4UI9B

Atomic structure of the human anaphase-promoting complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
b'MKVKIKCWNGVALWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
molecule tags Cell cycle
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ui9B00
5D1KB 5C13A 1WIMA 4N4FA 4F52B 4UI9B 2YHOA 3KNVA 2JMJA 3M63A 5B76A 4ZQLA 4YC9A 2E6RA 2PUYA 4L58A 2KGIA 5LKZA 2L5UA 3VK6A 2VJEA 4W4UA 2IDAA 4B7YC 2CKLA 4A49A 5LKTA 1MM2A 4CCGX 3EB5A 3O7AA 2F42A 2KYUA 3MHSA 1WEPA 2M6MA 2VP7A 4Q6FA 1WESA 4WZ0A 4YBMA 5B78A 2CKLB 5LCWB 1K2FA 4I7BA 3O70A 3KV5A 2G43A 2G45A 2MA5A 4NN2A 1WENA 2VNFA 4WZ3B 2ECIA 2YUCA 4TKPB 5H1UA 2L43A 4XI1A 4IC2A 3NG2A 5D1LB 4AYCA 1DVPA 3ZYQA 4N3WA 3N9QA 5AITA 2MT5A 5G0FA 2ECVA 5TBNA 1RMDA 1WEQA 3L1ZB 3KQIA 3ZPVE 2LV9A 1FBVA 5KH3A 4GB0A 4LJNA 5G04B 2KWKA 4WZ2A 2VJEB 2CT2A 3N9MA 2KWNA 2QJ0A 2XB1A 5EYAF 2YSJA 1G25A 3GL6A 2MD8C 3RPGB 1JOCA 3U5MA 2K1JA 3IHPA 5B79A 4LADB 2VJFA 3U5NA 4PPEA 1WEWA 1VFYA 5H1VA 1FP0A 2F6JA 4ZUXU 3HCUA 1WEMA 2ZETC 2LQ6A 2M1RA 2YT5A 3O37A 3ZVYA 1XWHA 2M3HA 1HYIA 2PNXA 2KE1A 1WFKA 1MM3A 3O36A 5C11A 4MSXA 5TABA 3LQHA 2LXPC 3N9OA 4FJCA 3O33A 2JMDA 5FERA 2FSAA 4R8PK 2K4DA 5DINA 3M62A 5DKAA 5TRBA 3RPGC 2VPBA 4AUQB 2MNYA 4YBSA 4O64A 2CSYA 4AP4A 3HTKC 1V87A 4CA1A 5KH7A 1N87A 1X4UA 4YAXA 3ASLA 2LDRA 4GNFA 3EB6A 2YU4A 3N9PA 1E4UA 2YURA 2D8SA 2C2VS 4YBTA 2FUUA 4ZDTA 5B75A 2H0DB 2L0BA 3SOXA 5TDRA 2VPDA 2F6NA 2KU3A 5LKXA 4LK9A 1WGMA 2FUIA 3LRQA 3U5OA 3RTRB 4MVTA 3N9LA 2KIZA 1WEUA 3I2DA 4GNDA 3PHDA 4A4CA 3V43A 4FIPA 3SOWA 1WE9A 5FEYA 3LQJA 4R7EA 1CHCA 2VJFB 1U6GB 4B86C 1T1HA 1F62A 1Z60A 4S3OC 3M99A 2KREA 5G05B 2KFTA 3L11A 2LGKA 4QF2A 2CSZA 2HYED 5D1MB 3C6WA 3PUQA 5B8DA 1X4JA 4YADA 2KGGA 2KR4A 4A4BA 2LN0A 2MUMA 2EGPA 1WEVA 1VD4A 2M85A 4LLBA 4LKAA 2Y43A 1WEOA 2KWOA 2L75A 1ZBDB 5H9MA 2C2LA 2LGGA 2DX8A 3PURA 2RSDA 3ZVZB 3DPLR 2LRIC 2RI7A 2ECWA 3QZVA 5H1TA 2VPEA 2BAYA 2HDPA 2YQLA 3LQIA 2EA6A 3U5PA 4C9ZA 4I7CA 3ZNIA 2EODA 2LXHC 2K17A 3L1XA 2QICA 2JMIA 4WA6A 1LDJB 2L80A 3DQVR 4YATA 3C5KA 4UP0A 1IYMA 2LGLA 2ECNA 2MIQA 4PTBA 4L7XA 2I50A 5J3XA 2QIZA 2YREA 2YYRA 3SHBA 3FL2A 2E6SA 3MHHA 2VPGA 3ZTGA 3N9NA 1X4IA 2UZGA 1HYJA 2NAAA 3GV4A 4S3OB 2ECJA 5FB1A 2MD7B 2LGVA 4IC3A 4AYCB 2ECGA 3KV6A 2H0DA 4FO9A 2G6QA 5AIUA 2Y1NA 4GNEA 2MA6A 4FK5A 4BBQA 2KWJA 3HCTA 4I7DA 4AVXA 3T7LA 3T6RA 1BORA 2JRJA 5KH9A 2Y1MA 5I3LA 2K16A 4BHWA 4P5OB 1LDKC 3ZPV1 4GNGA 3O35A 2MNZA 3HCSA 1Z2QA 1WILA 5TDWA 4X3GA 2YSMA 1JM7B 5JG6A 2YQMA 2XEUA 4QF3A 1Z6UA 5B77A 2YW8A 4YABA 4UP5A 5LKUA 2OXQC 4A0CD 4R2YA 4V3LC 1VYXA 2YHNA 4V3KC 5FB0A 3SOUA 2ECTA 3O34A 2AN6A 1JM7A 1WEEA
