4UI9B

Atomic structure of the human anaphase-promoting complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
MKVKIKCWNGVALWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ui9B00
2NAAA 3PURA 5B79A 3MHSA 2C2VS 5DKAA 2UZGA 2LQ6A 5B78A 2YHNA 2M85A 2ECTA 2KU3A 4WA6A 1F62A 4UP5A 2YUCA 2OXQC 4GNGA 2DX8A 1MM3A 5H9MA 4YATA 5B75A 4UI9B 2JRJA 1N87A 2K16A 2YYRA 4MVTA 1K2FA 2YHOA 5B8DA 2L5UA 1WESA 4WZ0A 4A4BA 2CT2A 3SHBA 3NG2A 3LQJA 2D8SA 5FEYA 3PHDA 2KE1A 2FSAA 2MNYA 4ZUXU 1WEPA 2YURA 1WEOA 4Q6FA 2F42A 2VP7A 2KYUA 1X4JA 4AYCB 3U5PA 2LDRA 3O37A 1T1HA 2MD7B 1WGMA 2LXPC 2H0DB 4YBMA 4V3KC 4UP0A 4GNFA 4BBQA 3IHPA 2XB1A 5LKXA 4B86C 2YW8A 4S3OB 2K17A 3M99A 2VJEB 1WILA 4CCGX 5C13A 1FBVA 2RI7A 2EGPA 1WEUA 3RPGC 4N4FA 2KWKA 2PNXA 2YQMA 5LKTA 2QICA 3SOXA 2YSJA 1X4UA 3N9MA 1MM2A 2ECJA 2JMIA 5G0FA 1HYJA 5TRBA 5D1LB 3RTRB 2KWJA 3KQIA 3MHHA 5FERA 5TDWA 2KWOA 1VYXA 2LN0A 3N9OA 2YU4A 2EA6A 4WZ3B 4AVXA 4PTBA 1ZBDB 1Z6UA 2K1JA 1Z60A 2MUMA 5DINA 5G05B 3ASLA 2M3HA 3ZYQA 4TKPB 3GV4A 4X3GA 2CKLA 4P5OB 1WIMA 4I7BA 5TABA 4YC9A 3O34A 4GNEA 4LK9A 5C11A 1JOCA 2QIZA 4FIPA 2LGGA 2M6MA 3HCUA 3FL2A 4FO9A 5FB0A 5KH7A 3HCSA 2Y1MA 2LXHC 4A4CA 4AUQB 1U6GB 4CA1A 5KH3A 3LQIA 5FB1A 4IC3A 1WFKA 4I7DA 2LV9A 3T6RA 4BHWA 1Z2QA 2LGLA 4MSXA 3HTKC 3KV6A 2RSDA 4PPEA 3SOWA 2VPDA 3ZNIA 5LKUA 1CHCA 5TDRA 3GL6A 1V87A 2XEUA 4NN2A 1RMDA 5AITA 2HYED 2KFTA 2KR4A 4LADB 4LKAA 1IYMA 1LDJB 2JMDA 4O64A 1HYIA 2VNFA 3KV5A 2K4DA 2MD8C 3N9NA 2VPGA 3EB6A 4I7CA 3LRQA 2ECGA 3ZPV1 5AIUA 4YADA 3L1XA 5B77A 2YQLA 1WEEA 2KIZA 3L11A 1WEWA 2MNZA 5TBNA 3N9QA 3ZVZB 2YT5A 2MA6A 2L80A 2VJFA 2ZETC 4R7EA 3RPGB 2ECIA 4C9ZA 2AN6A 2IDAA 2CKLB 3ZPVE 4GNDA 1FP0A 1DVPA 3DQVR 2ECWA 3ZTGA 5I3LA 4F52B 4W4UA 3N9LA 1WENA 1WEVA 2MIQA 3O70A 5JG6A 3HCTA 2L0BA 3U5NA 3N9PA 4YBSA 3M62A 3O35A 1JM7A 4A49A 5H1VA 2L75A 5EYAF 3L1ZB 4V3LC 2LRIC 1X4IA 3M63A 4L58A 4A0CD 5H1TA 2ECVA 2L43A 3U5MA 4WZ2A 2MA5A 1VD4A 5B76A 5D1MB 1E4UA 2QJ0A 4AP4A 5J3XA 4R2YA 2E6SA 2FUIA 4LJNA 2YSMA 1XWHA 2ECNA 2KGGA 1LDKC 2HDPA 3O36A 5KH9A 2G45A 4N3WA 3T7LA 3C5KA 2MT5A 3U5OA 4XI1A 4ZQLA 3O33A 5LCWB 4FK5A 1WEMA 2M1RA 2FUUA 2VJFB 3QZVA 3I2DA 4LLBA 5LKZA 2G43A 3EB5A 2YREA 1G25A 2VPBA 4B7YC 1WE9A 2BAYA 4IC2A 2PUYA 2LGVA 4YABA 4S3OC 3O7AA 4YBTA 2Y43A 2C2LA 3C6WA 4L7XA 4YAXA 1VFYA 5D1KB 2EODA 5G04B 2F6NA 3DPLR 2F6JA 1JM7B 3VK6A 3PUQA 4AYCA 2I50A 3LQHA 2H0DA 2KGIA 4ZDTA 2KWNA 2E6RA 4GB0A 2VPEA 1WEQA 3V43A 2CSZA 5H1UA 2LGKA 4FJCA 2KREA 2JMJA 4QF3A 2VJEA 3KNVA 3ZVYA 2CSYA 2G6QA 3SOUA 2Y1NA 4QF2A 4R8PK 1BORA
