4UI9B

Atomic structure of the human anaphase-promoting complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
b'MKVKIKCWNGVALWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ui9B00
2C2LA 3V43A 4I7CA 3HCSA 4WZ2A 3KNVA 2I50A 2L5UA 2D8SA 2K4DA 4V3LC 5LKUA 2YSJA 2JMIA 2L80A 1WEMA 4AVXA 3NG2A 3O34A 2L75A 5TDWA 1V87A 4AUQB 3N9QA 3L11A 1HYJA 4TKPB 1JOCA 3L1XA 3GV4A 3U5OA 2BAYA 3EB6A 5TABA 2FUIA 3O7AA 5D1MB 2YW8A 4GNGA 2MIQA 5G0FA 5TDRA 2L0BA 2VJFA 2AN6A 2LXHC 4P5OB 3O37A 4WZ3B 3KQIA 1WGMA 1F62A 2EA6A 5AIUA 5I3LA 3ASLA 2NAAA 2ZETC 1Z60A 3HCTA 1BORA 1JM7A 2YQMA 2XB1A 4BBQA 5B78A 2YU4A 4N3WA 5H1VA 4BHWA 3LQJA 5TRBA 1WE9A 2VP7A 2MUMA 2H0DB 2LDRA 3T6RA 3DPLR 4L58A 2MD8C 2KU3A 3U5NA 1WILA 4FO9A 2KWJA 5D1LB 2VJEB 3O70A 4ZDTA 2ECWA 2MT5A 1FP0A 3HCUA 2YT5A 1X4JA 2CKLB 2F42A 3LQIA 4GNFA 4F52B 5H9MA 1X4UA 2IDAA 4YABA 2LXPC 2RSDA 4W4UA 2F6JA 3IHPA 3C5KA 2QICA 2Y1MA 3I2DA 3N9OA 2LGGA 4R8PK 2QIZA 4I7BA 1G25A 2G45A 4MVTA 2M6MA 4B7YC 2F6NA 2CSZA 2LQ6A 5LCWB 2ECIA 2YQLA 2KREA 2FUUA 2XEUA 3PUQA 4WZ0A 4YBSA 4YATA 1WENA 3QZVA 2LGVA 1WEPA 4C9ZA 2KE1A 3M99A 3FL2A 4UP0A 2JMJA 2KYUA 2VPDA 4V3KC 2KR4A 2KWOA 5B79A 4LK9A 1WEVA 5C11A 2MA6A 2ECJA 4LJNA 2Y43A 4CA1A 2YUCA 3RTRB 4LLBA 2VPGA 5G04B 2L43A 4R7EA 3VK6A 2QJ0A 4PTBA 5J3XA 5G05B 2PUYA 4A4CA 2EGPA 5EYAF 4XI1A 5D1KB 2MA5A 1X4IA 3T7LA 2LGKA 3MHHA 2Y1NA 1WEOA 2LV9A 3LQHA 1WEQA 3KV5A 2M85A 4YBTA 3HTKC 3N9NA 4YAXA 4LADB 4YC9A 4AYCB 1WIMA 4L7XA 2KFTA 1Z6UA 4GNDA 3L1ZB 3ZPVE 2VPBA 2YYRA 5B8DA 2E6SA 1VFYA 1T1HA 3O33A 1WEEA 2G6QA 2VPEA 4R2YA 4YBMA 2YURA 4FJCA 2KGIA 1CHCA 4I7DA 5LKZA 5TBNA 5B77A 2ECVA 4ZUXU 3DQVR 4A49A 2UZGA 1WESA 4FIPA 3PURA 3ZTGA 1FBVA 4A0CD 2LGLA 3MHSA 1MM2A 5DINA 2H0DA 1K2FA 2LRIC 3KV6A 2K16A 4NN2A 3GL6A 3M63A 2RI7A 3LRQA 1WFKA 3N9PA 4PPEA 2VJEA 3C6WA 4X3GA 4S3OC 2PNXA 3SOWA 3ZVZB 3M62A 3O36A 2HDPA 4IC3A 2CKLA 3N9MA 2ECTA 3RPGB 5FB0A 2VJFB 5B75A 1WEWA 5JG6A 5FB1A 4GB0A 5LKTA 2YHOA 5H1TA 2M1RA 2OXQC 3SHBA 1DVPA 4MSXA 4YADA 4B86C 4UP5A 1Z2QA 4Q6FA 3RPGC 3O35A 4IC2A 2G43A 3PHDA 4WA6A 3SOXA 4N4FA 2JMDA 4QF3A 1JM7B 4FK5A 2HYED 3ZPV1 2KGGA 3U5PA 2ECNA 2M3HA 5KH7A 1MM3A 5AITA 4AP4A 5LKXA 2KWKA 5FERA 2KWNA 4O64A 3SOUA 4LKAA 5DKAA 2LN0A 1XWHA 3ZNIA 1VD4A 1E4UA 2FSAA 1WEUA 1HYIA 1LDKC 2C2VS 2JRJA 2YHNA 2MD7B 3EB5A 5KH3A 4ZQLA 4UI9B 5B76A 1VYXA 2ECGA 3ZVYA 4A4BA 2CT2A 1RMDA 5FEYA 4QF2A 3ZYQA 2KIZA 4S3OB 2MNYA 4CCGX 1ZBDB 5KH9A 4AYCA 3U5MA 1IYMA 1U6GB 2YREA 1N87A 2E6RA 5C13A 2MNZA 5H1UA 1LDJB 2DX8A 2EODA 2CSYA 2VNFA 2K17A 2YSMA 2K1JA 4GNEA 3N9LA