chains in the Genus database with same CATH superfamily
5D1KB 5C13A 1WIMA 1MBMA 4N4FA 2L7PA 4F52B 4UI9B 2YHOA 3KNVA 2JMJA 3M63A 5B76A 4ZQLA 4OGEA 4YC9A 2E6RA 2PUYA 4L58A 2KGIA 5LKZA 2L5UA 3VK6A 2VJEA 2E61A 4W4UA 2IDAA 4B7YC 2CKLA 4A49A 3FANA 5LKTA 1MM2A 4CCGX 3EB5A 3O7AA 4Z0OA 2DJAA 2F42A 2KYUA 3MHSA 1WEPA 2M6MA 2VP7A 4Q6FA 1WESA 4WZ0A 4YBMA 5B78A 2CKLB 5LCWB 1K2FA 4I7BA 3O70A 4Z0RA 3KV5A 2G43A 2G45A 2MA5A 4NN2A 1WENA 2VNFA 4WZ3B 2ECIA 2YUCA 4TKPB 2M13A 5H1UA 2L43A 4XI1A 4IC2A 3PLWA 3NG2A 5D1LB 2IQJA 4AYCA 1DVPA 3ZYQA 2B0OE 4N3WA 3N9QA 3LVRE 2FD4A 5AITA 2MT5A 5G0FA 2ECVA 5TBNA 1RMDA 1WEQA 2D8UA 3L1ZB 3KQIA 3ZPVE 2LV9A 1FBVA 5KH3A 4GB0A 3FM8C 5SVXA 4LJNA 5G04B 2KWKA 4WZ2A 2VJEB 2XOCA 2CT2A 3N9MA 2KWNA 2QJ0A 2XB1A 5EYAF 2YSJA 1G25A 3GL6A 3MDBC 2MD8C 3RPGB 1JOCA 3U5MA 2K1JA 5SVIB 3LVQE 3IHPA 5B79A 4LADB 2VJFA 3U5NA 4PPEA 2YVRA 1WEWA 1VFYA 5H1VA 1FP0A 2F6JA 4ZUXU 3HCUA 1WEMA 2ZETC 2LQ6A 2M1RA 2YT5A 3O37A 3ZVYA 1XWHA 2M3HA 1HYIA 2PNXA 2KE1A 2P57A 3JUEA 2CSVA 2XP0A 1WFKA 1MM3A 2XOZA 3O36A 5C11A 4MSXA 3T9KA 2OWAA 5TABA 3LQHA 2LXPC 3N9OA 4FJCA 2CONA 3FAOA 3O33A 2JMDA 5FERA 2FSAA 4R8PK 2K4DA 5DINA 3M62A 5DKAA 5TRBA 3RPGC 2VPBA 4AUQB 2MNYA 4YBSA 4O64A 2CSYA 4AP4A 2KKXA 3HTKC 1V87A 4CA1A 5KH7A 1N87A 1X4UA 4YAXA 3ASLA 5SVYA 2LDRA 4GNFA 3EB6A 2YU4A 3N9PA 1E4UA 2YURA 2D8SA 2XOYA 3LJUX 2C2VS 3E2DA 4YBTA 2FUUA 4ZDTA 5B75A 2H0DB 2L0BA 3SOXA 5TDRA 2VPDA 2F6NA 3FJUB 3SUBA 2KU3A 5K3QA 5LKXA 4LK9A 1WGMA 2FUIA 2CRWA 3LRQA 3U5OA 3RTRB 4MVTA 2LAUA 3N9LA 2KIZA 1WEUA 3I2DA 4GNDA 3PHDA 4A4CA 3V43A 4FIPA 3SOWA 1WE9A 5FEYA 3LQJA 4R7EA 1CHCA 2VJFB 3M7KA 1U6GB 4B86C 1T1HA 4QQ4A 1F62A 1Z60A 4S3OC 3M99A 3O47A 2KREA 5G05B 2KFTA 2JM3A 3L11A 2LGKA 2KKYA 4QF2A 2CSZA 2HYED 5D1MB 3C6WA 3PUQA 5B8DA 1X4JA 4YADA 2KGGA 2KR4A 4A4BA 2LN0A 2MUMA 2EGPA 1WEVA 1VD4A 2M85A 4LLBA 4LKAA 2Y43A 1WEOA 2KWOA 3H7HA 2L75A 1ZBDB 5H9MA 2C2LA 2LGGA 2DX8A 3PURA 2RSDA 3ZVZB 5SVIA 3DPLR 2LRIC 2RI7A 4H9DA 3FEHA 2ECWA 3QZVA 2CRRA 5H1TA 2VPEA 2EGMA 2BAYA 2HDPA 2YQLA 3LQIA 2EA6A 3U5PA 4C9ZA 4I7CA 3ZNIA 2EODA 2LXHC 2K17A 3L1XA 2QICA 2JMIA 4WA6A 1LDJB 2L80A 3DQVR 2RR4A 4YATA 3C5KA 4UP0A 1IYMA 2LGLA 2ECNA 2MIQA 