chains in the Genus database with same CATH superfamily
3FM8C 2DSMA 2NAAA 3PURA 5B79A 3MHSA 3O47A 2C2VS 5DKAA 3DDTA 2UZGA 2LQ6A 5B78A 2YHNA 2M85A 2ECTA 2KU3A 4WA6A 1F62A 4UP5A 2YUCA 2OXQC 4GNGA 2DX8A 1MM3A 5H9MA 4YATA 2XOZA 5B75A 4UI9B 2JRJA 1N87A 2K16A 2YYRA 2MKEA 4OGEA 4MVTA 1K2FA 2XP0A 2YHOA 5B8DA 2L5UA 1WESA 4WZ0A 4A4BA 2KKYA 2CT2A 3SHBA 3NG2A 3LQJA 2D8SA 5FEYA 5K3QA 3PHDA 2KE1A 2FSAA 2MNYA 4ZUXU 2E61A 1WEPA 2YURA 1WEOA 4Q6FA 2F42A 2VP7A 2KYUA 1X4JA 4AYCB 3U5PA 2LDRA 3O37A 1T1HA 2MD7B 1WGMA 4Z0RA 2LXPC 2H0DB 4YBMA 5SVXA 4V3KC 4UP0A 2M13A 4GNFA 4BBQA 3IHPA 2YVRA 3Q1DA 2XB1A 5LKXA 3LJUX 4B86C 2YW8A 4S3OB 2K17A 3M99A 2VJEB 1WILA 4CCGX 2EXUA 5C13A 1FBVA 3FEHA 2RI7A 2EGPA 1WEUA 3RPGC 4N4FA 2KWKA 2PNXA 2YQMA 5LKTA 2QICA 3SOXA 2YSJA 1X4UA 2CSVA 3N9MA 1MM2A 2ECJA 2JMIA 5G0FA 1HYJA 5TRBA 3M7KA 5D1LB 3RTRB 2KWJA 3KQIA 3MHHA 5FERA 5TDWA 2KWOA 1VYXA 4Z0OA 2LN0A 2D8UA 3N9OA 2YU4A 2EA6A 4WZ3B 4AVXA 4PTBA 1ZBDB 1Z6UA 2K1JA 3FANA 1Z60A 2MUMA 5DINA 5G05B 3ASLA 2JUNA 2M3HA 3ZYQA 4TKPB 3GV4A 4X3GA 2CKLA 4P5OB 3PLWA 1WIMA 4I7BA 2CRRA 5TABA 2EGMA 4YC9A 3O34A 4GNEA 4LK9A 5C11A 1JOCA 2QIZA 4FIPA 2LGGA 2M6MA 3HCUA 3FL2A 4FO9A 5FB0A 5KH7A 3HCSA 2Y1MA 2LXHC 3JUEA 4A4CA 4AUQB 1U6GB 4CA1A 2XOCA 5KH3A 3LQIA 5FB1A 4IC3A 1WFKA 4I7DA 2LV9A 3T6RA 4BHWA 1Z2QA 2LGLA 4MSXA 4H9DA 3HTKC 3KV6A 2RSDA 4PPEA 3SOWA 2VPDA 2KKXA 3ZNIA 5LKUA 1CHCA 1MBMA 5TDRA 3GL6A 1V87A 2XEUA 2P57A 4NN2A 1RMDA 5AITA 2JM3A 2HYED 2KFTA 2KR4A 4LADB 4LKAA 1IYMA 1LDJB 2JMDA 4O64A 3E2DA 1HYIA 2VNFA 3KV5A 2K4DA 2MD8C 3N9NA 3DWDA 2VPGA 3EB6A 4I7CA 3LRQA 2ECGA 1DCQA 3ZPV1 5AIUA 4YADA 3L1XA 5B77A 2YQLA 1WEEA 2KIZA 3L11A 1WEWA 2MNZA 5TBNA 3N9QA 3ZVZB 2YT5A 3FJUB 2MA6A 2L80A 2VJFA 2ZETC 4R7EA 3RPGB 2ECIA 4C9ZA 2AN6A 2IDAA 2CKLB 3ZPVE 4GNDA 1FP0A 1DVPA 3DQVR 2B0OE 2ECWA 3ZTGA 5I3LA 4F52B 4W4UA 3N9LA 1WENA 2DJAA 1WEVA 2MIQA 3O70A 5JG6A 3HCTA 2L0BA 3U5NA 3N9PA 4YBSA 3M62A 3O35A 1JM7A 2CONA 4A49A 2LAUA 5H1VA 2L75A 5EYAF 3L1ZB 4V3LC 2LRIC 1X4IA 3M63A 4L58A 4A0CD 5H1TA 2ECVA 3T9KA 2L43A 3U5MA 4WZ2A 2MA5A 1VD4A 5SVIA 5B76A 5D1MB 1E4UA 4OGCA 2QJ0A 4AP4A 2FD4A 4O62A 5J3XA 4QQ4A 3KDEC 4R2YA 3LVQE 2E6SA 2FUIA 4LJNA 2YSMA 1XWHA 2ECNA 2KGGA 1LDKC 2L7PA 2RR4A 2HDPA 3O36A 5KH9A 2G45A 