chains in the Genus database with same CATH superfamily
2C2LA 3V43A 4I7CA 3HCSA 4OGCA 3KNVA 2I50A 4WZ2A 2L5UA 2D8SA 3PLWA 2K4DA 4V3LC 5LKUA 2YSJA 2DSMA 3FEHA 4H9DA 2JMIA 2L80A 1WEMA 4AVXA 5K3QA 3NG2A 3O34A 2L75A 5TDWA 1V87A 4AUQB 3N9QA 3L11A 4O62A 1HYJA 4TKPB 2XOZA 1JOCA 3L1XA 3GV4A 3LVRE 3O47A 3U5OA 2BAYA 3EB6A 5TABA 2FUIA 3O7AA 5D1MB 2YW8A 4GNGA 2MIQA 5G0FA 2CRWA 5SVIA 5TDRA 2L0BA 2EGMA 2VJFA 2AN6A 3FAOA 2JUNA 2LXHC 2E61A 4P5OB 2B0OE 3O37A 4OGEA 4WZ3B 3KQIA 1WGMA 5SVXA 1F62A 2EA6A 5AIUA 5I3LA 2KKYA 3ASLA 3JUEA 2NAAA 2ZETC 1Z60A 3HCTA 1BORA 1JM7A 2YQMA 2XB1A 4BBQA 5B78A 2CONA 2YU4A 4N3WA 5H1VA 2XOCA 4BHWA 3LQJA 5TRBA 1WE9A 2VP7A 2MUMA 2H0DB 2LDRA 3T6RA 3DPLR 4L58A 2MD8C 2KU3A 3U5NA 4FO9A 1WILA 2KWJA 5D1LB 2VJEB 3O70A 2IQJA 4ZDTA 2ECWA 2MT5A 1FP0A 3HCUA 2YT5A 1MBMA 1X4JA 2CKLB 2F42A 3LQIA 4GNFA 4F52B 3LDYA 5H9MA 1X4UA 2IDAA 4YABA 2LXPC 2RSDA 4W4UA 2F6JA 3IHPA 2XOYA 3C5KA 2MKEA 2QICA 2Y1MA 3I2DA 3N9OA 2LGGA 4R8PK 2QIZA 4I7BA 1G25A 2G45A 3DWDA 2M6MA 4MVTA 4B7YC 2F6NA 2CSZA 2LQ6A 5LCWB 2ECIA 2YQLA 2KREA 2FUUA 2XEUA 3PUQA 4WZ0A 4YBSA 4YATA 1WENA 3QZVA 2LGVA 5SVYA 1WEPA 4C9ZA 2KE1A 4F1PA 3M99A 3FL2A 4UP0A 2JMJA 2KYUA 2VPDA 4V3KC 2KR4A 2KWOA 5B79A 4LK9A 1WEVA 5C11A 2MA6A 4Z0OA 2ECJA 4LJNA 2Y43A 4CA1A 2YUCA 3RTRB 4LLBA 2VPGA 5G04B 2L43A 1DCQA 4R7EA 2DJAA 3KDEC 3VK6A 2QJ0A 4PTBA 5J3XA 5G05B 2PUYA 2RR4A 3Q1DA 2FFWA 4A4CA 2EGPA 5EYAF 3MDBC 4XI1A 5D1KB 2MA5A 1X4IA 3T7LA 2LGKA 3MHHA 2Y1NA 1WEOA 2LV9A 3LQHA 1WEQA 3KV5A 2YVRA 2M85A 4YBTA 3HTKC 3N9NA 4YAXA 4LADB 4YC9A 4AYCB 1WIMA 4L7XA 2KFTA 1Z6UA 4GNDA 3L1ZB 3ZPVE 2VPBA 3E2DA 2YYRA 5B8DA 2E6SA 1VFYA 1T1HA 3O33A 3FANA 1WEEA 2G6QA 2VPEA 4R2YA 4YBMA 2YURA 4FJCA 2KGIA 1CHCA 4I7DA 5LKZA 5TBNA 5B77A 2ECVA 4ZUXU 3DQVR 4Z0RA 4A49A 2UZGA 3H7HA 1WESA 4FIPA 3PURA 3LVQE 3ZTGA 1FBVA 4A0CD 2LGLA 3MHSA 1MM2A 5DINA 2H0DA 1K2FA 2LRIC 3KV6A 2K16A 4NN2A 3GL6A 3M63A 2RI7A 3LRQA 1WFKA 3N9PA 4PPEA 2VJEA 3C6WA 4X3GA 4S3OC 2PNXA 2P57A 3SOWA 3ZVZB 3M62A 3O36A 2HDPA 4IC3A 