4UI9B

Atomic structure of the human anaphase-promoting complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
MKVKIKCWNGVALWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ui9B00
4A0CD 2QICA 1VFYA 5H1TA 3O33A 5J3XA 2QIZA 4WZ2A 5D1KB 3ZYQA 4YADA 5G0FA 1WIMA 2L80A 4NN2A 1U6GB 4WZ3B 4ZUXU 5AITA 3GL6A 2KGGA 2KU3A 3HTKC 4V3LC 3HCSA 5LCWB 2YQLA 3RPGC 1DVPA 1X4IA 5B8DA 5H9MA 2ECWA 4CA1A 3QZVA 5TDRA 4FIPA 1Z60A 4A4CA 4GB0A 3O7AA 1WFKA 4LLBA 2FUIA 1IYMA 3M63A 5LKTA 4V3KC 2HYED 1BORA 3PUQA 5KH7A 2LGKA 2PUYA 2UZGA 2KYUA 4MSXA 3NG2A 5G04B 2Y1MA 4PTBA 2XB1A 1X4JA 2K17A 2KIZA 3T7LA 2VPEA 4ZDTA 2JMIA 2MA6A 3KNVA 1FBVA 2CSZA 2M1RA 4N4FA 2YYRA 2KWKA 4FJCA 1WEWA 4AYCA 1WEOA 5B77A 3DPLR 3ASLA 3DQVR 2K1JA 5LKZA 5I3LA 2F6JA 5LKXA 3U5NA 2YHNA 2ECGA 2LXHC 2LXPC 4WZ0A 2Y1NA 1XWHA 2FSAA 4YBSA 2YQMA 5EYAF 3T6RA 1FP0A 2K16A 2VPDA 3LQJA 2YSMA 4CCGX 3MHHA 2EGPA 1WGMA 2CSYA 4GNGA 4I7CA 3KV5A 1F62A 3C5KA 4AYCB 1JM7A 3ZPVE 2MA5A 4B86C 1WENA 4R2YA 3EB6A 3L11A 1WEUA 3O36A 4BBQA 3M99A 4GNFA 2H0DB 3ZNIA 2HDPA 4W4UA 2ECVA 5DKAA 2MIQA 2QJ0A 4S3OC 4FK5A 2KWJA 2L5UA 4B7YC 4FO9A 1E4UA 2NAAA 1LDJB 1X4UA 3VK6A 2LGLA 3HCTA 1JM7B 3LRQA 3GV4A 3U5OA 2G45A 1K2FA 2EODA 2M6MA 3N9OA 2E6SA 4WA6A 1WEQA 3SOUA 3M62A 4LK9A 4L58A 4YBTA 2CKLB 2YU4A 4O64A 1HYJA 3N9PA 2AN6A 3C6WA 2Y43A 3N9LA 4YBMA 2VP7A 1WILA 2RI7A 3RTRB 2VPGA 4AVXA 4ZQLA 3V43A 5FB0A 4YABA 2L43A 4LADB 2BAYA 5C11A 5FB1A 5D1LB 1LDKC 1T1HA 3O34A 2PNXA 2G43A 3N9NA 2M85A 2ECNA 4Q6FA 1WEVA 1RMDA 4BHWA 5FEYA 2VNFA 4LJNA 2KREA 1VD4A 4IC3A 2EA6A 2H0DA 1WEEA 2I50A 2LV9A 2VPBA 3O35A 3RPGB 2KFTA 5D1MB 3HCUA 2C2VS 2M3HA 2D8SA 2FUUA 2MD7B 2LDRA 2MUMA 5B75A 4N3WA 5B78A 2LGVA 5C13A 4R7EA 3KV6A 2L0BA 4MVTA 2C2LA 4XI1A 4QF2A 4R8PK 2IDAA 2VJFA 3ZVZB 3ZVYA 3L1ZB 3L1XA 1MM2A 2CKLA 2E6RA 3N9QA 3LQIA 4F52B 3ZPV1 4I7BA 3SHBA 2KWOA 2ECTA 5JG6A 2YSJA 5KH3A 5H1UA 4IC2A 3U5MA 5TRBA 1VYXA 1JOCA 4UI9B 2KR4A 4GNEA 2VJEB 5KH9A 4TKPB 2ECJA 5B76A 2KE1A 2F6NA 4UP5A 2XEUA 2KWNA 3PHDA 5FERA 4I7DA 3LQHA 2YUCA 1V87A 2YW8A 3MHSA 5DINA 3ZTGA 3SOXA 2MNYA 2MD8C 2VJFB 2L75A 2RSDA 4P5OB 3FL2A 1HYIA 4YC9A 3N9MA 2JMJA 1CHCA 5TABA 4PPEA 2YREA 4AP4A 2LQ6A 2F42A 2ZETC 3O37A 2LGGA 2MNZA 2MT5A 5G05B 3SOWA 4UP0A 2CT2A 1ZBDB 4YATA 1WESA 5LKUA 5B79A 3KQIA 5TBNA 2YT5A 4LKAA 3EB5A 3I2DA 2KGIA 1WE9A 2JMDA 4GNDA 1G25A 4A49A 3O70A 4S3OB 4YAXA 3U5PA 5H1VA 2G6QA 3PURA 5AIUA 1N87A 1MM3A 2LRIC 4QF3A 4C9ZA 1WEMA 4AUQB 3IHPA 2ECIA 1WEPA 1Z2QA 2LN0A 2DX8A 2YURA 2VJEA 2OXQC 4X3GA 1Z6UA 2K4DA 4A4BA 4L7XA 2JRJA 5TDWA 2YHOA