4N3WA 3T7LA 3C5KA 2MT5A 3U5OA 4XI1A 4ZQLA 3O33A 5LCWB 4FK5A 1WEMA 2M1RA 2FUUA 2VJFB 3MDBC 3QZVA 2FFWA 3I2DA 4LLBA 5LKZA 2IQJA 3LDYA 2G43A 2XOYA 3EB5A 2YREA 1G25A 2VPBA 4B7YC 1WE9A 2BAYA 4IC2A 3H7HA 2PUYA 2LGVA 4YABA 4S3OC 3O7AA 4YBTA 2Y43A 2C2LA 3C6WA 4L7XA 5SVYA 4YAXA 1VFYA 5D1KB 2EODA 5G04B 2F6NA 3DPLR 2F6JA 1JM7B 3VK6A 3PUQA 4AYCA 2I50A 3FAOA 3LQHA 2H0DA 2KGIA 4ZDTA 2KWNA 2E6RA 4GB0A 2VPEA 4F1PA 1WEQA 3LVRE 3V43A 2CSZA 5H1UA 2LGKA 4FJCA 2KREA 2JMJA 4QF3A 2VJEA 5SVIB 3SUBA 2CRWA 3KNVA 3ZVYA 2CSYA 2OWAA 2G6QA 3SOUA 2Y1NA 4QF2A 4R8PK 1BORA
chains in the Genus database with same CATH topology
2NAAA 3PURA 5B79A 3MHSA 2C2VS 5DKAA 2UZGA 2LQ6A 5B78A 2YHNA 2M85A 2ECTA 2KU3A 4WA6A 1F62A 4UP5A 2YUCA 2OXQC 4GNGA 2DX8A 1MM3A 5H9MA 4YATA 5B75A 4UI9B 2JRJA 1N87A 2K16A 2YYRA 4MVTA 1K2FA 2YHOA 5B8DA 2L5UA 1WESA 4WZ0A 4A4BA 2CT2A 3SHBA 3NG2A 3LQJA 2D8SA 5FEYA 3PHDA 2KE1A 2FSAA 2MNYA 4ZUXU 1WEPA 2YURA 1WEOA 4Q6FA 2F42A 2VP7A 2KYUA 1X4JA 4AYCB 3U5PA 2LDRA 3O37A 1T1HA 2MD7B 1WGMA 2LXPC 2H0DB 4YBMA 4V3KC 4UP0A 4GNFA 4BBQA 3IHPA 2XB1A 5LKXA 4B86C 2YW8A 4S3OB 2K17A 3M99A 2VJEB 1WILA 4CCGX 5C13A 1FBVA 2RI7A 2EGPA 1WEUA 3RPGC 4N4FA 2KWKA 2PNXA 2YQMA 5LKTA 2QICA 3SOXA 2YSJA 1X4UA 3N9MA 1MM2A 2ECJA 2JMIA 5G0FA 1HYJA 5TRBA 5D1LB 3RTRB 2KWJA 3KQIA 3MHHA 5FERA 5TDWA 2KWOA 1VYXA 2LN0A 3N9OA 2YU4A 2EA6A 4WZ3B 4AVXA 4PTBA 1ZBDB 1Z6UA 2K1JA 1Z60A 2MUMA 5DINA 5G05B 3ASLA 2M3HA 3ZYQA 4TKPB 3GV4A 4X3GA 2CKLA 4P5OB 1WIMA 4I7BA 5TABA 4YC9A 3O34A 4GNEA 4LK9A 5C11A 1JOCA 2QIZA 4FIPA 2LGGA 2M6MA 3HCUA 3FL2A 4FO9A 5FB0A 5KH7A 3HCSA 2Y1MA 2LXHC 4A4CA 4AUQB 1U6GB 4CA1A 5KH3A 3LQIA 5FB1A 4IC3A 1WFKA 4I7DA 2LV9A 3T6RA 4BHWA 1Z2QA 2LGLA 4MSXA 3HTKC 3KV6A 2RSDA 4PPEA 3SOWA 2VPDA 3ZNIA 5LKUA 1CHCA 5TDRA 3GL6A 1V87A 2XEUA 4NN2A 1RMDA 5AITA 2HYED 2KFTA 2KR4A 4LADB 4LKAA 1IYMA 1LDJB 2JMDA 4O64A 1HYIA 2VNFA 3KV5A 2K4DA 2MD8C 3N9NA 2VPGA 3EB6A 4I7CA 3LRQA 2ECGA 3ZPV1 5AIUA 4YADA 3L1XA 5B77A 2YQLA 1WEEA 2KIZA 3L11A 1WEWA 2MNZA 5TBNA 3N9QA 3ZVZB 2YT5A 2MA6A 2L80A 2VJFA 2ZETC 4R7EA 3RPGB 2ECIA 4C9ZA 2AN6A 2IDAA 2CKLB 3ZPVE 4GNDA 1FP0A 1DVPA 3DQVR 2ECWA 3ZTGA 5I3LA 4F52B 4W4UA 3N9LA 1WENA 1WEVA 2MIQA 3O70A 5JG6A 3HCTA 2L0BA 3U5NA 3N9PA 4YBSA 3M62A 3O35A 1JM7A 4A49A 5H1VA 2L75A 5EYAF 3L1ZB 4V3LC 2LRIC 1X4IA 3M63A 4L58A 4A0CD 5H1TA 2ECVA 2L43A 3U5MA 4WZ2A 2MA5A 1VD4A 5B76A 5D1MB 1E4UA 2QJ0A 