3RPGC

Bmi1/ring1b-ubch5c complex structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
TWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 D3
publication title Recognition of UbcH5c and the nucleosome by the Bmi1/Ring1b ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 101
sequence length 101
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3rpgC01
3ZTGA 1MM3A 4N4FA 2ECJA 5FB0A 5LKUA 5B75A 2MA6A 3ZPV1 4WZ0A 4YATA 4P5OB 4I7CA 3LRQA 4FJCA 5B76A 2YHNA 4YBSA 1X4IA 4UI9B 3DQVR 2YYRA 4ZDTA 3ZNIA 3ZVYA 3GL6A 5H1TA 4YBTA 3HCTA 3N9QA 4B7YC 1LDJB 2YT5A 5H1UA 3C6WA 1DVPA 2HDPA 3O33A 3RTRB 1VD4A 4A4CA 2E6RA 2YURA 1WEEA 3ZPVE 2LV9A 2FSAA 3N9LA 1MM2A 4A49A 3HCUA 3I2DA 3ZYQA 2KR4A 5FB1A 2KIZA 1WIMA 3EB6A 2ZETC 2MIQA 2F42A 4GNGA 1HYIA 3EB5A 3U5MA 2G6QA 3C5KA 2MD7B 4NN2A 5D1KB 5TABA 2C2LA 2KWOA 1WEQA 3PUQA 1CHCA 5B77A 2M6MA 2EODA 4V3LC 2ECTA 5B79A 4GNEA 4FIPA 2MT5A 2KU3A 2YSJA 1JM7A 1Z2QA 2VPBA 2BAYA 4PPEA 3LQIA 4PTBA 4GNDA 5J3XA 2VPDA 1WILA 5LKTA 4A4BA 2H0DA 2LGLA 3O36A 1JOCA 3L11A 2LQ6A 3LQJA 2I50A 5TBNA 2JRJA 1JM7B 5G04B 2G43A 2CT2A 1WGMA 4AUQB 3U5NA 2RSDA 2K1JA 2EGPA 5D1LB 3SOWA 3VK6A 5DKAA 2KE1A 3KNVA 2H0DB 4CCGX 5TDRA 5JG6A 2C2VS 4TKPB 2YREA 5H1VA 2EA6A 2DX8A 3KQIA 5EYAF 5G05B 4YABA 2KREA 4YBMA 2FUUA 1WFKA 2M85A 4W4UA 4AP4A 2KFTA 1HYJA 5I3LA 1VYXA 5LKXA 3O35A 1WEPA 3IHPA 3LQHA 2KGGA 2RI7A 3RPGC 4CA1A 5LCWB 3O34A 2K4DA 3L1XA 2Y43A 4LLBA 2ECVA 1WEVA 4B86C 2LXHC 4V3KC 5H9MA 4AVXA 4WZ2A 5AIUA 2L43A 3T7LA 4R8PK 2YQMA 2MA5A 1E4UA 4S3OB 4LADB 1FP0A 1FBVA 3HCSA 2CKLA 3PURA 3SOXA 2YQLA 4MSXA 4R2YA 1X4UA 3O7AA 4L7XA 3KV5A 3U5OA 2F6NA 2QIZA 5KH3A 3U5PA 2CKLB 3KV6A 2M1RA 3N9PA 3O70A 2LDRA 2JMJA 4WZ3B 2YW8A 3FL2A 4ZQLA 5TRBA 3N9MA 1U6GB 1WEOA 5FEYA 2M3HA 2XB1A 3ZVZB 2CSZA 3MHHA 4C9ZA 2L80A 2LN0A 2PUYA 2MD8C 4L58A 2QJ0A 2F6JA 2XEUA 2UZGA 3QZVA 2Y1NA 1WENA 2K16A 2K17A 3DPLR 1VFYA 1LDKC 4ZUXU 2VJEA 3SHBA 2VPEA 1Z6UA 4YC9A 1WEMA 3N9OA 2JMIA 2VNFA 3MHSA 4AYCA 2KWJA 5FERA 4LKAA 5AITA 2IDAA 1IYMA 3ASLA 5C11A 1WEUA 4LJNA 1X4JA 5TDWA 4I7DA 2G45A 2LXPC 4I7BA 2VJEB 1K2FA 1ZBDB 4QF3A 3T6RA 2LRIC 4MVTA 1WEWA 2KWNA 2VJFA 3M62A 4UP5A 4AYCB 2ECGA 4GB0A 1F62A 2ECWA 2Y1MA 1T1HA 4O64A 2ECIA 4LK9A 4Q6FA 3N9NA 3SOUA 2VJFB 4UP0A 4X3GA 3V43A 4BBQA 2AN6A 4F52B 2E6SA 4GNFA 2KWKA 2OXQC 2D8SA 2L0BA 2NAAA 4YAXA 5DINA 2QICA 3M63A 5D1MB 3L1ZB 3RPGB 2L75A 2LGGA 4QF2A 4R7EA 1BORA 2YSMA 1RMDA 2MNYA 2HYED 3GV4A 5B78A 1Z60A 2VP7A 5B8DA 2JMDA 4A0CD 3PHDA 4BHWA 2FUIA 5KH9A 3NG2A 2YU4A 2YUCA 4IC3A 2MUMA 1N87A 3HTKC 2LGVA 4IC2A 4WA6A 2YHOA 5LKZA 4YADA 1XWHA 3O37A 2CSYA 2L5UA 4XI1A 2KYUA 1WESA 2ECNA 1WE9A 4N3WA 2LGKA 5C13A 4FO9A 4FK5A 5G0FA 2MNZA 4S3OC 1G25A 2VPGA 3M99A 2PNXA 5KH7A 2KGIA 1V87A