chains in the Genus database with same CATH superfamily
4A0CD 2QICA 4Z0OA 1VFYA 5H1TA 3O33A 5J3XA 2QIZA 4WZ2A 5D1KB 3ZYQA 4YADA 5G0FA 1WIMA 2L80A 4NN2A 2XOYA 1U6GB 4WZ3B 4ZUXU 5AITA 3GL6A 2KGGA 2KU3A 3HTKC 4V3LC 3HCSA 5LCWB 2YQLA 3RPGC 1DVPA 1X4IA 5B8DA 3O47A 5H9MA 2ECWA 2KKYA 4CA1A 3QZVA 5TDRA 4FIPA 2YVRA 3LJUX 1Z60A 4A4CA 4GB0A 3O7AA 4F1PA 1WFKA 4LLBA 2XOCA 2FUIA 1IYMA 3M63A 5LKTA 4V3KC 2CRWA 2HYED 1BORA 3PUQA 5KH7A 2LGKA 2PUYA 2UZGA 2KYUA 4MSXA 3NG2A 5G04B 2Y1MA 4PTBA 2XB1A 1X4JA 2K17A 2CRRA 2DSMA 2KIZA 3T7LA 2VPEA 2XP0A 4ZDTA 2JMIA 2MA6A 3KNVA 1FBVA 2CONA 2CSZA 2M1RA 4N4FA 2YYRA 3FM8C 2KWKA 4FJCA 1WEWA 4AYCA 1WEOA 5B77A 3DPLR 3ASLA 3DQVR 5SVXA 2K1JA 3M7KA 5LKZA 5I3LA 2F6JA 5LKXA 3U5NA 4OGCA 2YHNA 2ECGA 2LXHC 2LXPC 4WZ0A 2Y1NA 1XWHA 2FSAA 4YBSA 2YQMA 5EYAF 3T6RA 1FP0A 2K16A 1DCQA 2VPDA 3LQJA 2JUNA 2YSMA 4CCGX 3FEHA 3MHHA 2EGPA 2EGMA 1WGMA 2CSYA 4GNGA 4I7CA 3KV5A 1F62A 3C5KA 5SVIB 4AYCB 1JM7A 3ZPVE 2MA5A 5K3QA 4B86C 1WENA 4R2YA 3EB6A 3L11A 3LDYA 1WEUA 3O36A 4BBQA 3M99A 4GNFA 2H0DB 3ZNIA 2HDPA 4W4UA 2ECVA 5DKAA 2MIQA 2QJ0A 4S3OC 4FK5A 2KWJA 2L5UA 4B7YC 3H7HA 4FO9A 1E4UA 2NAAA 2B0OE 1LDJB 1X4UA 3VK6A 2LGLA 3HCTA 1JM7B 3LRQA 3GV4A 3U5OA 2KKXA 2G45A 1K2FA 2EODA 2M6MA 3N9OA 2E6SA 4WA6A 1WEQA 3SOUA 3M62A 4LK9A 4L58A 4YBTA 2CKLB 2YU4A 4O64A 1HYJA 2OWAA 3N9PA 2AN6A 3C6WA 2Y43A 3N9LA 3Q1DA 4YBMA 2VP7A 1WILA 2RI7A 3RTRB 2VPGA 4AVXA 4ZQLA 3V43A 5FB0A 4YABA 2L43A 4LADB 2BAYA 2P57A 5C11A 5FB1A 2MKEA 5D1LB 1LDKC 5SVIA 1T1HA 3O34A 2PNXA 2G43A 3N9NA 2M85A 2ECNA 4Q6FA 1WEVA 1RMDA 2E61A 4BHWA 5FEYA 2VNFA 4LJNA 2KREA 3JUEA 1VD4A 4IC3A 2EA6A 2H0DA 1WEEA 2I50A 2LV9A 2VPBA 3O35A 3RPGB 2KFTA 5D1MB 3HCUA 2C2VS 2M3HA 2D8SA 4OGEA 2FUUA 2MD7B 2LDRA 2MUMA 5B75A 3MDBC 2D8UA 3LVQE 4N3WA 2LGVA 2XOZA 1MBMA 5B78A 5C13A 4R7EA 3KV6A 2JM3A 2L0BA 4MVTA 2C2LA 4XI1A 4QF2A 4R8PK 2IDAA 2VJFA 3ZVZB 3ZVYA 2M13A 3L1ZB 3L1XA 1MM2A 2CKLA 2E6RA 3N9QA 3LQIA 4F52B 3ZPV1 4H9DA 4I7BA 3SHBA 2KWOA 3T9KA 2LAUA 2ECTA 5JG6A 4O62A 2YSJA 5KH3A 5H1UA 4IC2A 3U5MA 5TRBA 1VYXA 1JOCA 4UI9B 2KR4A 4GNEA 3KDEC 2VJEB 5KH9A 4TKPB 2ECJA 5B76A 2KE1A 2FD4A 2F6NA 3FAOA 4UP5A 2XEUA 4QQ4A 2KWNA 3PHDA 5FERA 4I7DA 3LQHA 2YUCA 1V87A 2YW8A 3MHSA 5DINA 3SUBA 3ZTGA 3SOXA 2MNYA 