4AP4A 5J3XA 4R2YA 2E6SA 2FUIA 4LJNA 2YSMA 1XWHA 2ECNA 2KGGA 1LDKC 2HDPA 3O36A 5KH9A 2G45A 4N3WA 3T7LA 3C5KA 2MT5A 3U5OA 4XI1A 4ZQLA 3O33A 5LCWB 4FK5A 1WEMA 2M1RA 2FUUA 2VJFB 3QZVA 3I2DA 4LLBA 5LKZA 2G43A 3EB5A 2YREA 1G25A 2VPBA 4B7YC 1WE9A 2BAYA 4IC2A 2PUYA 2LGVA 4YABA 4S3OC 3O7AA 4YBTA 2Y43A 2C2LA 3C6WA 4L7XA 4YAXA 1VFYA 5D1KB 2EODA 5G04B 2F6NA 3DPLR 2F6JA 1JM7B 3VK6A 3PUQA 4AYCA 2I50A 3LQHA 2H0DA 2KGIA 4ZDTA 2KWNA 2E6RA 4GB0A 2VPEA 1WEQA 3V43A 2CSZA 5H1UA 2LGKA 4FJCA 2KREA 2JMJA 4QF3A 2VJEA 3KNVA 3ZVYA 2CSYA 2G6QA 3SOUA 2Y1NA 4QF2A 4R8PK 1BORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NAA A;  3PUR A;  5B79 A;  3MHS A;  2C2V S;  5DKA A;  2UZG A;  2LQ6 A;  5B78 A;  2YHN A;  2M85 A;  2ECT A;  2KU3 A;  4WA6 A;  1F62 A;  4UP5 A;  2YUC A;  2OXQ C;  4GNG A;  2DX8 A;  1MM3 A;  5H9M A;  4YAT A;  5B75 A;  4UI9 B;  2JRJ A;  1N87 A;  2K16 A;  2YYR A;  4MVT A;  1K2F A;  2YHO A;  5B8D A;  2L5U A;  1WES A;  4WZ0 A;  4A4B A;  2CT2 A;  3SHB A;  3NG2 A;  3LQJ A;  2D8S A;  5FEY A;  3PHD A;  2KE1 A;  2FSA A;  2MNY A;  4ZUX U;  1WEP A;  2YUR A;  1WEO A;  4Q6F A;  2F42 A;  2VP7 A;  2KYU A;  1X4J A;  4AYC B;  3U5P A;  2LDR A;  3O37 A;  1T1H A;  2MD7 B;  1WGM A;  2LXP C;  2H0D B;  4YBM A;  4V3K C;  4UP0 A;  4GNF A;  4BBQ A;  3IHP A;  2XB1 A;  5LKX A;  4B86 C;  2YW8 A;  4S3O B;  2K17 A;  3M99 A;  2VJE B;  1WIL A;  4CCG X;  5C13 A;  1FBV A;  2RI7 A;  2EGP A;  1WEU A;  3RPG C;  4N4F A;  2KWK A;  2PNX A;  2YQM A;  5LKT A;  2QIC A;  3SOX A;  2YSJ A;  1X4U A;  3N9M A;  1MM2 A;  2ECJ A;  2JMI A;  5G0F A;  1HYJ A;  5TRB A;  5D1L B;  3RTR B;  2KWJ A;  3KQI A;  3MHH A;  5FER A;  5TDW A;  2KWO A;  1VYX A;  2LN0 A;  3N9O A;  2YU4 A;  2EA6 A;  4WZ3 B;  4AVX A;  4PTB A;  1ZBD B;  1Z6U A;  2K1J A;  1Z60 A;  2MUM A;  5DIN A;  5G05 B;  3ASL A;  2M3H A;  3ZYQ A;  4TKP B;  3GV4 A;  4X3G A;  2CKL A;  4P5O B;  1WIM A;  4I7B A;  5TAB A;  4YC9 A;  3O34 A;  4GNE A;  4LK9 A;  5C11 A;  1JOC A;  2QIZ A;  4FIP A;  2LGG A;  2M6M A;  3HCU A;  3FL2 A;  4FO9 A;  5FB0 A;  5KH7 A;  3HCS A;  2Y1M A;  2LXH C;  4A4C A;  4AUQ B;  1U6G B;  4CA1 A;  5KH3 A;  3LQI A;  5FB1 A;  4IC3 A;  1WFK A;  4I7D A;  2LV9 A;  3T6R A;  4BHW A;  1Z2Q A;  2LGL A;  4MSX A;  3HTK C;  3KV6 A;  2RSD A;  4PPE A;  3SOW A;  2VPD A;  3ZNI A;  5LKU A;  1CHC A;  5TDR A;  3GL6 A;  1V87 A;  2XEU A;  4NN2 A;  1RMD A;  