chains in the Genus database with same CATH superfamily
3ZTGA 1MM3A 4N4FA 2ECJA 3T9KA 2CRRA 5FB0A 5LKUA 2FFWA 5B75A 2MA6A 3ZPV1 2DJAA 4WZ0A 4YATA 4P5OB 4I7CA 3FM8C 3LRQA 4FJCA 5B76A 2YHNA 4YBSA 1X4IA 4UI9B 3DQVR 2YYRA 4ZDTA 3ZNIA 3ZVYA 3GL6A 5H1TA 4YBTA 3HCTA 3N9QA 4B7YC 1LDJB 2YT5A 5H1UA 3C6WA 1DVPA 2HDPA 3O33A 3RTRB 1VD4A 4A4CA 2E6RA 2YURA 1WEEA 3ZPVE 2LV9A 2FSAA 3N9LA 1MM2A 2KKYA 4A49A 3HCUA 3I2DA 3ZYQA 2KR4A 5FB1A 2KIZA 1WIMA 3EB6A 2ZETC 2MIQA 2F42A 4GNGA 3FEHA 1HYIA 3EB5A 3U5MA 2G6QA 3C5KA 2MD7B 4OGEA 4NN2A 5D1KB 5TABA 2C2LA 2KWOA 1WEQA 3PUQA 3LJUX 1CHCA 5B77A 2M6MA 2EODA 4V3LC 2ECTA 5B79A 4GNEA 4FIPA 2MT5A 3DWDA 2KU3A 2YSJA 1JM7A 1Z2QA 2VPBA 2BAYA 4PPEA 2YVRA 3LQIA 4PTBA 4GNDA 5J3XA 2VPDA 2XOZA 1WILA 5LKTA 4A4BA 2H0DA 2LGLA 3O36A 1JOCA 3L11A 2LQ6A 3LQJA 2I50A 5TBNA 2JRJA 2M13A 5G04B 1JM7B 2G43A 2CT2A 1WGMA 4AUQB 3U5NA 2RSDA 2K1JA 3FANA 2EGPA 5D1LB 3SOWA 3VK6A 5DKAA 2KE1A 3LVQE 3KNVA 2H0DB 4CCGX 5TDRA 4QQ4A 5JG6A 2C2VS 4TKPB 2YREA 5H1VA 2JM3A 2EA6A 2DX8A 3KQIA 5EYAF 5G05B 4YABA 2KREA 4YBMA 2FUUA 1WFKA 2M85A 3SUBA 4W4UA 4AP4A 2KFTA 1HYJA 5I3LA 1VYXA 5LKXA 3O35A 1WEPA 3IHPA 3LQHA 3M7KA 2KGGA 2RI7A 3RPGC 4CA1A 5LCWB 3O34A 2K4DA 3KDEC 3L1XA 2Y43A 4LLBA 2ECVA 1WEVA 2D8UA 4B86C 2KKXA 2LXHC 3Q1DA 4V3KC 3O47A 5H9MA 4AVXA 2FD4A 1DCQA 4WZ2A 5AIUA 2L43A 3T7LA 4R8PK 2E61A 2YQMA 2MA5A 2MKEA 1E4UA 4S3OB 4LADB 1FP0A 4H9DA 1FBVA 3HCSA 2CKLA 3PURA 3SOXA 2YQLA 4MSXA 4R2YA 1X4UA 3O7AA 4L7XA 2L7PA 3KV5A 3FJUB 3DDTA 3U5OA 2F6NA 2QIZA 4O62A 5KH3A 3U5PA 2CKLB 2XOYA 3KV6A 2M1RA 3N9PA 3O70A 2LDRA 2JMJA 4WZ3B 2YW8A 2DSMA 3FL2A 4ZQLA 5TRBA 3N9MA 2EGMA 1U6GB 1WEOA 5FEYA 2M3HA 2XB1A 3ZVZB 2CSZA 3MHHA 4C9ZA 2L80A 2LN0A 2PUYA 2MD8C 4L58A 2QJ0A 2F6JA 2XEUA 5SVIA 2UZGA 3QZVA 2IQJA 2B0OE 2Y1NA 1WENA 2K16A 2K17A 3DPLR 1VFYA 1LDKC 4ZUXU 2VJEA 3SHBA 2VPEA 1Z6UA 3JUEA 2LAUA 4YC9A 1WEMA 2XOCA 5SVXA 3N9OA 2JMIA 5SVIB 2VNFA 3MHSA 4AYCA 2KWJA 5FERA 4LKAA 5AITA 2IDAA 1IYMA 3ASLA 5K3QA 5C11A 1WEUA 2CONA 4LJNA 1X4JA 5TDWA 3PLWA 4I7DA 1MBMA 2G45A 2LXPC 4I7BA 2VJEB 1K2FA 1ZBDB 2CRWA 4QF3A 3T6RA 2LRIC 4F1PA 