2CKLA 3DDTA 3N9MA 2ECTA 2JM3A 3RPGB 2KKXA 3SUBA 5FB0A 5SVIB 2VJFB 5B75A 1WEWA 5JG6A 5FB1A 4GB0A 5LKTA 2YHOA 5H1TA 2M1RA 2OXQC 3SHBA 1DVPA 2CSVA 2CRRA 4MSXA 4YADA 4B86C 4UP5A 1Z2QA 4Q6FA 3RPGC 3O35A 2M13A 4IC2A 2G43A 3PHDA 4WA6A 3SOXA 4N4FA 2JMDA 4QF3A 1JM7B 4FK5A 2HYED 3ZPV1 2KGGA 3U5PA 2ECNA 2XP0A 2M3HA 5KH7A 1MM3A 5AITA 4AP4A 5LKXA 3FM8C 4QQ4A 2KWKA 5FERA 2KWNA 4O64A 3SOUA 4LKAA 5DKAA 2LN0A 1XWHA 3ZNIA 1VD4A 3LJUX 2LAUA 1E4UA 2FSAA 1WEUA 1HYIA 1LDKC 2C2VS 2JRJA 2YHNA 2MD7B 3EB5A 2OWAA 5KH3A 4ZQLA 4UI9B 5B76A 1VYXA 2ECGA 3ZVYA 4A4BA 2L7PA 2CT2A 3FJUB 1RMDA 5FEYA 4QF2A 3ZYQA 2KIZA 4S3OB 2MNYA 4CCGX 1ZBDB 5KH9A 4AYCA 3M7KA 3U5MA 1IYMA 1U6GB 2YREA 1N87A 2E6RA 5C13A 2FD4A 2MNZA 5H1UA 1LDJB 2DX8A 2EXUA 2D8UA 2EODA 2CSYA 2VNFA 2K17A 2YSMA 2K1JA 4GNEA 3T9KA 3N9LA
chains in the Genus database with same CATH topology
2C2LA 3V43A 4I7CA 3HCSA 4WZ2A 3KNVA 2I50A 2L5UA 2D8SA 2K4DA 4V3LC 5LKUA 2YSJA 2JMIA 2L80A 1WEMA 4AVXA 3NG2A 3O34A 2L75A 5TDWA 1V87A 4AUQB 3N9QA 3L11A 1HYJA 4TKPB 1JOCA 3L1XA 3GV4A 3U5OA 2BAYA 3EB6A 5TABA 2FUIA 3O7AA 5D1MB 2YW8A 4GNGA 2MIQA 5G0FA 5TDRA 2L0BA 2VJFA 2AN6A 2LXHC 4P5OB 3O37A 4WZ3B 3KQIA 1WGMA 1F62A 2EA6A 5AIUA 5I3LA 3ASLA 2NAAA 2ZETC 1Z60A 3HCTA 1BORA 1JM7A 2YQMA 2XB1A 4BBQA 5B78A 2YU4A 4N3WA 5H1VA 4BHWA 3LQJA 5TRBA 1WE9A 2VP7A 2MUMA 2H0DB 2LDRA 3T6RA 3DPLR 4L58A 2MD8C 2KU3A 3U5NA 1WILA 4FO9A 2KWJA 5D1LB 2VJEB 3O70A 4ZDTA 2ECWA 2MT5A 1FP0A 3HCUA 2YT5A 1X4JA 2CKLB 2F42A 3LQIA 4GNFA 4F52B 5H9MA 1X4UA 2IDAA 4YABA 2LXPC 2RSDA 4W4UA 2F6JA 3IHPA 3C5KA 2QICA 2Y1MA 3I2DA 3N9OA 2LGGA 4R8PK 2QIZA 4I7BA 1G25A 2G45A 4MVTA 2M6MA 4B7YC 2F6NA 2CSZA 2LQ6A 5LCWB 2ECIA 2YQLA 2KREA 2FUUA 2XEUA 3PUQA 4WZ0A 4YBSA 4YATA 1WENA 3QZVA 2LGVA 1WEPA 4C9ZA 2KE1A 3M99A 3FL2A 4UP0A 2JMJA 2KYUA 2VPDA 4V3KC 2KR4A 2KWOA 5B79A 4LK9A 1WEVA 5C11A 2MA6A 2ECJA 4LJNA 2Y43A 4CA1A 2YUCA 3RTRB 4LLBA 2VPGA 5G04B 2L43A 4R7EA 3VK6A 2QJ0A 4PTBA 5J3XA 5G05B 2PUYA 4A4CA 2EGPA 5EYAF 4XI1A 5D1KB 2MA5A 1X4IA 3T7LA 2LGKA 3MHHA 2Y1NA 1WEOA 2LV9A 3LQHA 1WEQA 3KV5A 2M85A 4YBTA 3HTKC 3N9NA 4YAXA 4LADB 4YC9A 4AYCB 1WIMA 4L7XA 2KFTA 1Z6UA 4GNDA 3L1ZB 3ZPVE 2VPBA 2YYRA 5B8DA 2E6SA 1VFYA 1T1HA 3O33A 1WEEA 2G6QA 2VPEA 4R2YA 4YBMA 2YURA 4FJCA 2KGIA 1CHCA 4I7DA 5LKZA 5TBNA 