABA 5B8DA 2K16A 4CCGX 5LKXA 3SHBA 5TDRA 5FERA 2Y1NA 2YUCA 5B79A 4YBMA 3RPGC 4LADB 4Q6FA 3DQVR 4XI1A 1WFKA 1X4IA 3PUQA 5H1UA 2CT2A 5DINA 1WIMA 1WILA 5B75A 2K4DA 2KWOA 2LGLA 4C9ZA 4YBTA 2LN0A 3O35A 4WZ2A 4L58A 3KV5A 2ECIA 2LGGA 5C13A 2YREA 3MHHA 3EB6A 3N9MA 2H0DB 3N9OA 1VD4A 2Y1MA 2MA5A 1U6GB 5LKZA 2ECWA 3O33A 4LJNA 5EYAF 2L80A 1Z2QA 2DX8A 2KU3A 5KH9A 2C2VS 3C6WA 4I7CA 1LDJB 1WEWA 4LK9A 1Z60A 3T6RA 1G25A 3ZVYA 2YT5A 1MM3A 4F52B 2VJEA 4UI9B 3MHSA 3ZPV1 2YHOA 1WE9A 5TBNA 2MNZA 2I50A 1WEOA 4TKPB 1XWHA 3FL2A 2VNFA 5B78A 3NG2A 1FP0A 2XB1A 1DVPA 4R2YA 2VPGA 2KWKA 4A49A 3LQHA 3LQJA 2MNYA 5LKUA 2KFTA 4S3OB 4B86C 2LGVA 5H9MA 3SOWA 2MD8C 3U5OA 2FUIA 4YATA 5TDWA 2K17A 5AITA 3IHPA 3ZYQA 1WESA 3KNVA 3KQIA 3ASLA 2LXPC 3ZPVE 3HCUA 2CKLB 5KH3A 2D8SA 2KR4A 5LKTA 3U5NA 2UZGA 1WEQA 2M3HA 4S3OC 3VK6A 1LDKC 2L75A 2L0BA 4ZDTA 4YC9A 2KGGA 1E4UA 1ZBDB 4PTBA 2IDAA 4R8PK 2ECJA 3O37A 4IC2A 1K2FA 4YABA 2VPBA 4GNFA 3O70A 2BAYA 2AN6A 2MUMA 3M62A 5TRBA 2KGIA 2JMDA 2FUUA 2YSJA 4GNGA 5AIUA 2K1JA 1T1HA 2YYRA
chains in the Genus database with same CATH superfamily
2YU4A 3LJUX 3ZVZB 1JM7B 2FSAA 4GNDA 4R7EA 2F6NA 2Y43A 5KH7A 2JRJA 2YVRA 3FJUB 2ECVA 2G43A 1JOCA 5D1LB 2LGKA 2E6SA 4FJCA 2B0OE 2JM3A 1DCQA 4MVTA 2M85A 5FB1A 4AYCB 5C11A 2YSMA 2VJFA 1VFYA 5I3LA 2ECNA 3HCTA 2M6MA 3EB5A 2QJ0A 5G05B 2RSDA 3C5KA 4QF2A 3U5PA 3SOUA 2VPEA 2VPDA 4V3KC 5D1KB 2VP7A 3DPLR 3L1XA 4LLBA 1WGMA 5K3QA 2F6JA 2C2LA 5SVIA 3MDBC 2QIZA 2CRWA 4L7XA 1WEPA 2EXUA 4WZ3B 4ZUXU 2H0DA 2PUYA 4WZ0A 1X4UA 3LVQE 4O64A 1FBVA 4BBQA 4ZQLA 2L43A 2YURA 4GNEA 3KV6A 1WEEA 4YBSA 2MA6A 2XEUA 2KYUA 1VYXA 4QF3A 2LRIC 1CHCA 2F42A 4F1PA 3HTKC 3V43A 4I7BA 4P5OB 3M7KA 2EGPA 1BORA 1Z6UA 1WEVA 2E6RA 4UP5A 5SVXA 4AVXA 4H9DA 3U5MA 3I2DA 2QICA 4QQ4A 5LCWB 3LRQA 2MD7B 5G04B 4CA1A 2LQ6A 4N4FA 5H1VA 2YHNA 2HYED 3M63A 3LQIA 4UP0A 4NN2A 3KDEC 2YW8A 4AYCA 2EGMA 3O34A 2JMJA 2XP0A 2KWJA 2LXHC 3N9NA 2M13A 4IC3A 3M99A 5JG6A 1MM2A 2KWNA 3LVRE 4A4BA 4FO9A 4BHWA 2DJAA 5G0FA 3L1ZB 4W4UA 3RPGB 2OXQC 2MT5A 3SOXA 2YQMA 2KREA 2LV9A 2PNXA 2G45A 5B76A 2KE1A 3N9LA 2MIQA 3HCSA 4AP4A 4FIPA 2YQLA 3ZTGA 4PPEA 4MSXA 2KKXA 4AUQB 3GL6A 5D1MB 2CSZA 1X4JA 1HYJA 2P57A 5FB0A 3JUEA 1IYMA 4YADA 