4MVTA 1WEWA 2KWNA 2VJFA 3M62A 4UP5A 4AYCB 2ECGA 2XP0A 4GB0A 1F62A 2ECWA 2Y1MA 1T1HA 4O64A 2ECIA 4LK9A 4Q6FA 3N9NA 3SOUA 2EXUA 3FAOA 2VJFB 2JUNA 4UP0A 4X3GA 3V43A 4BBQA 2AN6A 4F52B 2E6SA 4GNFA 2KWKA 2OXQC 2D8SA 2L0BA 2NAAA 4YAXA 5DINA 2QICA 3M63A 5D1MB 3MDBC 3L1ZB 3RPGB 2L75A 2LGGA 4QF2A 4R7EA 1BORA 2YSMA 1RMDA 2MNYA 3E2DA 2HYED 3GV4A 5B78A 4Z0RA 1Z60A 2VP7A 5B8DA 2JMDA 4A0CD 3PHDA 4BHWA 2FUIA 2P57A 5KH9A 3H7HA 3NG2A 2YU4A 2YUCA 4IC3A 2MUMA 1N87A 2OWAA 3HTKC 3LDYA 2LGVA 4IC2A 4WA6A 2YHOA 5LKZA 4YADA 4Z0OA 2RR4A 1XWHA 3O37A 2CSYA 2L5UA 4XI1A 2KYUA 1WESA 2ECNA 1WE9A 4N3WA 2LGKA 4OGCA 5C13A 4FO9A 4FK5A 5G0FA 2CSVA 2MNZA 4S3OC 1G25A 2VPGA 3M99A 2PNXA 5KH7A 2KGIA 3LVRE 1V87A 5SVYA
chains in the Genus database with same CATH topology
3ZTGA 1MM3A 4N4FA 2ECJA 5FB0A 5LKUA 5B75A 2MA6A 3ZPV1 4WZ0A 4YATA 4P5OB 4I7CA 3LRQA 4FJCA 5B76A 2YHNA 4YBSA 1X4IA 4UI9B 3DQVR 2YYRA 4ZDTA 3ZNIA 3ZVYA 3GL6A 5H1TA 4YBTA 3HCTA 3N9QA 4B7YC 1LDJB 2YT5A 5H1UA 3C6WA 1DVPA 2HDPA 3O33A 3RTRB 1VD4A 4A4CA 2E6RA 2YURA 1WEEA 3ZPVE 2LV9A 2FSAA 3N9LA 1MM2A 4A49A 3HCUA 3I2DA 3ZYQA 2KR4A 5FB1A 2KIZA 1WIMA 3EB6A 2ZETC 2MIQA 2F42A 4GNGA 1HYIA 3EB5A 3U5MA 2G6QA 3C5KA 2MD7B 4NN2A 5D1KB 5TABA 2C2LA 2KWOA 1WEQA 3PUQA 1CHCA 5B77A 2M6MA 2EODA 4V3LC 2ECTA 5B79A 4GNEA 4FIPA 2MT5A 2KU3A 2YSJA 1JM7A 1Z2QA 2VPBA 2BAYA 4PPEA 3LQIA 4PTBA 4GNDA 5J3XA 2VPDA 1WILA 5LKTA 4A4BA 2H0DA 2LGLA 3O36A 1JOCA 3L11A 2LQ6A 3LQJA 2I50A 5TBNA 2JRJA 1JM7B 5G04B 2G43A 2CT2A 1WGMA 4AUQB 3U5NA 2RSDA 2K1JA 2EGPA 5D1LB 3SOWA 3VK6A 5DKAA 2KE1A 3KNVA 2H0DB 4CCGX 5TDRA 5JG6A 2C2VS 4TKPB 2YREA 5H1VA 2EA6A 2DX8A 3KQIA 5EYAF 5G05B 4YABA 2KREA 4YBMA 2FUUA 1WFKA 2M85A 4W4UA 4AP4A 2KFTA 1HYJA 5I3LA 1VYXA 5LKXA 3O35A 1WEPA 3IHPA 3LQHA 2KGGA 2RI7A 3RPGC 4CA1A 5LCWB 3O34A 2K4DA 3L1XA 2Y43A 4LLBA 2ECVA 1WEVA 4B86C 2LXHC 4V3KC 5H9MA 4AVXA 4WZ2A 5AIUA 2L43A 3T7LA 4R8PK 2YQMA 2MA5A 1E4UA 4S3OB 4LADB 1FP0A 1FBVA 3HCSA 2CKLA 3PURA 3SOXA 2YQLA 4MSXA 4R2YA 1X4UA 3O7AA 4L7XA 3KV5A 3U5OA 2F6NA 2QIZA 5KH3A 3U5PA 2CKLB 3KV6A 2M1RA 3N9PA 3O70A 2LDRA 2JMJA 4WZ3B 2YW8A 3FL2A 4ZQLA 5TRBA 3N9MA 1U6GB 1WEOA 5FEYA 2M3HA 2XB1A 3ZVZB 2CSZA 3MHHA 4C9ZA 2L80A 2LN0A 2PUYA 2MD8C 4L58A 2QJ0A 2F6JA 2XEUA 2UZGA 3QZVA 2Y1NA 1WENA 2K16A 2K17A 3DPLR 1VFYA 1LDKC 4ZUXU 2VJEA 3SHBA 2VPEA 1Z6UA 4YC9A 1WEMA 3N9OA 2JMIA 2VNFA 3MHSA 4AYCA 2KWJA 5FERA 4LKAA 5AITA 2IDAA 1IYMA 3ASLA 5C11A 