5B77A 2ECVA 4ZUXU 3DQVR 4A49A 2UZGA 1WESA 4FIPA 3PURA 3ZTGA 1FBVA 4A0CD 2LGLA 3MHSA 1MM2A 5DINA 2H0DA 1K2FA 2LRIC 3KV6A 2K16A 4NN2A 3GL6A 3M63A 2RI7A 3LRQA 1WFKA 3N9PA 4PPEA 2VJEA 3C6WA 4X3GA 4S3OC 2PNXA 3SOWA 3ZVZB 3M62A 3O36A 2HDPA 4IC3A 2CKLA 3N9MA 2ECTA 3RPGB 5FB0A 2VJFB 5B75A 1WEWA 5JG6A 5FB1A 4GB0A 5LKTA 2YHOA 5H1TA 2M1RA 2OXQC 3SHBA 1DVPA 4MSXA 4YADA 4B86C 4UP5A 1Z2QA 4Q6FA 3RPGC 3O35A 4IC2A 2G43A 3PHDA 4WA6A 3SOXA 4N4FA 2JMDA 4QF3A 1JM7B 4FK5A 2HYED 3ZPV1 2KGGA 3U5PA 2ECNA 2M3HA 5KH7A 1MM3A 5AITA 4AP4A 5LKXA 2KWKA 5FERA 2KWNA 4O64A 3SOUA 4LKAA 5DKAA 2LN0A 1XWHA 3ZNIA 1VD4A 1E4UA 2FSAA 1WEUA 1HYIA 1LDKC 2C2VS 2JRJA 2YHNA 2MD7B 3EB5A 5KH3A 4ZQLA 4UI9B 5B76A 1VYXA 2ECGA 3ZVYA 4A4BA 2CT2A 1RMDA 5FEYA 4QF2A 3ZYQA 2KIZA 4S3OB 2MNYA 4CCGX 1ZBDB 5KH9A 4AYCA 3U5MA 1IYMA 1U6GB 2YREA 1N87A 2E6RA 5C13A 2MNZA 5H1UA 1LDJB 2DX8A 2EODA 2CSYA 2VNFA 2K17A 2YSMA 2K1JA 4GNEA 3N9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2L A;  3V43 A;  4I7C A;  3HCS A;  4WZ2 A;  3KNV A;  2I50 A;  2L5U A;  2D8S A;  2K4D A;  4V3L C;  5LKU A;  2YSJ A;  2JMI A;  2L80 A;  1WEM A;  4AVX A;  3NG2 A;  3O34 A;  2L75 A;  5TDW A;  1V87 A;  4AUQ B;  3N9Q A;  3L11 A;  1HYJ A;  4TKP B;  1JOC A;  3L1X A;  3GV4 A;  3U5O A;  2BAY A;  3EB6 A;  5TAB A;  2FUI A;  3O7A A;  5D1M B;  2YW8 A;  4GNG A;  2MIQ A;  5G0F A;  5TDR A;  2L0B A;  2VJF A;  2AN6 A;  2LXH C;  4P5O B;  3O37 A;  4WZ3 B;  3KQI A;  1WGM A;  1F62 A;  2EA6 A;  5AIU A;  5I3L A;  3ASL A;  2NAA A;  2ZET C;  1Z60 A;  3HCT A;  1BOR A;  1JM7 A;  2YQM A;  2XB1 A;  4BBQ A;  5B78 A;  2YU4 A;  4N3W A;  5H1V A;  4BHW A;  3LQJ A;  5TRB A;  1WE9 A;  2VP7 A;  2MUM A;  2H0D B;  2LDR A;  3T6R A;  3DPL R;  4L58 A;  2MD8 C;  2KU3 A;  3U5N A;  1WIL A;  4FO9 A;  2KWJ A;  5D1L B;  2VJE B;  3O70 A;  4ZDT A;  2ECW A;  2MT5 A;  1FP0 A;  3HCU A;  2YT5 A;  1X4J A;  2CKL B;  2F42 A;  3LQI A;  4GNF A;  4F52 B;  5H9M A;  1X4U A;  2IDA A;  4YAB A;  2LXP C;  2RSD A;  4W4U A;  2F6J A;  3IHP A;  3C5K A;  2QIC A;  2Y1M A;  3I2D A;  3N9O A;  2LGG A;  4R8P K;  2QIZ A;  4I7B A;  1G25 A;  2G45 A;  4MVT A;  2M6M A;  4B7Y C;  2F6N A;  2CSZ A;  2LQ6 A;  5LCW B;  2ECI A;  2YQL A;  2KRE A;  2FUU A;  2XEU A;  3PUQ A;  4WZ0 A;  4YBS A;  4YAT A;  