2L5UA 3FEHA 2L7PA 4X3GA 4A0CD 2JMIA 4N3WA 2E61A 4GB0A 4A4CA 5SVIB 2EA6A 2KIZA 1HYIA 5FEYA 4V3LC 4I7DA 3N9QA 2CKLA 3O7AA 3PLWA 2NAAA 3ZNIA 2CSYA 2EODA 4B7YC 1RMDA 1JM7A 5H1TA 1MBMA 1WEUA 2RI7A 2DSMA 1WENA 1N87A 3GV4A 3PHDA 2LDRA 2M1RA 2ECGA 4FK5A 3RTRB 2HDPA 2ECTA 5B77A 1WEMA 1V87A 2ZETC 3T7LA 3QZVA 2VJFB 2CONA 3PURA 5DKAA 4YAXA 2VJEB 2G6QA 5J3XA 1F62A 4OGCA 4WA6A 3O36A 3N9PA 3L11A 4LKAA 5TABA 5B8DA 2K16A 4CCGX 5LKXA 3SHBA 5TDRA 3DWDA 5FERA 2Y1NA 2YUCA 5B79A 4YBMA 3RPGC 4LADB 4Q6FA 3E2DA 3DQVR 4XI1A 1WFKA 1X4IA 3PUQA 5H1UA 2CT2A 5DINA 1WIMA 1WILA 5B75A 2K4DA 2KWOA 2LGLA 4C9ZA 3O47A 4YBTA 2LN0A 3O35A 3SUBA 2KKYA 4WZ2A 4L58A 3KV5A 2ECIA 2XOYA 2LGGA 5C13A 2YREA 3FM8C 3MHHA 2LAUA 3EB6A 3N9MA 2H0DB 3DDTA 3N9OA 1VD4A 2Y1MA 2MA5A 1U6GB 5LKZA 2ECWA 3T9KA 3O33A 3FANA 4LJNA 5EYAF 2L80A 1Z2QA 2DX8A 2KU3A 5KH9A 2C2VS 3C6WA 5SVYA 4I7CA 1LDJB 1WEWA 2JUNA 4LK9A 2IQJA 1Z60A 3T6RA 4O62A 1G25A 3ZVYA 2YT5A 1MM3A 4F52B 2VJEA 4OGEA 4UI9B 3MHSA 3ZPV1 2YHOA 1WE9A 5TBNA 2MNZA 2OWAA 2I50A 1WEOA 4TKPB 1XWHA 3FL2A 2VNFA 5B78A 3NG2A 4Z0OA 1FP0A 2XB1A 1DVPA 4R2YA 2VPGA 2KWKA 2XOCA 4A49A 3LQHA 3LQJA 2CSVA 2MNYA 5LKUA 2KFTA 4S3OB 3FAOA 2FFWA 4B86C 2LGVA 5H9MA 3SOWA 2MD8C 3U5OA 2FUIA 4YATA 5TDWA 2K17A 5AITA 3IHPA 3ZYQA 1WESA 3KNVA 3KQIA 3H7HA 3ASLA 2LXPC 3ZPVE 3HCUA 2CKLB 3LDYA 5KH3A 2D8SA 2KR4A 5LKTA 3U5NA 2UZGA 1WEQA 2MKEA 2M3HA 4S3OC 3VK6A 1LDKC 2L75A 2CRRA 2L0BA 4YC9A 4ZDTA 2KGGA 1E4UA 1ZBDB 4PTBA 2IDAA 2XOZA 4R8PK 2ECJA 3O37A 4IC2A 1K2FA 4YABA 2VPBA 4GNFA 3O70A 4Z0RA 2BAYA 2D8UA 2AN6A 2MUMA 3M62A 5TRBA 2KGIA 2JMDA 2FUUA 2YSJA 4GNGA 5AIUA 2K1JA 2FD4A 1T1HA 2RR4A 2YYRA 3Q1DA
chains in the Genus database with same CATH topology
2YU4A 3ZVZB 1JM7B 2FSAA 4GNDA 4R7EA 2F6NA 2Y43A 5KH7A 2JRJA 2ECVA 2G43A 1JOCA 5D1LB 2LGKA 2E6SA 4FJCA 4MVTA 2M85A 5FB1A 4AYCB 5C11A 2YSMA 2VJFA 1VFYA 5I3LA 2ECNA 3HCTA 2M6MA 3EB5A 2QJ0A 5G05B 2RSDA 3C5KA 4QF2A 3U5PA 3SOUA 2VPEA 2VPDA 4V3KC 5D1KB 2VP7A 3DPLR 3L1XA 4LLBA 1WGMA 2F6JA 2C2LA 2QIZA 4L7XA 1WEPA 4WZ3B 4ZUXU 2H0DA 2PUYA 4WZ0A 1X4UA 4O64A 1FBVA 4BBQA 4ZQLA 2L43A 2YURA 4GNEA 3KV6A 1WEEA 4YBSA 2MA6A 2XEUA 2KYUA 1VYXA 4QF3A 2LRIC 1CHCA 2F42A 3HTKC 3V43A 4I7BA 