1WEUA 4LJNA 1X4JA 5TDWA 4I7DA 2G45A 2LXPC 4I7BA 2VJEB 1K2FA 1ZBDB 4QF3A 3T6RA 2LRIC 4MVTA 1WEWA 2KWNA 2VJFA 3M62A 4UP5A 4AYCB 2ECGA 4GB0A 1F62A 2ECWA 2Y1MA 1T1HA 4O64A 2ECIA 4LK9A 4Q6FA 3N9NA 3SOUA 2VJFB 4UP0A 4X3GA 3V43A 4BBQA 2AN6A 4F52B 2E6SA 4GNFA 2KWKA 2OXQC 2D8SA 2L0BA 2NAAA 4YAXA 5DINA 2QICA 3M63A 5D1MB 3L1ZB 3RPGB 2L75A 2LGGA 4QF2A 4R7EA 1BORA 2YSMA 1RMDA 2MNYA 2HYED 3GV4A 5B78A 1Z60A 2VP7A 5B8DA 2JMDA 4A0CD 3PHDA 4BHWA 2FUIA 5KH9A 3NG2A 2YU4A 2YUCA 4IC3A 2MUMA 1N87A 3HTKC 2LGVA 4IC2A 4WA6A 2YHOA 5LKZA 4YADA 1XWHA 3O37A 2CSYA 2L5UA 4XI1A 2KYUA 1WESA 2ECNA 1WE9A 4N3WA 2LGKA 5C13A 4FO9A 4FK5A 5G0FA 2MNZA 4S3OC 1G25A 2VPGA 3M99A 2PNXA 5KH7A 2KGIA 1V87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTG A;  1MM3 A;  4N4F A;  2ECJ A;  5FB0 A;  5LKU A;  5B75 A;  2MA6 A;  3ZPV 1;  4WZ0 A;  4YAT A;  4P5O B;  4I7C A;  3LRQ A;  4FJC A;  5B76 A;  2YHN A;  4YBS A;  1X4I A;  4UI9 B;  3DQV R;  2YYR A;  4ZDT A;  3ZNI A;  3ZVY A;  3GL6 A;  5H1T A;  4YBT A;  3HCT A;  3N9Q A;  4B7Y C;  1LDJ B;  2YT5 A;  5H1U A;  3C6W A;  1DVP A;  2HDP A;  3O33 A;  3RTR B;  1VD4 A;  4A4C A;  2E6R A;  2YUR A;  1WEE A;  3ZPV E;  2LV9 A;  2FSA A;  3N9L A;  1MM2 A;  4A49 A;  3HCU A;  3I2D A;  3ZYQ A;  2KR4 A;  5FB1 A;  2KIZ A;  1WIM A;  3EB6 A;  2ZET C;  2MIQ A;  2F42 A;  4GNG A;  1HYI A;  3EB5 A;  3U5M A;  2G6Q A;  3C5K A;  2MD7 B;  4NN2 A;  5D1K B;  5TAB A;  2C2L A;  2KWO A;  1WEQ A;  3PUQ A;  1CHC A;  5B77 A;  2M6M A;  2EOD A;  4V3L C;  2ECT A;  5B79 A;  4GNE A;  4FIP A;  2MT5 A;  2KU3 A;  2YSJ A;  1JM7 A;  1Z2Q A;  2VPB A;  2BAY A;  4PPE A;  3LQI A;  4PTB A;  4GND A;  5J3X A;  2VPD A;  1WIL A;  5LKT A;  4A4B A;  2H0D A;  2LGL A;  3O36 A;  1JOC A;  3L11 A;  2LQ6 A;  3LQJ A;  2I50 A;  5TBN A;  2JRJ A;  1JM7 B;  5G04 B;  2G43 A;  2CT2 A;  1WGM A;  4AUQ B;  3U5N A;  2RSD A;  2K1J A;  2EGP A;  5D1L B;  3SOW A;  3VK6 A;  5DKA A;  2KE1 A;  3KNV A;  2H0D B;  4CCG X;  5TDR A;  5JG6 A;  2C2V S;  4TKP B;  2YRE A;  5H1V A;  2EA6 A;  2DX8 A;  3KQI A;  5EYA F;  5G05 B;  4YAB A;  2KRE A;  4YBM A;  2FUU A;  1WFK A;  2M85 A;  4W4U A;  4AP4 A;  2KFT A;  1HYJ A;  5I3L A;  1VYX A;  5LKX A;  3O35 A;  1WEP A;  3IHP A;  3LQH A;  2KGG A;  2RI7 A;  3RPG C;  4CA1 A;  5LCW B;  3O34 A;  2K4D A;  3L1X A;  2Y43 A;  4LLB A;  2ECV A;  1WEV A;  4B86 C;  2LXH C;  4V3K C;  5H9M A;  4AVX A;  4WZ2 A;  5AIU A;  2L43 A;  