5AIT A;  2HYE D;  2KFT A;  2KR4 A;  4LAD B;  4LKA A;  1IYM A;  1LDJ B;  2JMD A;  4O64 A;  1HYI A;  2VNF A;  3KV5 A;  2K4D A;  2MD8 C;  3N9N A;  2VPG A;  3EB6 A;  4I7C A;  3LRQ A;  2ECG A;  3ZPV 1;  5AIU A;  4YAD A;  3L1X A;  5B77 A;  2YQL A;  1WEE A;  2KIZ A;  3L11 A;  1WEW A;  2MNZ A;  5TBN A;  3N9Q A;  3ZVZ B;  2YT5 A;  2MA6 A;  2L80 A;  2VJF A;  2ZET C;  4R7E A;  3RPG B;  2ECI A;  4C9Z A;  2AN6 A;  2IDA A;  2CKL B;  3ZPV E;  4GND A;  1FP0 A;  1DVP A;  3DQV R;  2ECW A;  3ZTG A;  5I3L A;  4F52 B;  4W4U A;  3N9L A;  1WEN A;  1WEV A;  2MIQ A;  3O70 A;  5JG6 A;  3HCT A;  2L0B A;  3U5N A;  3N9P A;  4YBS A;  3M62 A;  3O35 A;  1JM7 A;  4A49 A;  5H1V A;  2L75 A;  5EYA F;  3L1Z B;  4V3L C;  2LRI C;  1X4I A;  3M63 A;  4L58 A;  4A0C D;  5H1T A;  2ECV A;  2L43 A;  3U5M A;  4WZ2 A;  2MA5 A;  1VD4 A;  5B76 A;  5D1M B;  1E4U A;  2QJ0 A;  4AP4 A;  5J3X A;  4R2Y A;  2E6S A;  2FUI A;  4LJN A;  2YSM A;  1XWH A;  2ECN A;  2KGG A;  1LDK C;  2HDP A;  3O36 A;  5KH9 A;  2G45 A;  4N3W A;  3T7L A;  3C5K A;  2MT5 A;  3U5O A;  4XI1 A;  4ZQL A;  3O33 A;  5LCW B;  4FK5 A;  1WEM A;  2M1R A;  2FUU A;  2VJF B;  3QZV A;  3I2D A;  4LLB A;  5LKZ A;  2G43 A;  3EB5 A;  2YRE A;  1G25 A;  2VPB A;  4B7Y C;  1WE9 A;  2BAY A;  4IC2 A;  2PUY A;  2LGV A;  4YAB A;  4S3O C;  3O7A A;  4YBT A;  2Y43 A;  2C2L A;  3C6W A;  4L7X A;  4YAX A;  1VFY A;  5D1K B;  2EOD A;  5G04 B;  2F6N A;  3DPL R;  2F6J A;  1JM7 B;  3VK6 A;  3PUQ A;  4AYC A;  2I50 A;  3LQH A;  2H0D A;  2KGI A;  4ZDT A;  2KWN A;  2E6R A;  4GB0 A;  2VPE A;  1WEQ A;  3V43 A;  2CSZ A;  5H1U A;  2LGK A;  4FJC A;  2KRE A;  2JMJ A;  4QF3 A;  2VJE A;  3KNV A;  3ZVY A;  2CSY A;  2G6Q A;  3SOU A;  2Y1N A;  4QF2 A;  4R8P K;  1BOR A; 
#chains in the Genus database with same CATH topology
 3FM8 C;  2DSM A;  2NAA A;  3PUR A;  5B79 A;  3MHS A;  3O47 A;  2C2V S;  5DKA A;  3DDT A;  2UZG A;  2LQ6 A;  5B78 A;  2YHN A;  2M85 A;  2ECT A;  2KU3 A;  4WA6 A;  1F62 A;  4UP5 A;  2YUC A;  2OXQ C;  4GNG A;  2DX8 A;  1MM3 A;  5H9M A;  4YAT A;  2XOZ A;  5B75 A;  4UI9 B;  2JRJ A;  1N87 A;  2K16 A;  2YYR A;  2MKE A;  4OGE A;  4MVT A;  1K2F A;  2XP0 A;  2YHO A;  5B8D A;  2L5U A;  1WES A;  4WZ0 A;  4A4B A;  2KKY A;  2CT2 A;  3SHB A;  3NG2 A;  3LQJ A;  2D8S A;  5FEY A;  5K3Q A;  3PHD A;  2KE1 A;  2FSA A;  2MNY A;  4ZUX U;  2E61 A;  1WEP A;  2YUR A;  1WEO A;  