4P5OB 2EGPA 1BORA 1Z6UA 1WEVA 2E6RA 4UP5A 4AVXA 3U5MA 3I2DA 2QICA 5LCWB 3LRQA 2MD7B 5G04B 4CA1A 2LQ6A 4N4FA 5H1VA 2YHNA 2HYED 3M63A 3LQIA 4UP0A 4NN2A 2YW8A 4AYCA 3O34A 2JMJA 2KWJA 2LXHC 3N9NA 4IC3A 3M99A 5JG6A 1MM2A 2KWNA 4A4BA 4FO9A 4BHWA 5G0FA 3L1ZB 4W4UA 3RPGB 2OXQC 2MT5A 3SOXA 2YQMA 2KREA 2LV9A 2PNXA 2G45A 5B76A 2KE1A 3N9LA 2MIQA 3HCSA 4AP4A 4FIPA 2YQLA 3ZTGA 4PPEA 4MSXA 4AUQB 3GL6A 5D1MB 2CSZA 1X4JA 1HYJA 5FB0A 1IYMA 4YADA 2L5UA 4X3GA 4A0CD 2JMIA 4N3WA 4GB0A 4A4CA 2EA6A 2KIZA 1HYIA 5FEYA 4V3LC 4I7DA 3N9QA 2CKLA 3O7AA 2NAAA 3ZNIA 2CSYA 4B7YC 2EODA 1RMDA 1JM7A 5H1TA 1WEUA 2RI7A 1WENA 1N87A 3GV4A 3PHDA 2LDRA 2M1RA 2ECGA 4FK5A 3RTRB 2HDPA 2ECTA 5B77A 1WEMA 1V87A 2ZETC 3T7LA 3QZVA 2VJFB 3PURA 5DKAA 4YAXA 2VJEB 2G6QA 5J3XA 1F62A 4WA6A 3O36A 3N9PA 3L11A 4LKAA 5TABA 5B8DA 2K16A 4CCGX 5LKXA 3SHBA 5TDRA 5FERA 2Y1NA 2YUCA 5B79A 4YBMA 3RPGC 4LADB 4Q6FA 3DQVR 4XI1A 1WFKA 1X4IA 3PUQA 5H1UA 2CT2A 5DINA 1WIMA 1WILA 5B75A 2K4DA 2KWOA 2LGLA 4C9ZA 4YBTA 2LN0A 3O35A 4WZ2A 4L58A 3KV5A 2ECIA 2LGGA 5C13A 2YREA 3MHHA 3EB6A 3N9MA 2H0DB 3N9OA 1VD4A 2Y1MA 2MA5A 1U6GB 5LKZA 2ECWA 3O33A 4LJNA 5EYAF 2L80A 1Z2QA 2DX8A 2KU3A 5KH9A 2C2VS 3C6WA 4I7CA 1LDJB 1WEWA 4LK9A 1Z60A 3T6RA 1G25A 3ZVYA 2YT5A 1MM3A 4F52B 2VJEA 4UI9B 3MHSA 3ZPV1 2YHOA 1WE9A 5TBNA 2MNZA 2I50A 1WEOA 4TKPB 1XWHA 3FL2A 2VNFA 5B78A 3NG2A 1FP0A 2XB1A 1DVPA 4R2YA 2VPGA 2KWKA 4A49A 3LQHA 3LQJA 2MNYA 5LKUA 2KFTA 4S3OB 4B86C 2LGVA 5H9MA 3SOWA 2MD8C 3U5OA 2FUIA 4YATA 5TDWA 2K17A 5AITA 3IHPA 3ZYQA 1WESA 3KNVA 3KQIA 3ASLA 2LXPC 3ZPVE 3HCUA 2CKLB 5KH3A 2D8SA 2KR4A 5LKTA 3U5NA 2UZGA 1WEQA 2M3HA 4S3OC 3VK6A 1LDKC 2L75A 2L0BA 4ZDTA 4YC9A 2KGGA 1E4UA 1ZBDB 4PTBA 2IDAA 4R8PK 2ECJA 3O37A 4IC2A 1K2FA 4YABA 2VPBA 4GNFA 3O70A 2BAYA 2AN6A 2MUMA 3M62A 5TRBA 2KGIA 2JMDA 2FUUA 2YSJA 4GNGA 5AIUA 2K1JA 1T1HA 2YYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU4 A;  3ZVZ B;  1JM7 B;  2FSA A;  4GND A;  4R7E A;  2F6N A;  2Y43 A;  5KH7 A;  2JRJ A;  2ECV A;  2G43 A;  1JOC A;  5D1L B;  2LGK A;  2E6S A;  4FJC A;  4MVT A;  2M85 A;  5FB1 A;  4AYC B;  5C11 A;  2YSM A;  2VJF A;  1VFY A;  5I3L A;  2ECN A;  3HCT A;  2M6M A;  3EB5 A;  2QJ0 A;  5G05 B;  2RSD