2MD8C 2VJFB 2L75A 2L7PA 2RSDA 4P5OB 3FANA 3FL2A 1HYIA 4YC9A 3N9MA 2JMJA 1CHCA 3FJUB 5TABA 4PPEA 2YREA 4AP4A 2LQ6A 2IQJA 2F42A 2ZETC 3O37A 2LGGA 2MNZA 2MT5A 3DWDA 5G05B 3SOWA 3LVRE 2CSVA 2DJAA 4UP0A 2CT2A 1ZBDB 4YATA 1WESA 5LKUA 5B79A 2FFWA 3KQIA 5TBNA 2YT5A 4LKAA 3EB5A 5SVYA 3I2DA 2KGIA 1WE9A 2JMDA 4GNDA 1G25A 4A49A 3O70A 4S3OB 4YAXA 3U5PA 5H1VA 3E2DA 2G6QA 3PLWA 2EXUA 4Z0RA 3PURA 5AIUA 1N87A 1MM3A 2LRIC 4QF3A 4C9ZA 2RR4A 1WEMA 4AUQB 3IHPA 3DDTA 2ECIA 1WEPA 1Z2QA 2LN0A 2DX8A 2YURA 2VJEA 2OXQC 4X3GA 1Z6UA 2K4DA 4A4BA 4L7XA 2JRJA 5TDWA 2YHOA
chains in the Genus database with same CATH topology
4A0CD 2QICA 1VFYA 5H1TA 3O33A 5J3XA 2QIZA 4WZ2A 5D1KB 3ZYQA 4YADA 5G0FA 1WIMA 2L80A 4NN2A 1U6GB 4WZ3B 4ZUXU 5AITA 3GL6A 2KGGA 2KU3A 3HTKC 4V3LC 3HCSA 5LCWB 2YQLA 3RPGC 1DVPA 1X4IA 5B8DA 5H9MA 2ECWA 4CA1A 3QZVA 5TDRA 4FIPA 1Z60A 4A4CA 4GB0A 3O7AA 1WFKA 4LLBA 2FUIA 1IYMA 3M63A 5LKTA 4V3KC 2HYED 1BORA 3PUQA 5KH7A 2LGKA 2PUYA 2UZGA 2KYUA 4MSXA 3NG2A 5G04B 2Y1MA 4PTBA 2XB1A 1X4JA 2K17A 2KIZA 3T7LA 2VPEA 4ZDTA 2JMIA 2MA6A 3KNVA 1FBVA 2CSZA 2M1RA 4N4FA 2YYRA 2KWKA 4FJCA 1WEWA 4AYCA 1WEOA 5B77A 3DPLR 3ASLA 3DQVR 2K1JA 5LKZA 5I3LA 2F6JA 5LKXA 3U5NA 2YHNA 2ECGA 2LXHC 2LXPC 4WZ0A 2Y1NA 1XWHA 2FSAA 4YBSA 2YQMA 5EYAF 3T6RA 1FP0A 2K16A 2VPDA 3LQJA 2YSMA 4CCGX 3MHHA 2EGPA 1WGMA 2CSYA 4GNGA 4I7CA 3KV5A 1F62A 3C5KA 4AYCB 1JM7A 3ZPVE 2MA5A 4B86C 1WENA 4R2YA 3EB6A 3L11A 1WEUA 3O36A 4BBQA 3M99A 4GNFA 2H0DB 3ZNIA 2HDPA 4W4UA 2ECVA 5DKAA 2MIQA 2QJ0A 4S3OC 4FK5A 2KWJA 2L5UA 4B7YC 4FO9A 1E4UA 2NAAA 1LDJB 1X4UA 3VK6A 2LGLA 3HCTA 1JM7B 3LRQA 3GV4A 3U5OA 2G45A 1K2FA 2EODA 2M6MA 3N9OA 2E6SA 4WA6A 1WEQA 3SOUA 3M62A 4LK9A 4L58A 4YBTA 2CKLB 2YU4A 4O64A 1HYJA 3N9PA 2AN6A 3C6WA 2Y43A 3N9LA 4YBMA 2VP7A 1WILA 2RI7A 3RTRB 2VPGA 4AVXA 4ZQLA 3V43A 5FB0A 4YABA 2L43A 4LADB 2BAYA 5C11A 5FB1A 5D1LB 1LDKC 1T1HA 3O34A 2PNXA 2G43A 3N9NA 2M85A 2ECNA 4Q6FA 1WEVA 1RMDA 4BHWA 5FEYA 2VNFA 4LJNA 2KREA 1VD4A 4IC3A 2EA6A 2H0DA 1WEEA 2I50A 2LV9A 2VPBA 3O35A 3RPGB 2KFTA 5D1MB 3HCUA 2C2VS 2M3HA 2D8SA 2FUUA 2MD7B 2LDRA 2MUMA 5B75A 4N3WA 5B78A 2LGVA 5C13A 4R7EA 3KV6A 2L0BA 4MVTA 2C2LA 4XI1A 4QF2A 4R8PK 2IDAA 2VJFA 3ZVZB 3ZVYA 3L1ZB 3L1XA 1MM2A 2CKLA 2E6RA 3N9QA 3LQIA 4F52B 3ZPV1 4I7BA 3SHBA 2KWOA 2ECTA 5JG6A 2YSJA 5KH3A 5H1UA 4IC2A 3U5MA 5TRBA 1VYXA 1JOCA 4UI9B 2KR4A 4GNEA 2VJEB 5KH9A 4TKPB 2ECJA 5B76A 