3T7L A;  4R8P K;  2YQM A;  2MA5 A;  1E4U A;  4S3O B;  4LAD B;  1FP0 A;  1FBV A;  3HCS A;  2CKL A;  3PUR A;  3SOX A;  2YQL A;  4MSX A;  4R2Y A;  1X4U A;  3O7A A;  4L7X A;  3KV5 A;  3U5O A;  2F6N A;  2QIZ A;  5KH3 A;  3U5P A;  2CKL B;  3KV6 A;  2M1R A;  3N9P A;  3O70 A;  2LDR A;  2JMJ A;  4WZ3 B;  2YW8 A;  3FL2 A;  4ZQL A;  5TRB A;  3N9M A;  1U6G B;  1WEO A;  5FEY A;  2M3H A;  2XB1 A;  3ZVZ B;  2CSZ A;  3MHH A;  4C9Z A;  2L80 A;  2LN0 A;  2PUY A;  2MD8 C;  4L58 A;  2QJ0 A;  2F6J A;  2XEU A;  2UZG A;  3QZV A;  2Y1N A;  1WEN A;  2K16 A;  2K17 A;  3DPL R;  1VFY A;  1LDK C;  4ZUX U;  2VJE A;  3SHB A;  2VPE A;  1Z6U A;  4YC9 A;  1WEM A;  3N9O A;  2JMI A;  2VNF A;  3MHS A;  4AYC A;  2KWJ A;  5FER A;  4LKA A;  5AIT A;  2IDA A;  1IYM A;  3ASL A;  5C11 A;  1WEU A;  4LJN A;  1X4J A;  5TDW A;  4I7D A;  2G45 A;  2LXP C;  4I7B A;  2VJE B;  1K2F A;  1ZBD B;  4QF3 A;  3T6R A;  2LRI C;  4MVT A;  1WEW A;  2KWN A;  2VJF A;  3M62 A;  4UP5 A;  4AYC B;  2ECG A;  4GB0 A;  1F62 A;  2ECW A;  2Y1M A;  1T1H A;  4O64 A;  2ECI A;  4LK9 A;  4Q6F A;  3N9N A;  3SOU A;  2VJF B;  4UP0 A;  4X3G A;  3V43 A;  4BBQ A;  2AN6 A;  4F52 B;  2E6S A;  4GNF A;  2KWK A;  2OXQ C;  2D8S A;  2L0B A;  2NAA A;  4YAX A;  5DIN A;  2QIC A;  3M63 A;  5D1M B;  3L1Z B;  3RPG B;  2L75 A;  2LGG A;  4QF2 A;  4R7E A;  1BOR A;  2YSM A;  1RMD A;  2MNY A;  2HYE D;  3GV4 A;  5B78 A;  1Z60 A;  2VP7 A;  5B8D A;  2JMD A;  4A0C D;  3PHD A;  4BHW A;  2FUI A;  5KH9 A;  3NG2 A;  2YU4 A;  2YUC A;  4IC3 A;  2MUM A;  1N87 A;  3HTK C;  2LGV A;  4IC2 A;  4WA6 A;  2YHO A;  5LKZ A;  4YAD A;  1XWH A;  3O37 A;  2CSY A;  2L5U A;  4XI1 A;  2KYU A;  1WES A;  2ECN A;  1WE9 A;  4N3W A;  2LGK A;  5C13 A;  4FO9 A;  4FK5 A;  5G0F A;  2MNZ A;  4S3O C;  1G25 A;  2VPG A;  3M99 A;  2PNX A;  5KH7 A;  2KGI A;  1V87 A; 
#chains in the Genus database with same CATH topology
 3ZTG A;  1MM3 A;  4N4F A;  2ECJ A;  3T9K A;  2CRR A;  5FB0 A;  5LKU A;  2FFW A;  5B75 A;  2MA6 A;  3ZPV 1;  2DJA A;  4WZ0 A;  4YAT A;  4P5O B;  4I7C A;  3FM8 C;  3LRQ A;  4FJC A;  5B76 A;  2YHN A;  4YBS A;  1X4I A;  4UI9 B;  3DQV R;  2YYR A;  4ZDT A;  3ZNI A;  3ZVY A;  3GL6 A;  5H1T A;  4YBT A;  3HCT A;  3N9Q A;  4B7Y C;  1LDJ B;  2YT5 A;  5H1U A;  3C6W A;  1DVP A;  2HDP A;  3O33 A;  3RTR B;  1VD4 A;  4A4C A;  2E6R A;  2YUR A;  1WEE A;  3ZPV E;  2LV9 A;  2FSA A;  3N9L A;  1MM2 A;  2KKY