3DDTA 4PTBA 4L7XA 2I50A 5J3XA 2QIZA 2YREA 4OGCA 1DCQA 2YYRA 3SHBA 3FL2A 2E6SA 3MHHA 2VPGA 3ZTGA 3N9NA 1X4IA 2UZGA 1HYJA 2NAAA 3GV4A 4S3OB 2ECJA 2FFWA 2JUNA 2MD7B 5FB1A 2LGVA 4IC3A 4AYCB 2ECGA 3KV6A 2H0DA 4FO9A 2G6QA 5AIUA 2Y1NA 4GNEA 2MA6A 4FK5A 4BBQA 2KWJA 3HCTA 4I7DA 4AVXA 3T7LA 3T6RA 4F1PA 1BORA 2JRJA 5KH9A 2Y1MA 5I3LA 2K16A 4BHWA 4P5OB 1LDKC 3ZPV1 4O62A 4GNGA 3O35A 2MNZA 3KDEC 3HCSA 1Z2QA 1WILA 2MKEA 5TDWA 4X3GA 2YSMA 1JM7B 5JG6A 2YQMA 2XEUA 3DWDA 4QF3A 1Z6UA 5B77A 2YW8A 4YABA 3LDYA 4UP5A 5LKUA 2OXQC 4A0CD 4R2YA 2EXUA 4V3LC 1VYXA 2YHNA 4V3KC 2DSMA 5FB0A 3SOUA 3Q1DA 2ECTA 3O34A 2AN6A 1JM7A 1WEEA
chains in the Genus database with same CATH topology
5D1KB 5C13A 1WIMA 4N4FA 4F52B 4UI9B 2YHOA 3KNVA 2JMJA 3M63A 5B76A 4ZQLA 4YC9A 2E6RA 2PUYA 4L58A 2KGIA 5LKZA 2L5UA 3VK6A 2VJEA 4W4UA 2IDAA 4B7YC 2CKLA 4A49A 5LKTA 1MM2A 4CCGX 3EB5A 3O7AA 2F42A 2KYUA 3MHSA 1WEPA 2M6MA 2VP7A 4Q6FA 1WESA 4WZ0A 4YBMA 5B78A 2CKLB 5LCWB 1K2FA 4I7BA 3O70A 3KV5A 2G43A 2G45A 2MA5A 4NN2A 1WENA 2VNFA 4WZ3B 2ECIA 2YUCA 4TKPB 5H1UA 2L43A 4XI1A 4IC2A 3NG2A 5D1LB 4AYCA 1DVPA 3ZYQA 4N3WA 3N9QA 5AITA 2MT5A 5G0FA 2ECVA 5TBNA 1RMDA 1WEQA 3L1ZB 3KQIA 3ZPVE 2LV9A 1FBVA 5KH3A 4GB0A 4LJNA 5G04B 2KWKA 4WZ2A 2VJEB 2CT2A 3N9MA 2KWNA 2QJ0A 2XB1A 5EYAF 2YSJA 1G25A 3GL6A 2MD8C 3RPGB 1JOCA 3U5MA 2K1JA 3IHPA 5B79A 4LADB 2VJFA 3U5NA 4PPEA 1WEWA 1VFYA 5H1VA 1FP0A 2F6JA 4ZUXU 3HCUA 1WEMA 2ZETC 2LQ6A 2M1RA 2YT5A 3O37A 3ZVYA 1XWHA 2M3HA 1HYIA 2PNXA 2KE1A 1WFKA 1MM3A 3O36A 5C11A 4MSXA 5TABA 3LQHA 2LXPC 3N9OA 4FJCA 3O33A 2JMDA 5FERA 2FSAA 4R8PK 2K4DA 5DINA 3M62A 5DKAA 5TRBA 3RPGC 2VPBA 4AUQB 2MNYA 4YBSA 4O64A 2CSYA 4AP4A 3HTKC 1V87A 4CA1A 5KH7A 1N87A 1X4UA 4YAXA 3ASLA 2LDRA 4GNFA 3EB6A 2YU4A 3N9PA 1E4UA 2YURA 2D8SA 2C2VS 4YBTA 2FUUA 4ZDTA 5B75A 2H0DB 2L0BA 3SOXA 5TDRA 2VPDA 2F6NA 2KU3A 5LKXA 4LK9A 1WGMA 2FUIA 3LRQA 3U5OA 3RTRB 4MVTA 3N9LA 2KIZA 1WEUA 3I2DA 4GNDA 3PHDA 4A4CA 3V43A 4FIPA 3SOWA 1WE9A 5FEYA 3LQJA 4R7EA 1CHCA 2VJFB 1U6GB 4B86C 1T1HA 1F62A 1Z60A 4S3OC 3M99A 2KREA 5G05B 2KFTA 3L11A 2LGKA 4QF2A 2CSZA 2HYED 5D1MB 3C6WA 3PUQA 5B8DA 1X4JA 4YADA 2KGGA 2KR4A 4A4BA 2LN0A 2MUMA 2EGPA 1WEVA 1VD4A 2M85A 4LLBA 4LKAA 2Y43A 1WEOA 2KWOA 2L75A 1ZBDB 5H9MA 2C2LA 2LGGA 2DX8A 3PURA 2RSDA 3ZVZB 3DPLR 2LRIC 2RI7A 2ECWA 3QZVA 5H1TA 2VPEA 2BAYA 2HDPA 2YQLA 3LQIA 2EA6A 3U5PA 4C9ZA 4I7CA 3ZNIA 2EODA 2LXHC 2K17A 3L1XA 