2KE1A 2F6NA 4UP5A 2XEUA 2KWNA 3PHDA 5FERA 4I7DA 3LQHA 2YUCA 1V87A 2YW8A 3MHSA 5DINA 3ZTGA 3SOXA 2MNYA 2MD8C 2VJFB 2L75A 2RSDA 4P5OB 3FL2A 1HYIA 4YC9A 3N9MA 2JMJA 1CHCA 5TABA 4PPEA 2YREA 4AP4A 2LQ6A 2F42A 2ZETC 3O37A 2LGGA 2MNZA 2MT5A 5G05B 3SOWA 4UP0A 2CT2A 1ZBDB 4YATA 1WESA 5LKUA 5B79A 3KQIA 5TBNA 2YT5A 4LKAA 3EB5A 3I2DA 2KGIA 1WE9A 2JMDA 4GNDA 1G25A 4A49A 3O70A 4S3OB 4YAXA 3U5PA 5H1VA 2G6QA 3PURA 5AIUA 1N87A 1MM3A 2LRIC 4QF3A 4C9ZA 1WEMA 4AUQB 3IHPA 2ECIA 1WEPA 1Z2QA 2LN0A 2DX8A 2YURA 2VJEA 2OXQC 4X3GA 1Z6UA 2K4DA 4A4BA 4L7XA 2JRJA 5TDWA 2YHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A0C D;  2QIC A;  1VFY A;  5H1T A;  3O33 A;  5J3X A;  2QIZ A;  4WZ2 A;  5D1K B;  3ZYQ A;  4YAD A;  5G0F A;  1WIM A;  2L80 A;  4NN2 A;  1U6G B;  4WZ3 B;  4ZUX U;  5AIT A;  3GL6 A;  2KGG A;  2KU3 A;  3HTK C;  4V3L C;  3HCS A;  5LCW B;  2YQL A;  3RPG C;  1DVP A;  1X4I A;  5B8D A;  5H9M A;  2ECW A;  4CA1 A;  3QZV A;  5TDR A;  4FIP A;  1Z60 A;  4A4C A;  4GB0 A;  3O7A A;  1WFK A;  4LLB A;  2FUI A;  1IYM A;  3M63 A;  5LKT A;  4V3K C;  2HYE D;  1BOR A;  3PUQ A;  5KH7 A;  2LGK A;  2PUY A;  2UZG A;  2KYU A;  4MSX A;  3NG2 A;  5G04 B;  2Y1M A;  4PTB A;  2XB1 A;  1X4J A;  2K17 A;  2KIZ A;  3T7L A;  2VPE A;  4ZDT A;  2JMI A;  2MA6 A;  3KNV A;  1FBV A;  2CSZ A;  2M1R A;  4N4F A;  2YYR A;  2KWK A;  4FJC A;  1WEW A;  4AYC A;  1WEO A;  5B77 A;  3DPL R;  3ASL A;  3DQV R;  2K1J A;  5LKZ A;  5I3L A;  2F6J A;  5LKX A;  3U5N A;  2YHN A;  2ECG A;  2LXH C;  2LXP C;  4WZ0 A;  2Y1N A;  1XWH A;  2FSA A;  4YBS A;  2YQM A;  5EYA F;  3T6R A;  1FP0 A;  2K16 A;  2VPD A;  3LQJ A;  2YSM A;  4CCG X;  3MHH A;  2EGP A;  1WGM A;  2CSY A;  4GNG A;  4I7C A;  3KV5 A;  1F62 A;  3C5K A;  4AYC B;  1JM7 A;  3ZPV E;  2MA5 A;  4B86 C;  1WEN A;  4R2Y A;  3EB6 A;  3L11 A;  1WEU A;  3O36 A;  4BBQ A;  3M99 A;  4GNF A;  2H0D B;  3ZNI A;  2HDP A;  4W4U A;  2ECV A;  5DKA A;  2MIQ A;  2QJ0 A;  4S3O C;  4FK5 A;  2KWJ A;  2L5U A;  4B7Y C;  4FO9 A;  1E4U A;  2NAA A;  1LDJ B;  1X4U A;  3VK6 A;  2LGL A;  3HCT A;  1JM7 B;  3LRQ A;  3GV4 A;  3U5O A;  2G45 A;  1K2F A;  2EOD A;  2M6M A;  3N9O A;  2E6S A;  4WA6 A;  1WEQ A;  3SOU A;  3M62 A;  4LK9 A;  4L58 A;  4YBT A;  2CKL B;  2YU4 A;  4O64 A;  1HYJ A;  3N9P A;  2AN6 A;  3C6W A;  2Y43 A;  3N9L A;  4YBM A;  2VP7 A;  1WIL A;  2RI7 A;  3RTR B;  2VPG A;  4AVX A;  