4Q6F A;  2F42 A;  2VP7 A;  2KYU A;  1X4J A;  4AYC B;  3U5P A;  2LDR A;  3O37 A;  1T1H A;  2MD7 B;  1WGM A;  4Z0R A;  2LXP C;  2H0D B;  4YBM A;  5SVX A;  4V3K C;  4UP0 A;  2M13 A;  4GNF A;  4BBQ A;  3IHP A;  2YVR A;  3Q1D A;  2XB1 A;  5LKX A;  3LJU X;  4B86 C;  2YW8 A;  4S3O B;  2K17 A;  3M99 A;  2VJE B;  1WIL A;  4CCG X;  2EXU A;  5C13 A;  1FBV A;  3FEH A;  2RI7 A;  2EGP A;  1WEU A;  3RPG C;  4N4F A;  2KWK A;  2PNX A;  2YQM A;  5LKT A;  2QIC A;  3SOX A;  2YSJ A;  1X4U A;  2CSV A;  3N9M A;  1MM2 A;  2ECJ A;  2JMI A;  5G0F A;  1HYJ A;  5TRB A;  3M7K A;  5D1L B;  3RTR B;  2KWJ A;  3KQI A;  3MHH A;  5FER A;  5TDW A;  2KWO A;  1VYX A;  4Z0O A;  2LN0 A;  2D8U A;  3N9O A;  2YU4 A;  2EA6 A;  4WZ3 B;  4AVX A;  4PTB A;  1ZBD B;  1Z6U A;  2K1J A;  3FAN A;  1Z60 A;  2MUM A;  5DIN A;  5G05 B;  3ASL A;  2JUN A;  2M3H A;  3ZYQ A;  4TKP B;  3GV4 A;  4X3G A;  2CKL A;  4P5O B;  3PLW A;  1WIM A;  4I7B A;  2CRR A;  5TAB A;  2EGM A;  4YC9 A;  3O34 A;  4GNE A;  4LK9 A;  5C11 A;  1JOC A;  2QIZ A;  4FIP A;  2LGG A;  2M6M A;  3HCU A;  3FL2 A;  4FO9 A;  5FB0 A;  5KH7 A;  3HCS A;  2Y1M A;  2LXH C;  3JUE A;  4A4C A;  4AUQ B;  1U6G B;  4CA1 A;  2XOC A;  5KH3 A;  3LQI A;  5FB1 A;  4IC3 A;  1WFK A;  4I7D A;  2LV9 A;  3T6R A;  4BHW A;  1Z2Q A;  2LGL A;  4MSX A;  4H9D A;  3HTK C;  3KV6 A;  2RSD A;  4PPE A;  3SOW A;  2VPD A;  2KKX A;  3ZNI A;  5LKU A;  1CHC A;  1MBM A;  5TDR A;  3GL6 A;  1V87 A;  2XEU A;  2P57 A;  4NN2 A;  1RMD A;  5AIT A;  2JM3 A;  2HYE D;  2KFT A;  2KR4 A;  4LAD B;  4LKA A;  1IYM A;  1LDJ B;  2JMD A;  4O64 A;  3E2D A;  1HYI A;  2VNF A;  3KV5 A;  2K4D A;  2MD8 C;  3N9N A;  3DWD A;  2VPG A;  3EB6 A;  4I7C A;  3LRQ A;  2ECG A;  1DCQ A;  3ZPV 1;  5AIU A;  4YAD A;  3L1X A;  5B77 A;  2YQL A;  1WEE A;  2KIZ A;  3L11 A;  1WEW A;  2MNZ A;  5TBN A;  3N9Q A;  3ZVZ B;  2YT5 A;  3FJU B;  2MA6 A;  2L80 A;  2VJF A;  2ZET C;  4R7E A;  3RPG B;  2ECI A;  4C9Z A;  2AN6 A;  2IDA A;  2CKL B;  3ZPV E;  4GND A;  1FP0 A;  1DVP A;  3DQV R;  2B0O E;  2ECW A;  3ZTG A;  5I3L A;  4F52 B;  4W4U A;  3N9L A;  1WEN A;  2DJA A;  1WEV A;  2MIQ A;  3O70 A;  5JG6 A;  3HCT A;  2L0B A;  3U5N A;  3N9P A;  4YBS A;  3M62 A;  3O35 A;  1JM7 A;  2CON A;  4A49 A;  2LAU A;  5H1V A;  2L75 A;  5EYA F;  3L1Z B;  4V3L C;  2LRI C;  1X4I A;  3M63 A;  4L58 A;  4A0C D;  5H1T A;  2ECV A;  3T9K A;  2L43 A;  