A;  3C5K A;  4QF2 A;  3U5P A;  3SOU A;  2VPE A;  2VPD A;  4V3K C;  5D1K B;  2VP7 A;  3DPL R;  3L1X A;  4LLB A;  1WGM A;  2F6J A;  2C2L A;  2QIZ A;  4L7X A;  1WEP A;  4WZ3 B;  4ZUX U;  2H0D A;  2PUY A;  4WZ0 A;  1X4U A;  4O64 A;  1FBV A;  4BBQ A;  4ZQL A;  2L43 A;  2YUR A;  4GNE A;  3KV6 A;  1WEE A;  4YBS A;  2MA6 A;  2XEU A;  2KYU A;  1VYX A;  4QF3 A;  2LRI C;  1CHC A;  2F42 A;  3HTK C;  3V43 A;  4I7B A;  4P5O B;  2EGP A;  1BOR A;  1Z6U A;  1WEV A;  2E6R A;  4UP5 A;  4AVX A;  3U5M A;  3I2D A;  2QIC A;  5LCW B;  3LRQ A;  2MD7 B;  5G04 B;  4CA1 A;  2LQ6 A;  4N4F A;  5H1V A;  2YHN A;  2HYE D;  3M63 A;  3LQI A;  4UP0 A;  4NN2 A;  2YW8 A;  4AYC A;  3O34 A;  2JMJ A;  2KWJ A;  2LXH C;  3N9N A;  4IC3 A;  3M99 A;  5JG6 A;  1MM2 A;  2KWN A;  4A4B A;  4FO9 A;  4BHW A;  5G0F A;  3L1Z B;  4W4U A;  3RPG B;  2OXQ C;  2MT5 A;  3SOX A;  2YQM A;  2KRE A;  2LV9 A;  2PNX A;  2G45 A;  5B76 A;  2KE1 A;  3N9L A;  2MIQ A;  3HCS A;  4AP4 A;  4FIP A;  2YQL A;  3ZTG A;  4PPE A;  4MSX A;  4AUQ B;  3GL6 A;  5D1M B;  2CSZ A;  1X4J A;  1HYJ A;  5FB0 A;  1IYM A;  4YAD A;  2L5U A;  4X3G A;  4A0C D;  2JMI A;  4N3W A;  4GB0 A;  4A4C A;  2EA6 A;  2KIZ A;  1HYI A;  5FEY A;  4V3L C;  4I7D A;  3N9Q A;  2CKL A;  3O7A A;  2NAA A;  3ZNI A;  2CSY A;  4B7Y C;  2EOD A;  1RMD A;  1JM7 A;  5H1T A;  1WEU A;  2RI7 A;  1WEN A;  1N87 A;  3GV4 A;  3PHD A;  2LDR A;  2M1R A;  2ECG A;  4FK5 A;  3RTR B;  2HDP A;  2ECT A;  5B77 A;  1WEM A;  1V87 A;  2ZET C;  3T7L A;  3QZV A;  2VJF B;  3PUR A;  5DKA A;  4YAX A;  2VJE B;  2G6Q A;  5J3X A;  1F62 A;  4WA6 A;  3O36 A;  3N9P A;  3L11 A;  4LKA A;  5TAB A;  5B8D A;  2K16 A;  4CCG X;  5LKX A;  3SHB A;  5TDR A;  5FER A;  2Y1N A;  2YUC A;  5B79 A;  4YBM A;  3RPG C;  4LAD B;  4Q6F A;  3DQV R;  4XI1 A;  1WFK A;  1X4I A;  3PUQ A;  5H1U A;  2CT2 A;  5DIN A;  1WIM A;  1WIL A;  5B75 A;  2K4D A;  2KWO A;  2LGL A;  4C9Z A;  4YBT A;  2LN0 A;  3O35 A;  4WZ2 A;  4L58 A;  3KV5 A;  2ECI A;  2LGG A;  5C13 A;  2YRE A;  3MHH A;  3EB6 A;  3N9M A;  2H0D B;  3N9O A;  1VD4 A;  2Y1M A;  2MA5 A;  1U6G B;  5LKZ A;  2ECW A;  3O33 A;  4LJN A;  5EYA F;  2L80 A;  1Z2Q A;  2DX8 A;  2KU3 A;  5KH9 A;  2C2V