A;  4A49 A;  3HCU A;  3I2D A;  3ZYQ A;  2KR4 A;  5FB1 A;  2KIZ A;  1WIM A;  3EB6 A;  2ZET C;  2MIQ A;  2F42 A;  4GNG A;  3FEH A;  1HYI A;  3EB5 A;  3U5M A;  2G6Q A;  3C5K A;  2MD7 B;  4OGE A;  4NN2 A;  5D1K B;  5TAB A;  2C2L A;  2KWO A;  1WEQ A;  3PUQ A;  3LJU X;  1CHC A;  5B77 A;  2M6M A;  2EOD A;  4V3L C;  2ECT A;  5B79 A;  4GNE A;  4FIP A;  2MT5 A;  3DWD A;  2KU3 A;  2YSJ A;  1JM7 A;  1Z2Q A;  2VPB A;  2BAY A;  4PPE A;  2YVR A;  3LQI A;  4PTB A;  4GND A;  5J3X A;  2VPD A;  2XOZ A;  1WIL A;  5LKT A;  4A4B A;  2H0D A;  2LGL A;  3O36 A;  1JOC A;  3L11 A;  2LQ6 A;  3LQJ A;  2I50 A;  5TBN A;  2JRJ A;  2M13 A;  5G04 B;  1JM7 B;  2G43 A;  2CT2 A;  1WGM A;  4AUQ B;  3U5N A;  2RSD A;  2K1J A;  3FAN A;  2EGP A;  5D1L B;  3SOW A;  3VK6 A;  5DKA A;  2KE1 A;  3LVQ E;  3KNV A;  2H0D B;  4CCG X;  5TDR A;  4QQ4 A;  5JG6 A;  2C2V S;  4TKP B;  2YRE A;  5H1V A;  2JM3 A;  2EA6 A;  2DX8 A;  3KQI A;  5EYA F;  5G05 B;  4YAB A;  2KRE A;  4YBM A;  2FUU A;  1WFK A;  2M85 A;  3SUB A;  4W4U A;  4AP4 A;  2KFT A;  1HYJ A;  5I3L A;  1VYX A;  5LKX A;  3O35 A;  1WEP A;  3IHP A;  3LQH A;  3M7K A;  2KGG A;  2RI7 A;  3RPG C;  4CA1 A;  5LCW B;  3O34 A;  2K4D A;  3KDE C;  3L1X A;  2Y43 A;  4LLB A;  2ECV A;  1WEV A;  2D8U A;  4B86 C;  2KKX A;  2LXH C;  3Q1D A;  4V3K C;  3O47 A;  5H9M A;  4AVX A;  2FD4 A;  1DCQ A;  4WZ2 A;  5AIU A;  2L43 A;  3T7L A;  4R8P K;  2E61 A;  2YQM A;  2MA5 A;  2MKE A;  1E4U A;  4S3O B;  4LAD B;  1FP0 A;  4H9D A;  1FBV A;  3HCS A;  2CKL A;  3PUR A;  3SOX A;  2YQL A;  4MSX A;  4R2Y A;  1X4U A;  3O7A A;  4L7X A;  2L7P A;  3KV5 A;  3FJU B;  3DDT A;  3U5O A;  2F6N A;  2QIZ A;  4O62 A;  5KH3 A;  3U5P A;  2CKL B;  2XOY A;  3KV6 A;  2M1R A;  3N9P A;  3O70 A;  2LDR A;  2JMJ A;  4WZ3 B;  2YW8 A;  2DSM A;  3FL2 A;  4ZQL A;  5TRB A;  3N9M A;  2EGM A;  1U6G B;  1WEO A;  5FEY A;  2M3H A;  2XB1 A;  3ZVZ B;  2CSZ A;  3MHH A;  4C9Z A;  2L80 A;  2LN0 A;  2PUY A;  2MD8 C;  4L58 A;  2QJ0 A;  2F6J A;  2XEU A;  5SVI A;  2UZG A;  3QZV A;  2IQJ A;  2B0O E;  2Y1N A;  1WEN A;  2K16 A;  2K17 A;  3DPL R;  1VFY A;  1LDK C;  4ZUX U;  2VJE A;  3SHB A;  2VPE A;  1Z6U A;  3JUE A;  2LAU A;  4YC9 A;  1WEM A;  2XOC A;  5SVX A;  3N9O A;  2JMI A;  5SVI B;  2VNF A;  3MHS A;  4AYC A;  2KWJ A;  5FER A;  4LKA A;  5AIT A;  2IDA A;  1IYM A;  3ASL A;  5K3Q A;  5C11 A;  1WEU A;  2CON A;  4LJN A;  1X4J A;  5TDW A;  