3U5M A;  4WZ2 A;  2MA5 A;  1VD4 A;  5SVI A;  5B76 A;  5D1M B;  1E4U A;  4OGC A;  2QJ0 A;  4AP4 A;  2FD4 A;  4O62 A;  5J3X A;  4QQ4 A;  3KDE C;  4R2Y A;  3LVQ E;  2E6S A;  2FUI A;  4LJN A;  2YSM A;  1XWH A;  2ECN A;  2KGG A;  1LDK C;  2L7P A;  2RR4 A;  2HDP A;  3O36 A;  5KH9 A;  2G45 A;  4N3W A;  3T7L A;  3C5K A;  2MT5 A;  3U5O A;  4XI1 A;  4ZQL A;  3O33 A;  5LCW B;  4FK5 A;  1WEM A;  2M1R A;  2FUU A;  2VJF B;  3MDB C;  3QZV A;  2FFW A;  3I2D A;  4LLB A;  5LKZ A;  2IQJ A;  3LDY A;  2G43 A;  2XOY A;  3EB5 A;  2YRE A;  1G25 A;  2VPB A;  4B7Y C;  1WE9 A;  2BAY A;  4IC2 A;  3H7H A;  2PUY A;  2LGV A;  4YAB A;  4S3O C;  3O7A A;  4YBT A;  2Y43 A;  2C2L A;  3C6W A;  4L7X A;  5SVY A;  4YAX A;  1VFY A;  5D1K B;  2EOD A;  5G04 B;  2F6N A;  3DPL R;  2F6J A;  1JM7 B;  3VK6 A;  3PUQ A;  4AYC A;  2I50 A;  3FAO A;  3LQH A;  2H0D A;  2KGI A;  4ZDT A;  2KWN A;  2E6R A;  4GB0 A;  2VPE A;  4F1P A;  1WEQ A;  3LVR E;  3V43 A;  2CSZ A;  5H1U A;  2LGK A;  4FJC A;  2KRE A;  2JMJ A;  4QF3 A;  2VJE A;  5SVI B;  3SUB A;  2CRW A;  3KNV A;  3ZVY A;  2CSY A;  2OWA A;  2G6Q A;  3SOU A;  2Y1N A;  4QF2 A;  4R8P K;  1BOR A; 
#chains in the Genus database with same CATH homology
 2NAA A;  3PUR A;  5B79 A;  3MHS A;  2C2V S;  5DKA A;  2UZG A;  2LQ6 A;  5B78 A;  2YHN A;  2M85 A;  2ECT A;  2KU3 A;  4WA6 A;  1F62 A;  4UP5 A;  2YUC A;  2OXQ C;  4GNG A;  2DX8 A;  1MM3 A;  5H9M A;  4YAT A;  5B75 A;  4UI9 B;  2JRJ A;  1N87 A;  2K16 A;  2YYR A;  4MVT A;  1K2F A;  2YHO A;  5B8D A;  2L5U A;  1WES A;  4WZ0 A;  4A4B A;  2CT2 A;  3SHB A;  3NG2 A;  3LQJ A;  2D8S A;  5FEY A;  3PHD A;  2KE1 A;  2FSA A;  2MNY A;  4ZUX U;  1WEP A;  2YUR A;  1WEO A;  4Q6F A;  2F42 A;  2VP7 A;  2KYU A;  1X4J A;  4AYC B;  3U5P A;  2LDR A;  3O37 A;  1T1H A;  2MD7 B;  1WGM A;  2LXP C;  2H0D B;  4YBM A;  4V3K C;  4UP0 A;  4GNF A;  4BBQ A;  3IHP A;  2XB1 A;  5LKX A;  4B86 C;  2YW8 A;  4S3O B;  2K17 A;  3M99 A;  2VJE B;  1WIL A;  4CCG X;  5C13 A;  1FBV A;  2RI7 A;  2EGP A;  1WEU A;  3RPG C;  4N4F A;  2KWK A;  2PNX A;  2YQM A;  5LKT A;  2QIC A;  3SOX A;  2YSJ A;  1X4U A;  3N9M A;  1MM2 A;  2ECJ A;  2JMI A;  5G0F A;  1HYJ A;  5TRB A;  5D1L B;  3RTR B;  2KWJ A;  3KQI A;  3MHH A;  5FER A;  5TDW A;  2KWO A;  1VYX A;  2LN0 A;  3N9O A;  2YU4 A;  2EA6 A;  4WZ3 B;  4AVX A;  4PTB A;  1ZBD B;  1Z6U A;  2K1J A;  1Z60 A;  2MUM