2QICA 2JMIA 4WA6A 1LDJB 2L80A 3DQVR 4YATA 3C5KA 4UP0A 1IYMA 2LGLA 2ECNA 2MIQA 4PTBA 4L7XA 2I50A 5J3XA 2QIZA 2YREA 2YYRA 3SHBA 3FL2A 2E6SA 3MHHA 2VPGA 3ZTGA 3N9NA 1X4IA 2UZGA 1HYJA 2NAAA 3GV4A 4S3OB 2ECJA 5FB1A 2MD7B 2LGVA 4IC3A 4AYCB 2ECGA 3KV6A 2H0DA 4FO9A 2G6QA 5AIUA 2Y1NA 4GNEA 2MA6A 4FK5A 4BBQA 2KWJA 3HCTA 4I7DA 4AVXA 3T7LA 3T6RA 1BORA 2JRJA 5KH9A 2Y1MA 5I3LA 2K16A 4BHWA 4P5OB 1LDKC 3ZPV1 4GNGA 3O35A 2MNZA 3HCSA 1Z2QA 1WILA 5TDWA 4X3GA 2YSMA 1JM7B 5JG6A 2YQMA 2XEUA 4QF3A 1Z6UA 5B77A 2YW8A 4YABA 4UP5A 5LKUA 2OXQC 4A0CD 4R2YA 4V3LC 1VYXA 2YHNA 4V3KC 5FB0A 3SOUA 2ECTA 3O34A 2AN6A 1JM7A 1WEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1K B;  5C13 A;  1WIM A;  4N4F A;  4F52 B;  4UI9 B;  2YHO A;  3KNV A;  2JMJ A;  3M63 A;  5B76 A;  4ZQL A;  4YC9 A;  2E6R A;  2PUY A;  4L58 A;  2KGI A;  5LKZ A;  2L5U A;  3VK6 A;  2VJE A;  4W4U A;  2IDA A;  4B7Y C;  2CKL A;  4A49 A;  5LKT A;  1MM2 A;  4CCG X;  3EB5 A;  3O7A A;  2F42 A;  2KYU A;  3MHS A;  1WEP A;  2M6M A;  2VP7 A;  4Q6F A;  1WES A;  4WZ0 A;  4YBM A;  5B78 A;  2CKL B;  5LCW B;  1K2F A;  4I7B A;  3O70 A;  3KV5 A;  2G43 A;  2G45 A;  2MA5 A;  4NN2 A;  1WEN A;  2VNF A;  4WZ3 B;  2ECI A;  2YUC A;  4TKP B;  5H1U A;  2L43 A;  4XI1 A;  4IC2 A;  3NG2 A;  5D1L B;  4AYC A;  1DVP A;  3ZYQ A;  4N3W A;  3N9Q A;  5AIT A;  2MT5 A;  5G0F A;  2ECV A;  5TBN A;  1RMD A;  1WEQ A;  3L1Z B;  3KQI A;  3ZPV E;  2LV9 A;  1FBV A;  5KH3 A;  4GB0 A;  4LJN A;  5G04 B;  2KWK A;  4WZ2 A;  2VJE B;  2CT2 A;  3N9M A;  2KWN A;  2QJ0 A;  2XB1 A;  5EYA F;  2YSJ A;  1G25 A;  3GL6 A;  2MD8 C;  3RPG B;  1JOC A;  3U5M A;  2K1J A;  3IHP A;  5B79 A;  4LAD B;  2VJF A;  3U5N A;  4PPE A;  1WEW A;  1VFY A;  5H1V A;  1FP0 A;  2F6J A;  4ZUX U;  3HCU A;  1WEM A;  2ZET C;  2LQ6 A;  2M1R A;  2YT5 A;  3O37 A;  3ZVY A;  1XWH A;  2M3H A;  1HYI A;  2PNX A;  2KE1 A;  1WFK A;  1MM3 A;  3O36 A;  5C11 A;  4MSX A;  5TAB A;  3LQH A;  2LXP C;  3N9O A;  4FJC A;  3O33 A;  2JMD A;  5FER A;  2FSA A;  4R8P K;  2K4D A;  5DIN A;  3M62 A;  5DKA A;  5TRB A;  3RPG C;  2VPB A;  4AUQ B;  2MNY A;  4YBS A;  4O64 A;  2CSY A;  4AP4 A;  3HTK C;  1V87 A;  4CA1 A;  5KH7 A;  1N87 A;  1X4U A;  4YAX A;  3ASL A;  2LDR A;  4GNF A;  3EB6 A;  2YU4 A;  3N9P A;  1E4U A;  2YUR A;  2D8S A;  2C2V S;  4YBT A;  2FUU A;  4ZDT A;  5B75 A;  2H0D B;  2L0B A;  3SOX A;  5TDR A;  2VPD A;  2F6N A;  