1WEN A;  3QZV A;  2LGV A;  1WEP A;  4C9Z A;  2KE1 A;  3M99 A;  3FL2 A;  4UP0 A;  2JMJ A;  2KYU A;  2VPD A;  4V3K C;  2KR4 A;  2KWO A;  5B79 A;  4LK9 A;  1WEV A;  5C11 A;  2MA6 A;  2ECJ A;  4LJN A;  2Y43 A;  4CA1 A;  2YUC A;  3RTR B;  4LLB A;  2VPG A;  5G04 B;  2L43 A;  4R7E A;  3VK6 A;  2QJ0 A;  4PTB A;  5J3X A;  5G05 B;  2PUY A;  4A4C A;  2EGP A;  5EYA F;  4XI1 A;  5D1K B;  2MA5 A;  1X4I A;  3T7L A;  2LGK A;  3MHH A;  2Y1N A;  1WEO A;  2LV9 A;  3LQH A;  1WEQ A;  3KV5 A;  2M85 A;  4YBT A;  3HTK C;  3N9N A;  4YAX A;  4LAD B;  4YC9 A;  4AYC B;  1WIM A;  4L7X A;  2KFT A;  1Z6U A;  4GND A;  3L1Z B;  3ZPV E;  2VPB A;  2YYR A;  5B8D A;  2E6S A;  1VFY A;  1T1H A;  3O33 A;  1WEE A;  2G6Q A;  2VPE A;  4R2Y A;  4YBM A;  2YUR A;  4FJC A;  2KGI A;  1CHC A;  4I7D A;  5LKZ A;  5TBN A;  5B77 A;  2ECV A;  4ZUX U;  3DQV R;  4A49 A;  2UZG A;  1WES A;  4FIP A;  3PUR A;  3ZTG A;  1FBV A;  4A0C D;  2LGL A;  3MHS A;  1MM2 A;  5DIN A;  2H0D A;  1K2F A;  2LRI C;  3KV6 A;  2K16 A;  4NN2 A;  3GL6 A;  3M63 A;  2RI7 A;  3LRQ A;  1WFK A;  3N9P A;  4PPE A;  2VJE A;  3C6W A;  4X3G A;  4S3O C;  2PNX A;  3SOW A;  3ZVZ B;  3M62 A;  3O36 A;  2HDP A;  4IC3 A;  2CKL A;  3N9M A;  2ECT A;  3RPG B;  5FB0 A;  2VJF B;  5B75 A;  1WEW A;  5JG6 A;  5FB1 A;  4GB0 A;  5LKT A;  2YHO A;  5H1T A;  2M1R A;  2OXQ C;  3SHB A;  1DVP A;  4MSX A;  4YAD A;  4B86 C;  4UP5 A;  1Z2Q A;  4Q6F A;  3RPG C;  3O35 A;  4IC2 A;  2G43 A;  3PHD A;  4WA6 A;  3SOX A;  4N4F A;  2JMD A;  4QF3 A;  1JM7 B;  4FK5 A;  2HYE D;  3ZPV 1;  2KGG A;  3U5P A;  2ECN A;  2M3H A;  5KH7 A;  1MM3 A;  5AIT A;  4AP4 A;  5LKX A;  2KWK A;  5FER A;  2KWN A;  4O64 A;  3SOU A;  4LKA A;  5DKA A;  2LN0 A;  1XWH A;  3ZNI A;  1VD4 A;  1E4U A;  2FSA A;  1WEU A;  1HYI A;  1LDK C;  2C2V S;  2JRJ A;  2YHN A;  2MD7 B;  3EB5 A;  5KH3 A;  4ZQL A;  4UI9 B;  5B76 A;  1VYX A;  2ECG A;  3ZVY A;  4A4B A;  2CT2 A;  1RMD A;  5FEY A;  4QF2 A;  3ZYQ A;  2KIZ A;  4S3O B;  2MNY A;  4CCG X;  1ZBD B;  5KH9 A;  4AYC A;  3U5M A;  1IYM A;  1U6G B;  2YRE A;  1N87 A;  2E6R A;  5C13 A;  2MNZ A;  5H1U A;  1LDJ B;  2DX8 A;  2EOD A;  2CSY A;  2VNF A;  2K17 A;  2YSM A;  2K1J A;  4GNE A;  3N9L A; 
#chains in the Genus database with same CATH topology