S;  3C6W A;  4I7C A;  1LDJ B;  1WEW A;  4LK9 A;  1Z60 A;  3T6R A;  1G25 A;  3ZVY A;  2YT5 A;  1MM3 A;  4F52 B;  2VJE A;  4UI9 B;  3MHS A;  3ZPV 1;  2YHO A;  1WE9 A;  5TBN A;  2MNZ A;  2I50 A;  1WEO A;  4TKP B;  1XWH A;  3FL2 A;  2VNF A;  5B78 A;  3NG2 A;  1FP0 A;  2XB1 A;  1DVP A;  4R2Y A;  2VPG A;  2KWK A;  4A49 A;  3LQH A;  3LQJ A;  2MNY A;  5LKU A;  2KFT A;  4S3O B;  4B86 C;  2LGV A;  5H9M A;  3SOW A;  2MD8 C;  3U5O A;  2FUI A;  4YAT A;  5TDW A;  2K17 A;  5AIT A;  3IHP A;  3ZYQ A;  1WES A;  3KNV A;  3KQI A;  3ASL A;  2LXP C;  3ZPV E;  3HCU A;  2CKL B;  5KH3 A;  2D8S A;  2KR4 A;  5LKT A;  3U5N A;  2UZG A;  1WEQ A;  2M3H A;  4S3O C;  3VK6 A;  1LDK C;  2L75 A;  2L0B A;  4ZDT A;  4YC9 A;  2KGG A;  1E4U A;  1ZBD B;  4PTB A;  2IDA A;  4R8P K;  2ECJ A;  3O37 A;  4IC2 A;  1K2F A;  4YAB A;  2VPB A;  4GNF A;  3O70 A;  2BAY A;  2AN6 A;  2MUM A;  3M62 A;  5TRB A;  2KGI A;  2JMD A;  2FUU A;  2YSJ A;  4GNG A;  5AIU A;  2K1J A;  1T1H A;  2YYR A; 
#chains in the Genus database with same CATH topology
 2YU4 A;  3LJU X;  3ZVZ B;  1JM7 B;  2FSA A;  4GND A;  4R7E A;  2F6N A;  2Y43 A;  5KH7 A;  2JRJ A;  2YVR A;  3FJU B;  2ECV A;  2G43 A;  1JOC A;  5D1L B;  2LGK A;  2E6S A;  4FJC A;  2B0O E;  2JM3 A;  1DCQ A;  4MVT A;  2M85 A;  5FB1 A;  4AYC B;  5C11 A;  2YSM A;  2VJF A;  1VFY A;  5I3L A;  2ECN A;  3HCT A;  2M6M A;  3EB5 A;  2QJ0 A;  5G05 B;  2RSD A;  3C5K A;  4QF2 A;  3U5P A;  3SOU A;  2VPE A;  2VPD A;  4V3K C;  5D1K B;  2VP7 A;  3DPL R;  3L1X A;  4LLB A;  1WGM A;  5K3Q A;  2F6J A;  2C2L A;  5SVI A;  3MDB C;  2QIZ A;  2CRW A;  4L7X A;  1WEP A;  2EXU A;  4WZ3 B;  4ZUX U;  2H0D A;  2PUY A;  4WZ0 A;  1X4U A;  3LVQ E;  4O64 A;  1FBV A;  4BBQ A;  4ZQL A;  2L43 A;  2YUR A;  4GNE A;  3KV6 A;  1WEE A;  4YBS A;  2MA6 A;  2XEU A;  2KYU A;  1VYX A;  4QF3 A;  2LRI C;  1CHC A;  2F42 A;  4F1P A;  3HTK C;  3V43 A;  4I7B A;  4P5O B;  3M7K A;  2EGP A;  1BOR A;  1Z6U A;  1WEV A;  2E6R A;  4UP5 A;  5SVX A;  4AVX A;  4H9D A;  3U5M A;  3I2D A;  2QIC A;  4QQ4 A;  5LCW B;  3LRQ A;  2MD7 B;  5G04 B;  4CA1 A;  2LQ6 A;  4N4F A;  5H1V A;  2YHN A;  2HYE D;  3M63 A;  3LQI A;  4UP0 A;  4NN2 A;  3KDE C;  2YW8 