3PLW A;  4I7D A;  1MBM A;  2G45 A;  2LXP C;  4I7B A;  2VJE B;  1K2F A;  1ZBD B;  2CRW A;  4QF3 A;  3T6R A;  2LRI C;  4F1P A;  4MVT A;  1WEW A;  2KWN A;  2VJF A;  3M62 A;  4UP5 A;  4AYC B;  2ECG A;  2XP0 A;  4GB0 A;  1F62 A;  2ECW A;  2Y1M A;  1T1H A;  4O64 A;  2ECI A;  4LK9 A;  4Q6F A;  3N9N A;  3SOU A;  2EXU A;  3FAO A;  2VJF B;  2JUN A;  4UP0 A;  4X3G A;  3V43 A;  4BBQ A;  2AN6 A;  4F52 B;  2E6S A;  4GNF A;  2KWK A;  2OXQ C;  2D8S A;  2L0B A;  2NAA A;  4YAX A;  5DIN A;  2QIC A;  3M63 A;  5D1M B;  3MDB C;  3L1Z B;  3RPG B;  2L75 A;  2LGG A;  4QF2 A;  4R7E A;  1BOR A;  2YSM A;  1RMD A;  2MNY A;  3E2D A;  2HYE D;  3GV4 A;  5B78 A;  4Z0R A;  1Z60 A;  2VP7 A;  5B8D A;  2JMD A;  4A0C D;  3PHD A;  4BHW A;  2FUI A;  2P57 A;  5KH9 A;  3H7H A;  3NG2 A;  2YU4 A;  2YUC A;  4IC3 A;  2MUM A;  1N87 A;  2OWA A;  3HTK C;  3LDY A;  2LGV A;  4IC2 A;  4WA6 A;  2YHO A;  5LKZ A;  4YAD A;  4Z0O A;  2RR4 A;  1XWH A;  3O37 A;  2CSY A;  2L5U A;  4XI1 A;  2KYU A;  1WES A;  2ECN A;  1WE9 A;  4N3W A;  2LGK A;  4OGC A;  5C13 A;  4FO9 A;  4FK5 A;  5G0F A;  2CSV A;  2MNZ A;  4S3O C;  1G25 A;  2VPG A;  3M99 A;  2PNX A;  5KH7 A;  2KGI A;  3LVR E;  1V87 A;  5SVY A; 
#chains in the Genus database with same CATH homology
 3ZTG A;  1MM3 A;  4N4F A;  2ECJ A;  5FB0 A;  5LKU A;  5B75 A;  2MA6 A;  3ZPV 1;  4WZ0 A;  4YAT A;  4P5O B;  4I7C A;  3LRQ A;  4FJC A;  5B76 A;  2YHN A;  4YBS A;  1X4I A;  4UI9 B;  3DQV R;  2YYR A;  4ZDT A;  3ZNI A;  3ZVY A;  3GL6 A;  5H1T A;  4YBT A;  3HCT A;  3N9Q A;  4B7Y C;  1LDJ B;  2YT5 A;  5H1U A;  3C6W A;  1DVP A;  2HDP A;  3O33 A;  3RTR B;  1VD4 A;  4A4C A;  2E6R A;  2YUR A;  1WEE A;  3ZPV E;  2LV9 A;  2FSA A;  3N9L A;  1MM2 A;  4A49 A;  3HCU A;  3I2D A;  3ZYQ A;  2KR4 A;  5FB1 A;  2KIZ A;  1WIM A;  3EB6 A;  2ZET C;  2MIQ A;  2F42 A;  4GNG A;  1HYI A;  3EB5 A;  3U5M A;  2G6Q A;  3C5K A;  2MD7 B;  4NN2 A;  5D1K B;  5TAB A;  2C2L A;  2KWO A;  1WEQ A;  3PUQ A;  1CHC A;  5B77 A;  2M6M A;  2EOD A;  4V3L C;  2ECT A;  5B79 A;  4GNE A;  4FIP A;  2MT5 A;  2KU3 A;  2YSJ A;  1JM7 A;  1Z2Q A;  2VPB A;  2BAY A;  4PPE A;  3LQI A;  4PTB A;  4GND A;  5J3X A;  2VPD A;  1WIL A;  5LKT A;  4A4B A;  2H0D A;  2LGL A;  3O36 A;  1JOC A;  3L11 A;  2LQ6 A;  3LQJ A;  2I50 A;  5TBN A;  2JRJ A;  1JM7 B;  5G04 B;  2G43 A;  2CT2 A;  1WGM A;  4AUQ B;  3U5N A;  2RSD A;  2K1J A;  2EGP A;  5D1L B;  