 2C2L A;  3V43 A;  4I7C A;  3HCS A;  4OGC A;  3KNV A;  2I50 A;  4WZ2 A;  2L5U A;  2D8S A;  3PLW A;  2K4D A;  4V3L C;  5LKU A;  2YSJ A;  2DSM A;  3FEH A;  4H9D A;  2JMI A;  2L80 A;  1WEM A;  4AVX A;  5K3Q A;  3NG2 A;  3O34 A;  2L75 A;  5TDW A;  1V87 A;  4AUQ B;  3N9Q A;  3L11 A;  4O62 A;  1HYJ A;  4TKP B;  2XOZ A;  1JOC A;  3L1X A;  3GV4 A;  3LVR E;  3O47 A;  3U5O A;  2BAY A;  3EB6 A;  5TAB A;  2FUI A;  3O7A A;  5D1M B;  2YW8 A;  4GNG A;  2MIQ A;  5G0F A;  2CRW A;  5SVI A;  5TDR A;  2L0B A;  2EGM A;  2VJF A;  2AN6 A;  3FAO A;  2JUN A;  2LXH C;  2E61 A;  4P5O B;  2B0O E;  3O37 A;  4OGE A;  4WZ3 B;  3KQI A;  1WGM A;  5SVX A;  1F62 A;  2EA6 A;  5AIU A;  5I3L A;  2KKY A;  3ASL A;  3JUE A;  2NAA A;  2ZET C;  1Z60 A;  3HCT A;  1BOR A;  1JM7 A;  2YQM A;  2XB1 A;  4BBQ A;  5B78 A;  2CON A;  2YU4 A;  4N3W A;  5H1V A;  2XOC A;  4BHW A;  3LQJ A;  5TRB A;  1WE9 A;  2VP7 A;  2MUM A;  2H0D B;  2LDR A;  3T6R A;  3DPL R;  4L58 A;  2MD8 C;  2KU3 A;  3U5N A;  4FO9 A;  1WIL A;  2KWJ A;  5D1L B;  2VJE B;  3O70 A;  2IQJ A;  4ZDT A;  2ECW A;  2MT5 A;  1FP0 A;  3HCU A;  2YT5 A;  1MBM A;  1X4J A;  2CKL B;  2F42 A;  3LQI A;  4GNF A;  4F52 B;  3LDY A;  5H9M A;  1X4U A;  2IDA A;  4YAB A;  2LXP C;  2RSD A;  4W4U A;  2F6J A;  3IHP A;  2XOY A;  3C5K A;  2MKE A;  2QIC A;  2Y1M A;  3I2D A;  3N9O A;  2LGG A;  4R8P K;  2QIZ A;  4I7B A;  1G25 A;  2G45 A;  3DWD A;  2M6M A;  4MVT A;  4B7Y C;  2F6N A;  2CSZ A;  2LQ6 A;  5LCW B;  2ECI A;  2YQL A;  2KRE A;  2FUU A;  2XEU A;  3PUQ A;  4WZ0 A;  4YBS A;  4YAT A;  1WEN A;  3QZV A;  2LGV A;  5SVY A;  1WEP A;  4C9Z A;  2KE1 A;  4F1P A;  3M99 A;  3FL2 A;  4UP0 A;  2JMJ A;  2KYU A;  2VPD A;  4V3K C;  2KR4 A;  2KWO A;  5B79 A;  4LK9 A;  1WEV A;  5C11 A;  2MA6 A;  4Z0O A;  2ECJ A;  4LJN A;  2Y43 A;  4CA1 A;  2YUC A;  3RTR B;  4LLB A;  2VPG A;  5G04 B;  2L43 A;  1DCQ A;  4R7E A;  2DJA A;  3KDE C;  3VK6 A;  2QJ0 A;  4PTB A;  5J3X A;  5G05 B;  2PUY A;  2RR4 A;  3Q1D A;  2FFW A;  4A4C A;  2EGP A;  5EYA F;  3MDB C;  4XI1 A;  5D1K B;  2MA5 A;  1X4I A;  3T7L A;  2LGK A;  3MHH A;  2Y1N A;  1WEO A;  2LV9 A;  3LQH A;  1WEQ A;  3KV5 A;  2YVR A;  2M85 A;  4YBT A;  3HTK C;  3N9N A;  4YAX A;  4LAD B;  4YC9 A;  4AYC B;  1WIM A;  4L7X A;  2KFT A;  