A;  5DIN A;  5G05 B;  3ASL A;  2M3H A;  3ZYQ A;  4TKP B;  3GV4 A;  4X3G A;  2CKL A;  4P5O B;  1WIM A;  4I7B A;  5TAB A;  4YC9 A;  3O34 A;  4GNE A;  4LK9 A;  5C11 A;  1JOC A;  2QIZ A;  4FIP A;  2LGG A;  2M6M A;  3HCU A;  3FL2 A;  4FO9 A;  5FB0 A;  5KH7 A;  3HCS A;  2Y1M A;  2LXH C;  4A4C A;  4AUQ B;  1U6G B;  4CA1 A;  5KH3 A;  3LQI A;  5FB1 A;  4IC3 A;  1WFK A;  4I7D A;  2LV9 A;  3T6R A;  4BHW A;  1Z2Q A;  2LGL A;  4MSX A;  3HTK C;  3KV6 A;  2RSD A;  4PPE A;  3SOW A;  2VPD A;  3ZNI A;  5LKU A;  1CHC A;  5TDR A;  3GL6 A;  1V87 A;  2XEU A;  4NN2 A;  1RMD A;  5AIT A;  2HYE D;  2KFT A;  2KR4 A;  4LAD B;  4LKA A;  1IYM A;  1LDJ B;  2JMD A;  4O64 A;  1HYI A;  2VNF A;  3KV5 A;  2K4D A;  2MD8 C;  3N9N A;  2VPG A;  3EB6 A;  4I7C A;  3LRQ A;  2ECG A;  3ZPV 1;  5AIU A;  4YAD A;  3L1X A;  5B77 A;  2YQL A;  1WEE A;  2KIZ A;  3L11 A;  1WEW A;  2MNZ A;  5TBN A;  3N9Q A;  3ZVZ B;  2YT5 A;  2MA6 A;  2L80 A;  2VJF A;  2ZET C;  4R7E A;  3RPG B;  2ECI A;  4C9Z A;  2AN6 A;  2IDA A;  2CKL B;  3ZPV E;  4GND A;  1FP0 A;  1DVP A;  3DQV R;  2ECW A;  3ZTG A;  5I3L A;  4F52 B;  4W4U A;  3N9L A;  1WEN A;  1WEV A;  2MIQ A;  3O70 A;  5JG6 A;  3HCT A;  2L0B A;  3U5N A;  3N9P A;  4YBS A;  3M62 A;  3O35 A;  1JM7 A;  4A49 A;  5H1V A;  2L75 A;  5EYA F;  3L1Z B;  4V3L C;  2LRI C;  1X4I A;  3M63 A;  4L58 A;  4A0C D;  5H1T A;  2ECV A;  2L43 A;  3U5M A;  4WZ2 A;  2MA5 A;  1VD4 A;  5B76 A;  5D1M B;  1E4U A;  2QJ0 A;  4AP4 A;  5J3X A;  4R2Y A;  2E6S A;  2FUI A;  4LJN A;  2YSM A;  1XWH A;  2ECN A;  2KGG A;  1LDK C;  2HDP A;  3O36 A;  5KH9 A;  2G45 A;  4N3W A;  3T7L A;  3C5K A;  2MT5 A;  3U5O A;  4XI1 A;  4ZQL A;  3O33 A;  5LCW B;  4FK5 A;  1WEM A;  2M1R A;  2FUU A;  2VJF B;  3QZV A;  3I2D A;  4LLB A;  5LKZ A;  2G43 A;  3EB5 A;  2YRE A;  1G25 A;  2VPB A;  4B7Y C;  1WE9 A;  2BAY A;  4IC2 A;  2PUY A;  2LGV A;  4YAB A;  4S3O C;  3O7A A;  4YBT A;  2Y43 A;  2C2L A;  3C6W A;  4L7X A;  4YAX A;  1VFY A;  5D1K B;  2EOD A;  5G04 B;  2F6N A;  3DPL R;  2F6J A;  1JM7 B;  3VK6 A;  3PUQ A;  4AYC A;  2I50 A;  3LQH A;  2H0D A;  2KGI A;  4ZDT A;  2KWN A;  2E6R A;  4GB0 A;  2VPE A;  1WEQ A;  3V43 A;  2CSZ A;  5H1U A;  2LGK A;  4FJC A;  2KRE A;  2JMJ A;  4QF3 A;  2VJE A;  3KNV A;  3ZVY A;  2CSY A;  2G6Q A;  3SOU A;  2Y1N A;  4QF2 A;  4R8P K;  1BOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...