A;  4AYC A;  2EGM A;  3O34 A;  2JMJ A;  2XP0 A;  2KWJ A;  2LXH C;  3N9N A;  2M13 A;  4IC3 A;  3M99 A;  5JG6 A;  1MM2 A;  2KWN A;  3LVR E;  4A4B A;  4FO9 A;  4BHW A;  2DJA A;  5G0F A;  3L1Z B;  4W4U A;  3RPG B;  2OXQ C;  2MT5 A;  3SOX A;  2YQM A;  2KRE A;  2LV9 A;  2PNX A;  2G45 A;  5B76 A;  2KE1 A;  3N9L A;  2MIQ A;  3HCS A;  4AP4 A;  4FIP A;  2YQL A;  3ZTG A;  4PPE A;  4MSX A;  2KKX A;  4AUQ B;  3GL6 A;  5D1M B;  2CSZ A;  1X4J A;  1HYJ A;  2P57 A;  5FB0 A;  3JUE A;  1IYM A;  4YAD A;  2L5U A;  3FEH A;  2L7P A;  4X3G A;  4A0C D;  2JMI A;  4N3W A;  2E61 A;  4GB0 A;  4A4C A;  5SVI B;  2EA6 A;  2KIZ A;  1HYI A;  5FEY A;  4V3L C;  4I7D A;  3N9Q A;  2CKL A;  3O7A A;  3PLW A;  2NAA A;  3ZNI A;  2CSY A;  2EOD A;  4B7Y C;  1RMD A;  1JM7 A;  5H1T A;  1MBM A;  1WEU A;  2RI7 A;  2DSM A;  1WEN A;  1N87 A;  3GV4 A;  3PHD A;  2LDR A;  2M1R A;  2ECG A;  4FK5 A;  3RTR B;  2HDP A;  2ECT A;  5B77 A;  1WEM A;  1V87 A;  2ZET C;  3T7L A;  3QZV A;  2VJF B;  2CON A;  3PUR A;  5DKA A;  4YAX A;  2VJE B;  2G6Q A;  5J3X A;  1F62 A;  4OGC A;  4WA6 A;  3O36 A;  3N9P A;  3L11 A;  4LKA A;  5TAB A;  5B8D A;  2K16 A;  4CCG X;  5LKX A;  3SHB A;  5TDR A;  3DWD A;  5FER A;  2Y1N A;  2YUC A;  5B79 A;  4YBM A;  3RPG C;  4LAD B;  4Q6F A;  3E2D A;  3DQV R;  4XI1 A;  1WFK A;  1X4I A;  3PUQ A;  5H1U A;  2CT2 A;  5DIN A;  1WIM A;  1WIL A;  5B75 A;  2K4D A;  2KWO A;  2LGL A;  4C9Z A;  3O47 A;  4YBT A;  2LN0 A;  3O35 A;  3SUB A;  2KKY A;  4WZ2 A;  4L58 A;  3KV5 A;  2ECI A;  2XOY A;  2LGG A;  5C13 A;  2YRE A;  3FM8 C;  3MHH A;  2LAU A;  3EB6 A;  3N9M A;  2H0D B;  3DDT A;  3N9O A;  1VD4 A;  2Y1M A;  2MA5 A;  1U6G B;  5LKZ A;  2ECW A;  3T9K A;  3O33 A;  3FAN A;  4LJN A;  5EYA F;  2L80 A;  1Z2Q A;  2DX8 A;  2KU3 A;  5KH9 A;  2C2V S;  3C6W A;  5SVY A;  4I7C A;  1LDJ B;  1WEW A;  2JUN A;  4LK9 A;  2IQJ A;  1Z60 A;  3T6R A;  4O62 A;  1G25 A;  3ZVY A;  2YT5 A;  1MM3 A;  4F52 B;  2VJE A;  4OGE A;  4UI9 B;  3MHS A;  3ZPV 1;  2YHO A;  1WE9 A;  5TBN A;  2MNZ A;  2OWA A;  2I50 A;  1WEO A;  4TKP B;  1XWH A;  3FL2 A;  2VNF A;  5B78 A;  3NG2 A;  4Z0O A;  1FP0 A;  2XB1 A;  1DVP A;  4R2Y A;  2VPG A;  2KWK A;  2XOC A;  4A49 