1Z6U A;  4GND A;  3L1Z B;  3ZPV E;  2VPB A;  3E2D A;  2YYR A;  5B8D A;  2E6S A;  1VFY A;  1T1H A;  3O33 A;  3FAN A;  1WEE A;  2G6Q A;  2VPE A;  4R2Y A;  4YBM A;  2YUR A;  4FJC A;  2KGI A;  1CHC A;  4I7D A;  5LKZ A;  5TBN A;  5B77 A;  2ECV A;  4ZUX U;  3DQV R;  4Z0R A;  4A49 A;  2UZG A;  3H7H A;  1WES A;  4FIP A;  3PUR A;  3LVQ E;  3ZTG A;  1FBV A;  4A0C D;  2LGL A;  3MHS A;  1MM2 A;  5DIN A;  2H0D A;  1K2F A;  2LRI C;  3KV6 A;  2K16 A;  4NN2 A;  3GL6 A;  3M63 A;  2RI7 A;  3LRQ A;  1WFK A;  3N9P A;  4PPE A;  2VJE A;  3C6W A;  4X3G A;  4S3O C;  2PNX A;  2P57 A;  3SOW A;  3ZVZ B;  3M62 A;  3O36 A;  2HDP A;  4IC3 A;  2CKL A;  3DDT A;  3N9M A;  2ECT A;  2JM3 A;  3RPG B;  2KKX A;  3SUB A;  5FB0 A;  5SVI B;  2VJF B;  5B75 A;  1WEW A;  5JG6 A;  5FB1 A;  4GB0 A;  5LKT A;  2YHO A;  5H1T A;  2M1R A;  2OXQ C;  3SHB A;  1DVP A;  2CSV A;  2CRR A;  4MSX A;  4YAD A;  4B86 C;  4UP5 A;  1Z2Q A;  4Q6F A;  3RPG C;  3O35 A;  2M13 A;  4IC2 A;  2G43 A;  3PHD A;  4WA6 A;  3SOX A;  4N4F A;  2JMD A;  4QF3 A;  1JM7 B;  4FK5 A;  2HYE D;  3ZPV 1;  2KGG A;  3U5P A;  2ECN A;  2XP0 A;  2M3H A;  5KH7 A;  1MM3 A;  5AIT A;  4AP4 A;  5LKX A;  3FM8 C;  4QQ4 A;  2KWK A;  5FER A;  2KWN A;  4O64 A;  3SOU A;  4LKA A;  5DKA A;  2LN0 A;  1XWH A;  3ZNI A;  1VD4 A;  3LJU X;  2LAU A;  1E4U A;  2FSA A;  1WEU A;  1HYI A;  1LDK C;  2C2V S;  2JRJ A;  2YHN A;  2MD7 B;  3EB5 A;  2OWA A;  5KH3 A;  4ZQL A;  4UI9 B;  5B76 A;  1VYX A;  2ECG A;  3ZVY A;  4A4B A;  2L7P A;  2CT2 A;  3FJU B;  1RMD A;  5FEY A;  4QF2 A;  3ZYQ A;  2KIZ A;  4S3O B;  2MNY A;  4CCG X;  1ZBD B;  5KH9 A;  4AYC A;  3M7K A;  3U5M A;  1IYM A;  1U6G B;  2YRE A;  1N87 A;  2E6R A;  5C13 A;  2FD4 A;  2MNZ A;  5H1U A;  1LDJ B;  2DX8 A;  2EXU A;  2D8U A;  2EOD A;  2CSY A;  2VNF A;  2K17 A;  2YSM A;  2K1J A;  4GNE A;  3T9K A;  3N9L A; 
#chains in the Genus database with same CATH homology
 2C2L A;  3V43 A;  4I7C A;  3HCS A;  4WZ2 A;  3KNV A;  2I50 A;  2L5U A;  2D8S A;  2K4D A;  4V3L C;  5LKU A;  2YSJ A;  2JMI A;  2L80 A;  1WEM A;  4AVX A;  3NG2 A;  3O34 A;  2L75 A;  5TDW A;  1V87 A;  4AUQ B;  3N9Q A;  3L11 A;  1HYJ A;  4TKP B;  1JOC A;  3L1X A;  3GV4 A;  3U5O A;  2BAY A;  3EB6 A;  5TAB A;  2FUI A;  3O7A A;  5D1M B;  2YW8 