2KU3 A;  5LKX A;  4LK9 A;  1WGM A;  2FUI A;  3LRQ A;  3U5O A;  3RTR B;  4MVT A;  3N9L A;  2KIZ A;  1WEU A;  3I2D A;  4GND A;  3PHD A;  4A4C A;  3V43 A;  4FIP A;  3SOW A;  1WE9 A;  5FEY A;  3LQJ A;  4R7E A;  1CHC A;  2VJF B;  1U6G B;  4B86 C;  1T1H A;  1F62 A;  1Z60 A;  4S3O C;  3M99 A;  2KRE A;  5G05 B;  2KFT A;  3L11 A;  2LGK A;  4QF2 A;  2CSZ A;  2HYE D;  5D1M B;  3C6W A;  3PUQ A;  5B8D A;  1X4J A;  4YAD A;  2KGG A;  2KR4 A;  4A4B A;  2LN0 A;  2MUM A;  2EGP A;  1WEV A;  1VD4 A;  2M85 A;  4LLB A;  4LKA A;  2Y43 A;  1WEO A;  2KWO A;  2L75 A;  1ZBD B;  5H9M A;  2C2L A;  2LGG A;  2DX8 A;  3PUR A;  2RSD A;  3ZVZ B;  3DPL R;  2LRI C;  2RI7 A;  2ECW A;  3QZV A;  5H1T A;  2VPE A;  2BAY A;  2HDP A;  2YQL A;  3LQI A;  2EA6 A;  3U5P A;  4C9Z A;  4I7C A;  3ZNI A;  2EOD A;  2LXH C;  2K17 A;  3L1X A;  2QIC A;  2JMI A;  4WA6 A;  1LDJ B;  2L80 A;  3DQV R;  4YAT A;  3C5K A;  4UP0 A;  1IYM A;  2LGL A;  2ECN A;  2MIQ A;  4PTB A;  4L7X A;  2I50 A;  5J3X A;  2QIZ A;  2YRE A;  2YYR A;  3SHB A;  3FL2 A;  2E6S A;  3MHH A;  2VPG A;  3ZTG A;  3N9N A;  1X4I A;  2UZG A;  1HYJ A;  2NAA A;  3GV4 A;  4S3O B;  2ECJ A;  5FB1 A;  2MD7 B;  2LGV A;  4IC3 A;  4AYC B;  2ECG A;  3KV6 A;  2H0D A;  4FO9 A;  2G6Q A;  5AIU A;  2Y1N A;  4GNE A;  2MA6 A;  4FK5 A;  4BBQ A;  2KWJ A;  3HCT A;  4I7D A;  4AVX A;  3T7L A;  3T6R A;  1BOR A;  2JRJ A;  5KH9 A;  2Y1M A;  5I3L A;  2K16 A;  4BHW A;  4P5O B;  1LDK C;  3ZPV 1;  4GNG A;  3O35 A;  2MNZ A;  3HCS A;  1Z2Q A;  1WIL A;  5TDW A;  4X3G A;  2YSM A;  1JM7 B;  5JG6 A;  2YQM A;  2XEU A;  4QF3 A;  1Z6U A;  5B77 A;  2YW8 A;  4YAB A;  4UP5 A;  5LKU A;  2OXQ C;  4A0C D;  4R2Y A;  4V3L C;  1VYX A;  2YHN A;  4V3K C;  5FB0 A;  3SOU A;  2ECT A;  3O34 A;  2AN6 A;  1JM7 A;  1WEE A; 
#chains in the Genus database with same CATH topology
 5D1K B;  5C13 A;  1WIM A;  1MBM A;  4N4F A;  2L7P A;  4F52 B;  4UI9 B;  2YHO A;  3KNV A;  2JMJ A;  3M63 A;  5B76 A;  4ZQL A;  4OGE A;  4YC9 A;  2E6R A;  2PUY A;  4L58 A;  2KGI A;  5LKZ A;  2L5U A;  3VK6 A;  2VJE A;  2E61 A;  4W4U A;  2IDA A;  4B7Y C;  2CKL A;  4A49 A;  3FAN A;  5LKT A;  1MM2 A;  4CCG X;  3EB5 A;  3O7A A;  4Z0O A;  2DJA A;  2F42 A;  2KYU A;  3MHS A;  1WEP A;  2M6M A;  2VP7 A;  4Q6F A;  1WES A;  4WZ0 A;  4YBM A;  5B78 A;  2CKL B;  5LCW B;  1K2F A;  4I7B A;  3O70 A;  4Z0R A;  3KV5 A;  2G43 A;  2G45 A;  2MA5 