A;  3LQH A;  3LQJ A;  2CSV A;  2MNY A;  5LKU A;  2KFT A;  4S3O B;  3FAO A;  2FFW A;  4B86 C;  2LGV A;  5H9M A;  3SOW A;  2MD8 C;  3U5O A;  2FUI A;  4YAT A;  5TDW A;  2K17 A;  5AIT A;  3IHP A;  3ZYQ A;  1WES A;  3KNV A;  3KQI A;  3H7H A;  3ASL A;  2LXP C;  3ZPV E;  3HCU A;  2CKL B;  3LDY A;  5KH3 A;  2D8S A;  2KR4 A;  5LKT A;  3U5N A;  2UZG A;  1WEQ A;  2MKE A;  2M3H A;  4S3O C;  3VK6 A;  1LDK C;  2L75 A;  2CRR A;  2L0B A;  4YC9 A;  4ZDT A;  2KGG A;  1E4U A;  1ZBD B;  4PTB A;  2IDA A;  2XOZ A;  4R8P K;  2ECJ A;  3O37 A;  4IC2 A;  1K2F A;  4YAB A;  2VPB A;  4GNF A;  3O70 A;  4Z0R A;  2BAY A;  2D8U A;  2AN6 A;  2MUM A;  3M62 A;  5TRB A;  2KGI A;  2JMD A;  2FUU A;  2YSJ A;  4GNG A;  5AIU A;  2K1J A;  2FD4 A;  1T1H A;  2RR4 A;  2YYR A;  3Q1D A; 
#chains in the Genus database with same CATH homology
 2YU4 A;  3ZVZ B;  1JM7 B;  2FSA A;  4GND A;  4R7E A;  2F6N A;  2Y43 A;  5KH7 A;  2JRJ A;  2ECV A;  2G43 A;  1JOC A;  5D1L B;  2LGK A;  2E6S A;  4FJC A;  4MVT A;  2M85 A;  5FB1 A;  4AYC B;  5C11 A;  2YSM A;  2VJF A;  1VFY A;  5I3L A;  2ECN A;  3HCT A;  2M6M A;  3EB5 A;  2QJ0 A;  5G05 B;  2RSD A;  3C5K A;  4QF2 A;  3U5P A;  3SOU A;  2VPE A;  2VPD A;  4V3K C;  5D1K B;  2VP7 A;  3DPL R;  3L1X A;  4LLB A;  1WGM A;  2F6J A;  2C2L A;  2QIZ A;  4L7X A;  1WEP A;  4WZ3 B;  4ZUX U;  2H0D A;  2PUY A;  4WZ0 A;  1X4U A;  4O64 A;  1FBV A;  4BBQ A;  4ZQL A;  2L43 A;  2YUR A;  4GNE A;  3KV6 A;  1WEE A;  4YBS A;  2MA6 A;  2XEU A;  2KYU A;  1VYX A;  4QF3 A;  2LRI C;  1CHC A;  2F42 A;  3HTK C;  3V43 A;  4I7B A;  4P5O B;  2EGP A;  1BOR A;  1Z6U A;  1WEV A;  2E6R A;  4UP5 A;  4AVX A;  3U5M A;  3I2D A;  2QIC A;  5LCW B;  3LRQ A;  2MD7 B;  5G04 B;  4CA1 A;  2LQ6 A;  4N4F A;  5H1V A;  2YHN A;  2HYE D;  3M63 A;  3LQI A;  4UP0 A;  4NN2 A;  2YW8 A;  4AYC A;  3O34 A;  2JMJ A;  2KWJ A;  2LXH C;  3N9N A;  4IC3 A;  3M99 A;  5JG6 A;  1MM2 A;  2KWN A;  4A4B A;  4FO9 A;  4BHW A;  5G0F A;  3L1Z B;  4W4U A;  3RPG B;  2OXQ C;  2MT5 A;  3SOX A;  2YQM A;  2KRE A;  2LV9 A;  2PNX A;  2G45 A;  5B76 A;  2KE1 A;  3N9L A;  2MIQ A;  3HCS A;  4AP4 A;  4FIP A;  2YQL A;  3ZTG A;  4PPE A;  4MSX A;  4AUQ B;  3GL6 A;  5D1M