4ZQL A;  3V43 A;  5FB0 A;  4YAB A;  2L43 A;  4LAD B;  2BAY A;  5C11 A;  5FB1 A;  5D1L B;  1LDK C;  1T1H A;  3O34 A;  2PNX A;  2G43 A;  3N9N A;  2M85 A;  2ECN A;  4Q6F A;  1WEV A;  1RMD A;  4BHW A;  5FEY A;  2VNF A;  4LJN A;  2KRE A;  1VD4 A;  4IC3 A;  2EA6 A;  2H0D A;  1WEE A;  2I50 A;  2LV9 A;  2VPB A;  3O35 A;  3RPG B;  2KFT A;  5D1M B;  3HCU A;  2C2V S;  2M3H A;  2D8S A;  2FUU A;  2MD7 B;  2LDR A;  2MUM A;  5B75 A;  4N3W A;  5B78 A;  2LGV A;  5C13 A;  4R7E A;  3KV6 A;  2L0B A;  4MVT A;  2C2L A;  4XI1 A;  4QF2 A;  4R8P K;  2IDA A;  2VJF A;  3ZVZ B;  3ZVY A;  3L1Z B;  3L1X A;  1MM2 A;  2CKL A;  2E6R A;  3N9Q A;  3LQI A;  4F52 B;  3ZPV 1;  4I7B A;  3SHB A;  2KWO A;  2ECT A;  5JG6 A;  2YSJ A;  5KH3 A;  5H1U A;  4IC2 A;  3U5M A;  5TRB A;  1VYX A;  1JOC A;  4UI9 B;  2KR4 A;  4GNE A;  2VJE B;  5KH9 A;  4TKP B;  2ECJ A;  5B76 A;  2KE1 A;  2F6N A;  4UP5 A;  2XEU A;  2KWN A;  3PHD A;  5FER A;  4I7D A;  3LQH A;  2YUC A;  1V87 A;  2YW8 A;  3MHS A;  5DIN A;  3ZTG A;  3SOX A;  2MNY A;  2MD8 C;  2VJF B;  2L75 A;  2RSD A;  4P5O B;  3FL2 A;  1HYI A;  4YC9 A;  3N9M A;  2JMJ A;  1CHC A;  5TAB A;  4PPE A;  2YRE A;  4AP4 A;  2LQ6 A;  2F42 A;  2ZET C;  3O37 A;  2LGG A;  2MNZ A;  2MT5 A;  5G05 B;  3SOW A;  4UP0 A;  2CT2 A;  1ZBD B;  4YAT A;  1WES A;  5LKU A;  5B79 A;  3KQI A;  5TBN A;  2YT5 A;  4LKA A;  3EB5 A;  3I2D A;  2KGI A;  1WE9 A;  2JMD A;  4GND A;  1G25 A;  4A49 A;  3O70 A;  4S3O B;  4YAX A;  3U5P A;  5H1V A;  2G6Q A;  3PUR A;  5AIU A;  1N87 A;  1MM3 A;  2LRI C;  4QF3 A;  4C9Z A;  1WEM A;  4AUQ B;  3IHP A;  2ECI A;  1WEP A;  1Z2Q A;  2LN0 A;  2DX8 A;  2YUR A;  2VJE A;  2OXQ C;  4X3G A;  1Z6U A;  2K4D A;  4A4B A;  4L7X A;  2JRJ A;  5TDW A;  2YHO A; 
#chains in the Genus database with same CATH topology
 4A0C D;  2QIC A;  4Z0O A;  1VFY A;  5H1T A;  3O33 A;  5J3X A;  2QIZ A;  4WZ2 A;  5D1K B;  3ZYQ A;  4YAD A;  5G0F A;  1WIM A;  2L80 A;  4NN2 A;  2XOY A;  1U6G B;  4WZ3 B;  4ZUX U;  5AIT A;  3GL6 A;  2KGG A;  2KU3 A;  3HTK C;  4V3L C;  3HCS A;  5LCW B;  2YQL A;  3RPG C;  1DVP A;  1X4I A;  5B8D A;  3O47 A;  5H9M A;  2ECW A;  2KKY A;  4CA1 A;  3QZV A;  5TDR A;  4FIP A;  2YVR A;  3LJU X;  1Z60 A;  4A4C A;  4GB0 A;  3O7A A;  4F1P A;  1WFK A;  4LLB A;  2XOC A;  2FUI A;  1IYM A;  3M63 A;  5LKT A;  4V3K C;  2CRW A;  2HYE D;  1BOR A;  3PUQ A;  5KH7 A;  2LGK A;  