3SOW A;  3VK6 A;  5DKA A;  2KE1 A;  3KNV A;  2H0D B;  4CCG X;  5TDR A;  5JG6 A;  2C2V S;  4TKP B;  2YRE A;  5H1V A;  2EA6 A;  2DX8 A;  3KQI A;  5EYA F;  5G05 B;  4YAB A;  2KRE A;  4YBM A;  2FUU A;  1WFK A;  2M85 A;  4W4U A;  4AP4 A;  2KFT A;  1HYJ A;  5I3L A;  1VYX A;  5LKX A;  3O35 A;  1WEP A;  3IHP A;  3LQH A;  2KGG A;  2RI7 A;  3RPG C;  4CA1 A;  5LCW B;  3O34 A;  2K4D A;  3L1X A;  2Y43 A;  4LLB A;  2ECV A;  1WEV A;  4B86 C;  2LXH C;  4V3K C;  5H9M A;  4AVX A;  4WZ2 A;  5AIU A;  2L43 A;  3T7L A;  4R8P K;  2YQM A;  2MA5 A;  1E4U A;  4S3O B;  4LAD B;  1FP0 A;  1FBV A;  3HCS A;  2CKL A;  3PUR A;  3SOX A;  2YQL A;  4MSX A;  4R2Y A;  1X4U A;  3O7A A;  4L7X A;  3KV5 A;  3U5O A;  2F6N A;  2QIZ A;  5KH3 A;  3U5P A;  2CKL B;  3KV6 A;  2M1R A;  3N9P A;  3O70 A;  2LDR A;  2JMJ A;  4WZ3 B;  2YW8 A;  3FL2 A;  4ZQL A;  5TRB A;  3N9M A;  1U6G B;  1WEO A;  5FEY A;  2M3H A;  2XB1 A;  3ZVZ B;  2CSZ A;  3MHH A;  4C9Z A;  2L80 A;  2LN0 A;  2PUY A;  2MD8 C;  4L58 A;  2QJ0 A;  2F6J A;  2XEU A;  2UZG A;  3QZV A;  2Y1N A;  1WEN A;  2K16 A;  2K17 A;  3DPL R;  1VFY A;  1LDK C;  4ZUX U;  2VJE A;  3SHB A;  2VPE A;  1Z6U A;  4YC9 A;  1WEM A;  3N9O A;  2JMI A;  2VNF A;  3MHS A;  4AYC A;  2KWJ A;  5FER A;  4LKA A;  5AIT A;  2IDA A;  1IYM A;  3ASL A;  5C11 A;  1WEU A;  4LJN A;  1X4J A;  5TDW A;  4I7D A;  2G45 A;  2LXP C;  4I7B A;  2VJE B;  1K2F A;  1ZBD B;  4QF3 A;  3T6R A;  2LRI C;  4MVT A;  1WEW A;  2KWN A;  2VJF A;  3M62 A;  4UP5 A;  4AYC B;  2ECG A;  4GB0 A;  1F62 A;  2ECW A;  2Y1M A;  1T1H A;  4O64 A;  2ECI A;  4LK9 A;  4Q6F A;  3N9N A;  3SOU A;  2VJF B;  4UP0 A;  4X3G A;  3V43 A;  4BBQ A;  2AN6 A;  4F52 B;  2E6S A;  4GNF A;  2KWK A;  2OXQ C;  2D8S A;  2L0B A;  2NAA A;  4YAX A;  5DIN A;  2QIC A;  3M63 A;  5D1M B;  3L1Z B;  3RPG B;  2L75 A;  2LGG A;  4QF2 A;  4R7E A;  1BOR A;  2YSM A;  1RMD A;  2MNY A;  2HYE D;  3GV4 A;  5B78 A;  1Z60 A;  2VP7 A;  5B8D A;  2JMD A;  4A0C D;  3PHD A;  4BHW A;  2FUI A;  5KH9 A;  3NG2 A;  2YU4 A;  2YUC A;  4IC3 A;  2MUM A;  1N87 A;  3HTK C;  2LGV A;  4IC2 A;  4WA6 A;  2YHO A;  5LKZ A;  4YAD A;  1XWH A;  3O37 A;  2CSY A;  2L5U A;  4XI1 A;  2KYU A;  1WES A;  2ECN A;  1WE9 A;  4N3W A;  2LGK A;  5C13 A;  4FO9 A;  4FK5 A;  5G0F A;  2MNZ A;  4S3O C;  1G25 A;  2VPG A;  3M99 A;  2PNX A;  5KH7 A;  2KGI A;  1V87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...