A;  4NN2 A;  1WEN A;  2VNF A;  4WZ3 B;  2ECI A;  2YUC A;  4TKP B;  2M13 A;  5H1U A;  2L43 A;  4XI1 A;  4IC2 A;  3PLW A;  3NG2 A;  5D1L B;  2IQJ A;  4AYC A;  1DVP A;  3ZYQ A;  2B0O E;  4N3W A;  3N9Q A;  3LVR E;  2FD4 A;  5AIT A;  2MT5 A;  5G0F A;  2ECV A;  5TBN A;  1RMD A;  1WEQ A;  2D8U A;  3L1Z B;  3KQI A;  3ZPV E;  2LV9 A;  1FBV A;  5KH3 A;  4GB0 A;  3FM8 C;  5SVX A;  4LJN A;  5G04 B;  2KWK A;  4WZ2 A;  2VJE B;  2XOC A;  2CT2 A;  3N9M A;  2KWN A;  2QJ0 A;  2XB1 A;  5EYA F;  2YSJ A;  1G25 A;  3GL6 A;  3MDB C;  2MD8 C;  3RPG B;  1JOC A;  3U5M A;  2K1J A;  5SVI B;  3LVQ E;  3IHP A;  5B79 A;  4LAD B;  2VJF A;  3U5N A;  4PPE A;  2YVR A;  1WEW A;  1VFY A;  5H1V A;  1FP0 A;  2F6J A;  4ZUX U;  3HCU A;  1WEM A;  2ZET C;  2LQ6 A;  2M1R A;  2YT5 A;  3O37 A;  3ZVY A;  1XWH A;  2M3H A;  1HYI A;  2PNX A;  2KE1 A;  2P57 A;  3JUE A;  2CSV A;  2XP0 A;  1WFK A;  1MM3 A;  2XOZ A;  3O36 A;  5C11 A;  4MSX A;  3T9K A;  2OWA A;  5TAB A;  3LQH A;  2LXP C;  3N9O A;  4FJC A;  2CON A;  3FAO A;  3O33 A;  2JMD A;  5FER A;  2FSA A;  4R8P K;  2K4D A;  5DIN A;  3M62 A;  5DKA A;  5TRB A;  3RPG C;  2VPB A;  4AUQ B;  2MNY A;  4YBS A;  4O64 A;  2CSY A;  4AP4 A;  2KKX A;  3HTK C;  1V87 A;  4CA1 A;  5KH7 A;  1N87 A;  1X4U A;  4YAX A;  3ASL A;  5SVY A;  2LDR A;  4GNF A;  3EB6 A;  2YU4 A;  3N9P A;  1E4U A;  2YUR A;  2D8S A;  2XOY A;  3LJU X;  2C2V S;  3E2D A;  4YBT A;  2FUU A;  4ZDT A;  5B75 A;  2H0D B;  2L0B A;  3SOX A;  5TDR A;  2VPD A;  2F6N A;  3FJU B;  3SUB A;  2KU3 A;  5K3Q A;  5LKX A;  4LK9 A;  1WGM A;  2FUI A;  2CRW A;  3LRQ A;  3U5O A;  3RTR B;  4MVT A;  2LAU A;  3N9L A;  2KIZ A;  1WEU A;  3I2D A;  4GND A;  3PHD A;  4A4C A;  3V43 A;  4FIP A;  3SOW A;  1WE9 A;  5FEY A;  3LQJ A;  4R7E A;  1CHC A;  2VJF B;  3M7K A;  1U6G B;  4B86 C;  1T1H A;  4QQ4 A;  1F62 A;  1Z60 A;  4S3O C;  3M99 A;  3O47 A;  2KRE A;  5G05 B;  2KFT A;  2JM3 A;  3L11 A;  2LGK A;  2KKY A;  4QF2 A;  2CSZ A;  2HYE D;  5D1M B;  3C6W A;  3PUQ A;  5B8D A;  1X4J A;  4YAD A;  2KGG A;  2KR4 A;  4A4B A;  2LN0 A;  2MUM A;  2EGP A;  1WEV A;  1VD4 A;  2M85 A;  4LLB A;  4LKA A;  2Y43 A;  1WEO A;  2KWO A;  3H7H A;  2L75 A;  1ZBD B;  5H9M A;  2C2L A;  2LGG A;  2DX8 A;  3PUR A;  2RSD A;  3ZVZ B;  5SVI A;  3DPL R;  2LRI C;  2RI7 A;  4H9D A;  3FEH A;  2ECW A;  3QZV A;  2CRR A;  5H1T A;  2VPE A;  2EGM A;  2BAY A;  2HDP A;  2YQL