2PUY A;  2UZG A;  2KYU A;  4MSX A;  3NG2 A;  5G04 B;  2Y1M A;  4PTB A;  2XB1 A;  1X4J A;  2K17 A;  2CRR A;  2DSM A;  2KIZ A;  3T7L A;  2VPE A;  2XP0 A;  4ZDT A;  2JMI A;  2MA6 A;  3KNV A;  1FBV A;  2CON A;  2CSZ A;  2M1R A;  4N4F A;  2YYR A;  3FM8 C;  2KWK A;  4FJC A;  1WEW A;  4AYC A;  1WEO A;  5B77 A;  3DPL R;  3ASL A;  3DQV R;  5SVX A;  2K1J A;  3M7K A;  5LKZ A;  5I3L A;  2F6J A;  5LKX A;  3U5N A;  4OGC A;  2YHN A;  2ECG A;  2LXH C;  2LXP C;  4WZ0 A;  2Y1N A;  1XWH A;  2FSA A;  4YBS A;  2YQM A;  5EYA F;  3T6R A;  1FP0 A;  2K16 A;  1DCQ A;  2VPD A;  3LQJ A;  2JUN A;  2YSM A;  4CCG X;  3FEH A;  3MHH A;  2EGP A;  2EGM A;  1WGM A;  2CSY A;  4GNG A;  4I7C A;  3KV5 A;  1F62 A;  3C5K A;  5SVI B;  4AYC B;  1JM7 A;  3ZPV E;  2MA5 A;  5K3Q A;  4B86 C;  1WEN A;  4R2Y A;  3EB6 A;  3L11 A;  3LDY A;  1WEU A;  3O36 A;  4BBQ A;  3M99 A;  4GNF A;  2H0D B;  3ZNI A;  2HDP A;  4W4U A;  2ECV A;  5DKA A;  2MIQ A;  2QJ0 A;  4S3O C;  4FK5 A;  2KWJ A;  2L5U A;  4B7Y C;  3H7H A;  4FO9 A;  1E4U A;  2NAA A;  2B0O E;  1LDJ B;  1X4U A;  3VK6 A;  2LGL A;  3HCT A;  1JM7 B;  3LRQ A;  3GV4 A;  3U5O A;  2KKX A;  2G45 A;  1K2F A;  2EOD A;  2M6M A;  3N9O A;  2E6S A;  4WA6 A;  1WEQ A;  3SOU A;  3M62 A;  4LK9 A;  4L58 A;  4YBT A;  2CKL B;  2YU4 A;  4O64 A;  1HYJ A;  2OWA A;  3N9P A;  2AN6 A;  3C6W A;  2Y43 A;  3N9L A;  3Q1D A;  4YBM A;  2VP7 A;  1WIL A;  2RI7 A;  3RTR B;  2VPG A;  4AVX A;  4ZQL A;  3V43 A;  5FB0 A;  4YAB A;  2L43 A;  4LAD B;  2BAY A;  2P57 A;  5C11 A;  5FB1 A;  2MKE A;  5D1L B;  1LDK C;  5SVI A;  1T1H A;  3O34 A;  2PNX A;  2G43 A;  3N9N A;  2M85 A;  2ECN A;  4Q6F A;  1WEV A;  1RMD A;  2E61 A;  4BHW A;  5FEY A;  2VNF A;  4LJN A;  2KRE A;  3JUE A;  1VD4 A;  4IC3 A;  2EA6 A;  2H0D A;  1WEE A;  2I50 A;  2LV9 A;  2VPB A;  3O35 A;  3RPG B;  2KFT A;  5D1M B;  3HCU A;  2C2V S;  2M3H A;  2D8S A;  4OGE A;  2FUU A;  2MD7 B;  2LDR A;  2MUM A;  5B75 A;  3MDB C;  2D8U A;  3LVQ E;  4N3W A;  2LGV A;  2XOZ A;  1MBM A;  5B78 A;  5C13 A;  4R7E A;  3KV6 A;  2JM3 A;  2L0B A;  4MVT A;  2C2L A;  4XI1 A;  4QF2 A;  4R8P K;  2IDA A;  2VJF A;  3ZVZ B;  3ZVY A;  2M13 A;  3L1Z B;  3L1X A;  1MM2 A;  2CKL A;  2E6R A;  3N9Q A;  3LQI A;  4F52 B;  3ZPV 1;  4H9D A;  4I7B A;  3SHB A;  2KWO A;  3T9K A;  2LAU A;  2ECT A;  5JG6 A;  4O62 A;  2YSJ A;  5KH3 A;  5H1U A;  4IC2 A;  3U5M A;  5TRB A;  