B;  2CSZ A;  1X4J A;  1HYJ A;  5FB0 A;  1IYM A;  4YAD A;  2L5U A;  4X3G A;  4A0C D;  2JMI A;  4N3W A;  4GB0 A;  4A4C A;  2EA6 A;  2KIZ A;  1HYI A;  5FEY A;  4V3L C;  4I7D A;  3N9Q A;  2CKL A;  3O7A A;  2NAA A;  3ZNI A;  2CSY A;  4B7Y C;  2EOD A;  1RMD A;  1JM7 A;  5H1T A;  1WEU A;  2RI7 A;  1WEN A;  1N87 A;  3GV4 A;  3PHD A;  2LDR A;  2M1R A;  2ECG A;  4FK5 A;  3RTR B;  2HDP A;  2ECT A;  5B77 A;  1WEM A;  1V87 A;  2ZET C;  3T7L A;  3QZV A;  2VJF B;  3PUR A;  5DKA A;  4YAX A;  2VJE B;  2G6Q A;  5J3X A;  1F62 A;  4WA6 A;  3O36 A;  3N9P A;  3L11 A;  4LKA A;  5TAB A;  5B8D A;  2K16 A;  4CCG X;  5LKX A;  3SHB A;  5TDR A;  5FER A;  2Y1N A;  2YUC A;  5B79 A;  4YBM A;  3RPG C;  4LAD B;  4Q6F A;  3DQV R;  4XI1 A;  1WFK A;  1X4I A;  3PUQ A;  5H1U A;  2CT2 A;  5DIN A;  1WIM A;  1WIL A;  5B75 A;  2K4D A;  2KWO A;  2LGL A;  4C9Z A;  4YBT A;  2LN0 A;  3O35 A;  4WZ2 A;  4L58 A;  3KV5 A;  2ECI A;  2LGG A;  5C13 A;  2YRE A;  3MHH A;  3EB6 A;  3N9M A;  2H0D B;  3N9O A;  1VD4 A;  2Y1M A;  2MA5 A;  1U6G B;  5LKZ A;  2ECW A;  3O33 A;  4LJN A;  5EYA F;  2L80 A;  1Z2Q A;  2DX8 A;  2KU3 A;  5KH9 A;  2C2V S;  3C6W A;  4I7C A;  1LDJ B;  1WEW A;  4LK9 A;  1Z60 A;  3T6R A;  1G25 A;  3ZVY A;  2YT5 A;  1MM3 A;  4F52 B;  2VJE A;  4UI9 B;  3MHS A;  3ZPV 1;  2YHO A;  1WE9 A;  5TBN A;  2MNZ A;  2I50 A;  1WEO A;  4TKP B;  1XWH A;  3FL2 A;  2VNF A;  5B78 A;  3NG2 A;  1FP0 A;  2XB1 A;  1DVP A;  4R2Y A;  2VPG A;  2KWK A;  4A49 A;  3LQH A;  3LQJ A;  2MNY A;  5LKU A;  2KFT A;  4S3O B;  4B86 C;  2LGV A;  5H9M A;  3SOW A;  2MD8 C;  3U5O A;  2FUI A;  4YAT A;  5TDW A;  2K17 A;  5AIT A;  3IHP A;  3ZYQ A;  1WES A;  3KNV A;  3KQI A;  3ASL A;  2LXP C;  3ZPV E;  3HCU A;  2CKL B;  5KH3 A;  2D8S A;  2KR4 A;  5LKT A;  3U5N A;  2UZG A;  1WEQ A;  2M3H A;  4S3O C;  3VK6 A;  1LDK C;  2L75 A;  2L0B A;  4ZDT A;  4YC9 A;  2KGG A;  1E4U A;  1ZBD B;  4PTB A;  2IDA A;  4R8P K;  2ECJ A;  3O37 A;  4IC2 A;  1K2F A;  4YAB A;  2VPB A;  4GNF A;  3O70 A;  2BAY A;  2AN6 A;  2MUM A;  3M62 A;  5TRB A;  2KGI A;  2JMD A;  2FUU A;  2YSJ A;  4GNG A;  5AIU A;  2K1J A;  1T1H A;  2YYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...