A;  3LQI A;  2EA6 A;  3U5P A;  4C9Z A;  4I7C A;  3ZNI A;  2EOD A;  2LXH C;  2K17 A;  3L1X A;  2QIC A;  2JMI A;  4WA6 A;  1LDJ B;  2L80 A;  3DQV R;  2RR4 A;  4YAT A;  3C5K A;  4UP0 A;  1IYM A;  2LGL A;  2ECN A;  2MIQ A;  3DDT A;  4PTB A;  4L7X A;  2I50 A;  5J3X A;  2QIZ A;  2YRE A;  4OGC A;  1DCQ A;  2YYR A;  3SHB A;  3FL2 A;  2E6S A;  3MHH A;  2VPG A;  3ZTG A;  3N9N A;  1X4I A;  2UZG A;  1HYJ A;  2NAA A;  3GV4 A;  4S3O B;  2ECJ A;  2FFW A;  2JUN A;  2MD7 B;  5FB1 A;  2LGV A;  4IC3 A;  4AYC B;  2ECG A;  3KV6 A;  2H0D A;  4FO9 A;  2G6Q A;  5AIU A;  2Y1N A;  4GNE A;  2MA6 A;  4FK5 A;  4BBQ A;  2KWJ A;  3HCT A;  4I7D A;  4AVX A;  3T7L A;  3T6R A;  4F1P A;  1BOR A;  2JRJ A;  5KH9 A;  2Y1M A;  5I3L A;  2K16 A;  4BHW A;  4P5O B;  1LDK C;  3ZPV 1;  4O62 A;  4GNG A;  3O35 A;  2MNZ A;  3KDE C;  3HCS A;  1Z2Q A;  1WIL A;  2MKE A;  5TDW A;  4X3G A;  2YSM A;  1JM7 B;  5JG6 A;  2YQM A;  2XEU A;  3DWD A;  4QF3 A;  1Z6U A;  5B77 A;  2YW8 A;  4YAB A;  3LDY A;  4UP5 A;  5LKU A;  2OXQ C;  4A0C D;  4R2Y A;  2EXU A;  4V3L C;  1VYX A;  2YHN A;  4V3K C;  2DSM A;  5FB0 A;  3SOU A;  3Q1D A;  2ECT A;  3O34 A;  2AN6 A;  1JM7 A;  1WEE A; 
#chains in the Genus database with same CATH homology
 5D1K B;  5C13 A;  1WIM A;  4N4F A;  4F52 B;  4UI9 B;  2YHO A;  3KNV A;  2JMJ A;  3M63 A;  5B76 A;  4ZQL A;  4YC9 A;  2E6R A;  2PUY A;  4L58 A;  2KGI A;  5LKZ A;  2L5U A;  3VK6 A;  2VJE A;  4W4U A;  2IDA A;  4B7Y C;  2CKL A;  4A49 A;  5LKT A;  1MM2 A;  4CCG X;  3EB5 A;  3O7A A;  2F42 A;  2KYU A;  3MHS A;  1WEP A;  2M6M A;  2VP7 A;  4Q6F A;  1WES A;  4WZ0 A;  4YBM A;  5B78 A;  2CKL B;  5LCW B;  1K2F A;  4I7B A;  3O70 A;  3KV5 A;  2G43 A;  2G45 A;  2MA5 A;  4NN2 A;  1WEN A;  2VNF A;  4WZ3 B;  2ECI A;  2YUC A;  4TKP B;  5H1U A;  2L43 A;  4XI1 A;  4IC2 A;  3NG2 A;  5D1L B;  4AYC A;  1DVP A;  3ZYQ A;  4N3W A;  3N9Q A;  5AIT A;  2MT5 A;  5G0F A;  2ECV A;  5TBN A;  1RMD A;  1WEQ A;  3L1Z B;  3KQI A;  3ZPV E;  2LV9 A;  1FBV A;  5KH3 A;  4GB0 A;  4LJN A;  5G04 B;  2KWK A;  4WZ2 A;  2VJE B;  2CT2 A;  3N9M A;  2KWN A;  2QJ0 A;  2XB1 A;  5EYA F;  2YSJ A;  1G25 A;  3GL6 A;  2MD8 C;  3RPG B;  1JOC A;  3U5M A;  2K1J A;  3IHP A;  5B79 A;  4LAD B;  2VJF A;  3U5N A;  4PPE A;  1WEW A;  1VFY A;  5H1V A;  1FP0 A;  2F6J A;  4ZUX U;  3HCU A;  1WEM A;  2ZET C;  2LQ6 A;  2M1R A;  2YT5 A;  3O37 A;  3ZVY A;  1XWH