1VYX A;  1JOC A;  4UI9 B;  2KR4 A;  4GNE A;  3KDE C;  2VJE B;  5KH9 A;  4TKP B;  2ECJ A;  5B76 A;  2KE1 A;  2FD4 A;  2F6N A;  3FAO A;  4UP5 A;  2XEU A;  4QQ4 A;  2KWN A;  3PHD A;  5FER A;  4I7D A;  3LQH A;  2YUC A;  1V87 A;  2YW8 A;  3MHS A;  5DIN A;  3SUB A;  3ZTG A;  3SOX A;  2MNY A;  2MD8 C;  2VJF B;  2L75 A;  2L7P A;  2RSD A;  4P5O B;  3FAN A;  3FL2 A;  1HYI A;  4YC9 A;  3N9M A;  2JMJ A;  1CHC A;  3FJU B;  5TAB A;  4PPE A;  2YRE A;  4AP4 A;  2LQ6 A;  2IQJ A;  2F42 A;  2ZET C;  3O37 A;  2LGG A;  2MNZ A;  2MT5 A;  3DWD A;  5G05 B;  3SOW A;  3LVR E;  2CSV A;  2DJA A;  4UP0 A;  2CT2 A;  1ZBD B;  4YAT A;  1WES A;  5LKU A;  5B79 A;  2FFW A;  3KQI A;  5TBN A;  2YT5 A;  4LKA A;  3EB5 A;  5SVY A;  3I2D A;  2KGI A;  1WE9 A;  2JMD A;  4GND A;  1G25 A;  4A49 A;  3O70 A;  4S3O B;  4YAX A;  3U5P A;  5H1V A;  3E2D A;  2G6Q A;  3PLW A;  2EXU A;  4Z0R A;  3PUR A;  5AIU A;  1N87 A;  1MM3 A;  2LRI C;  4QF3 A;  4C9Z A;  2RR4 A;  1WEM A;  4AUQ B;  3IHP A;  3DDT A;  2ECI A;  1WEP A;  1Z2Q A;  2LN0 A;  2DX8 A;  2YUR A;  2VJE A;  2OXQ C;  4X3G A;  1Z6U A;  2K4D A;  4A4B A;  4L7X A;  2JRJ A;  5TDW A;  2YHO A; 
#chains in the Genus database with same CATH homology
 4A0C D;  2QIC A;  1VFY A;  5H1T A;  3O33 A;  5J3X A;  2QIZ A;  4WZ2 A;  5D1K B;  3ZYQ A;  4YAD A;  5G0F A;  1WIM A;  2L80 A;  4NN2 A;  1U6G B;  4WZ3 B;  4ZUX U;  5AIT A;  3GL6 A;  2KGG A;  2KU3 A;  3HTK C;  4V3L C;  3HCS A;  5LCW B;  2YQL A;  3RPG C;  1DVP A;  1X4I A;  5B8D A;  5H9M A;  2ECW A;  4CA1 A;  3QZV A;  5TDR A;  4FIP A;  1Z60 A;  4A4C A;  4GB0 A;  3O7A A;  1WFK A;  4LLB A;  2FUI A;  1IYM A;  3M63 A;  5LKT A;  4V3K C;  2HYE D;  1BOR A;  3PUQ A;  5KH7 A;  2LGK A;  2PUY A;  2UZG A;  2KYU A;  4MSX A;  3NG2 A;  5G04 B;  2Y1M A;  4PTB A;  2XB1 A;  1X4J A;  2K17 A;  2KIZ A;  3T7L A;  2VPE A;  4ZDT A;  2JMI A;  2MA6 A;  3KNV A;  1FBV A;  2CSZ A;  2M1R A;  4N4F A;  2YYR A;  2KWK A;  4FJC A;  1WEW A;  4AYC A;  1WEO A;  5B77 A;  3DPL R;  3ASL A;  3DQV R;  2K1J A;  5LKZ A;  5I3L A;  2F6J A;  5LKX A;  3U5N A;  2YHN A;  2ECG A;  2LXH C;  2LXP C;  4WZ0 A;  2Y1N A;  1XWH A;  2FSA A;  4YBS A;  2YQM A;  5EYA F;  3T6R A;  1FP0 A;  2K16 A;  2VPD A;  3LQJ A;  2YSM A;  4CCG X;  3MHH A;  2EGP A;  1WGM A;  2CSY A;  4GNG A;  4I7C A;  3KV5 A;  1F62 A;  3C5K A;  4AYC B;  1JM7 A;  3ZPV E;  2MA5 A;  4B86 C;  1WEN