A;  2M3H A;  1HYI A;  2PNX A;  2KE1 A;  1WFK A;  1MM3 A;  3O36 A;  5C11 A;  4MSX A;  5TAB A;  3LQH A;  2LXP C;  3N9O A;  4FJC A;  3O33 A;  2JMD A;  5FER A;  2FSA A;  4R8P K;  2K4D A;  5DIN A;  3M62 A;  5DKA A;  5TRB A;  3RPG C;  2VPB A;  4AUQ B;  2MNY A;  4YBS A;  4O64 A;  2CSY A;  4AP4 A;  3HTK C;  1V87 A;  4CA1 A;  5KH7 A;  1N87 A;  1X4U A;  4YAX A;  3ASL A;  2LDR A;  4GNF A;  3EB6 A;  2YU4 A;  3N9P A;  1E4U A;  2YUR A;  2D8S A;  2C2V S;  4YBT A;  2FUU A;  4ZDT A;  5B75 A;  2H0D B;  2L0B A;  3SOX A;  5TDR A;  2VPD A;  2F6N A;  2KU3 A;  5LKX A;  4LK9 A;  1WGM A;  2FUI A;  3LRQ A;  3U5O A;  3RTR B;  4MVT A;  3N9L A;  2KIZ A;  1WEU A;  3I2D A;  4GND A;  3PHD A;  4A4C A;  3V43 A;  4FIP A;  3SOW A;  1WE9 A;  5FEY A;  3LQJ A;  4R7E A;  1CHC A;  2VJF B;  1U6G B;  4B86 C;  1T1H A;  1F62 A;  1Z60 A;  4S3O C;  3M99 A;  2KRE A;  5G05 B;  2KFT A;  3L11 A;  2LGK A;  4QF2 A;  2CSZ A;  2HYE D;  5D1M B;  3C6W A;  3PUQ A;  5B8D A;  1X4J A;  4YAD A;  2KGG A;  2KR4 A;  4A4B A;  2LN0 A;  2MUM A;  2EGP A;  1WEV A;  1VD4 A;  2M85 A;  4LLB A;  4LKA A;  2Y43 A;  1WEO A;  2KWO A;  2L75 A;  1ZBD B;  5H9M A;  2C2L A;  2LGG A;  2DX8 A;  3PUR A;  2RSD A;  3ZVZ B;  3DPL R;  2LRI C;  2RI7 A;  2ECW A;  3QZV A;  5H1T A;  2VPE A;  2BAY A;  2HDP A;  2YQL A;  3LQI A;  2EA6 A;  3U5P A;  4C9Z A;  4I7C A;  3ZNI A;  2EOD A;  2LXH C;  2K17 A;  3L1X A;  2QIC A;  2JMI A;  4WA6 A;  1LDJ B;  2L80 A;  3DQV R;  4YAT A;  3C5K A;  4UP0 A;  1IYM A;  2LGL A;  2ECN A;  2MIQ A;  4PTB A;  4L7X A;  2I50 A;  5J3X A;  2QIZ A;  2YRE A;  2YYR A;  3SHB A;  3FL2 A;  2E6S A;  3MHH A;  2VPG A;  3ZTG A;  3N9N A;  1X4I A;  2UZG A;  1HYJ A;  2NAA A;  3GV4 A;  4S3O B;  2ECJ A;  5FB1 A;  2MD7 B;  2LGV A;  4IC3 A;  4AYC B;  2ECG A;  3KV6 A;  2H0D A;  4FO9 A;  2G6Q A;  5AIU A;  2Y1N A;  4GNE A;  2MA6 A;  4FK5 A;  4BBQ A;  2KWJ A;  3HCT A;  4I7D A;  4AVX A;  3T7L A;  3T6R A;  1BOR A;  2JRJ A;  5KH9 A;  2Y1M A;  5I3L A;  2K16 A;  4BHW A;  4P5O B;  1LDK C;  3ZPV 1;  4GNG A;  3O35 A;  2MNZ A;  3HCS A;  1Z2Q A;  1WIL A;  5TDW A;  4X3G A;  2YSM A;  1JM7 B;  5JG6 A;  2YQM A;  2XEU A;  4QF3 A;  1Z6U A;  5B77 A;  2YW8 A;  4YAB A;  4UP5 A;  5LKU A;  2OXQ C;  4A0C D;  4R2Y A;  4V3L C;  1VYX A;  2YHN A;  4V3K C;  5FB0 A;  3SOU A;  2ECT A;  3O34 A;  2AN6 A;  1JM7 A;  1WEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...