A;  4R2Y A;  3EB6 A;  3L11 A;  1WEU A;  3O36 A;  4BBQ A;  3M99 A;  4GNF A;  2H0D B;  3ZNI A;  2HDP A;  4W4U A;  2ECV A;  5DKA A;  2MIQ A;  2QJ0 A;  4S3O C;  4FK5 A;  2KWJ A;  2L5U A;  4B7Y C;  4FO9 A;  1E4U A;  2NAA A;  1LDJ B;  1X4U A;  3VK6 A;  2LGL A;  3HCT A;  1JM7 B;  3LRQ A;  3GV4 A;  3U5O A;  2G45 A;  1K2F A;  2EOD A;  2M6M A;  3N9O A;  2E6S A;  4WA6 A;  1WEQ A;  3SOU A;  3M62 A;  4LK9 A;  4L58 A;  4YBT A;  2CKL B;  2YU4 A;  4O64 A;  1HYJ A;  3N9P A;  2AN6 A;  3C6W A;  2Y43 A;  3N9L A;  4YBM A;  2VP7 A;  1WIL A;  2RI7 A;  3RTR B;  2VPG A;  4AVX A;  4ZQL A;  3V43 A;  5FB0 A;  4YAB A;  2L43 A;  4LAD B;  2BAY A;  5C11 A;  5FB1 A;  5D1L B;  1LDK C;  1T1H A;  3O34 A;  2PNX A;  2G43 A;  3N9N A;  2M85 A;  2ECN A;  4Q6F A;  1WEV A;  1RMD A;  4BHW A;  5FEY A;  2VNF A;  4LJN A;  2KRE A;  1VD4 A;  4IC3 A;  2EA6 A;  2H0D A;  1WEE A;  2I50 A;  2LV9 A;  2VPB A;  3O35 A;  3RPG B;  2KFT A;  5D1M B;  3HCU A;  2C2V S;  2M3H A;  2D8S A;  2FUU A;  2MD7 B;  2LDR A;  2MUM A;  5B75 A;  4N3W A;  5B78 A;  2LGV A;  5C13 A;  4R7E A;  3KV6 A;  2L0B A;  4MVT A;  2C2L A;  4XI1 A;  4QF2 A;  4R8P K;  2IDA A;  2VJF A;  3ZVZ B;  3ZVY A;  3L1Z B;  3L1X A;  1MM2 A;  2CKL A;  2E6R A;  3N9Q A;  3LQI A;  4F52 B;  3ZPV 1;  4I7B A;  3SHB A;  2KWO A;  2ECT A;  5JG6 A;  2YSJ A;  5KH3 A;  5H1U A;  4IC2 A;  3U5M A;  5TRB A;  1VYX A;  1JOC A;  4UI9 B;  2KR4 A;  4GNE A;  2VJE B;  5KH9 A;  4TKP B;  2ECJ A;  5B76 A;  2KE1 A;  2F6N A;  4UP5 A;  2XEU A;  2KWN A;  3PHD A;  5FER A;  4I7D A;  3LQH A;  2YUC A;  1V87 A;  2YW8 A;  3MHS A;  5DIN A;  3ZTG A;  3SOX A;  2MNY A;  2MD8 C;  2VJF B;  2L75 A;  2RSD A;  4P5O B;  3FL2 A;  1HYI A;  4YC9 A;  3N9M A;  2JMJ A;  1CHC A;  5TAB A;  4PPE A;  2YRE A;  4AP4 A;  2LQ6 A;  2F42 A;  2ZET C;  3O37 A;  2LGG A;  2MNZ A;  2MT5 A;  5G05 B;  3SOW A;  4UP0 A;  2CT2 A;  1ZBD B;  4YAT A;  1WES A;  5LKU A;  5B79 A;  3KQI A;  5TBN A;  2YT5 A;  4LKA A;  3EB5 A;  3I2D A;  2KGI A;  1WE9 A;  2JMD A;  4GND A;  1G25 A;  4A49 A;  3O70 A;  4S3O B;  4YAX A;  3U5P A;  5H1V A;  2G6Q A;  3PUR A;  5AIU A;  1N87 A;  1MM3 A;  2LRI C;  4QF3 A;  4C9Z A;  1WEM A;  4AUQ B;  3IHP A;  2ECI A;  1WEP A;  1Z2Q A;  2LN0 A;  2DX8 A;  2YUR A;  2VJE A;  2OXQ C;  4X3G A;  1Z6U A;  2K4D A;  4A4B A;  4L7X A;  2JRJ A;  5TDW A;  2YHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...