A;  4GNG A;  2MIQ A;  5G0F A;  5TDR A;  2L0B A;  2VJF A;  2AN6 A;  2LXH C;  4P5O B;  3O37 A;  4WZ3 B;  3KQI A;  1WGM A;  1F62 A;  2EA6 A;  5AIU A;  5I3L A;  3ASL A;  2NAA A;  2ZET C;  1Z60 A;  3HCT A;  1BOR A;  1JM7 A;  2YQM A;  2XB1 A;  4BBQ A;  5B78 A;  2YU4 A;  4N3W A;  5H1V A;  4BHW A;  3LQJ A;  5TRB A;  1WE9 A;  2VP7 A;  2MUM A;  2H0D B;  2LDR A;  3T6R A;  3DPL R;  4L58 A;  2MD8 C;  2KU3 A;  3U5N A;  1WIL A;  4FO9 A;  2KWJ A;  5D1L B;  2VJE B;  3O70 A;  4ZDT A;  2ECW A;  2MT5 A;  1FP0 A;  3HCU A;  2YT5 A;  1X4J A;  2CKL B;  2F42 A;  3LQI A;  4GNF A;  4F52 B;  5H9M A;  1X4U A;  2IDA A;  4YAB A;  2LXP C;  2RSD A;  4W4U A;  2F6J A;  3IHP A;  3C5K A;  2QIC A;  2Y1M A;  3I2D A;  3N9O A;  2LGG A;  4R8P K;  2QIZ A;  4I7B A;  1G25 A;  2G45 A;  4MVT A;  2M6M A;  4B7Y C;  2F6N A;  2CSZ A;  2LQ6 A;  5LCW B;  2ECI A;  2YQL A;  2KRE A;  2FUU A;  2XEU A;  3PUQ A;  4WZ0 A;  4YBS A;  4YAT A;  1WEN A;  3QZV A;  2LGV A;  1WEP A;  4C9Z A;  2KE1 A;  3M99 A;  3FL2 A;  4UP0 A;  2JMJ A;  2KYU A;  2VPD A;  4V3K C;  2KR4 A;  2KWO A;  5B79 A;  4LK9 A;  1WEV A;  5C11 A;  2MA6 A;  2ECJ A;  4LJN A;  2Y43 A;  4CA1 A;  2YUC A;  3RTR B;  4LLB A;  2VPG A;  5G04 B;  2L43 A;  4R7E A;  3VK6 A;  2QJ0 A;  4PTB A;  5J3X A;  5G05 B;  2PUY A;  4A4C A;  2EGP A;  5EYA F;  4XI1 A;  5D1K B;  2MA5 A;  1X4I A;  3T7L A;  2LGK A;  3MHH A;  2Y1N A;  1WEO A;  2LV9 A;  3LQH A;  1WEQ A;  3KV5 A;  2M85 A;  4YBT A;  3HTK C;  3N9N A;  4YAX A;  4LAD B;  4YC9 A;  4AYC B;  1WIM A;  4L7X A;  2KFT A;  1Z6U A;  4GND A;  3L1Z B;  3ZPV E;  2VPB A;  2YYR A;  5B8D A;  2E6S A;  1VFY A;  1T1H A;  3O33 A;  1WEE A;  2G6Q A;  2VPE A;  4R2Y A;  4YBM A;  2YUR A;  4FJC A;  2KGI A;  1CHC A;  4I7D A;  5LKZ A;  5TBN A;  5B77 A;  2ECV A;  4ZUX U;  3DQV R;  4A49 A;  2UZG A;  1WES A;  4FIP A;  3PUR A;  3ZTG A;  1FBV A;  4A0C D;  2LGL A;  3MHS A;  1MM2 A;  5DIN A;  2H0D A;  1K2F A;  2LRI C;  3KV6 A;  2K16 A;  4NN2 A;  3GL6 A;  3M63 A;  2RI7 A;  3LRQ A;  1WFK A;  3N9P A;  4PPE A;  2VJE A;  3C6W A;  4X3G A;  4S3O C;  2PNX A;  3SOW A;  3ZVZ B;  3M62 A;  3O36 A;  2HDP A;  4IC3 A;  2CKL A;  3N9M A;  2ECT A;  3RPG B;  5FB0 A;  2VJF B;  5B75 A;  1WEW A;  5JG6 A;  5FB1 A;  4GB0 A;  5LKT A;  2YHO A;  5H1T A;  2M1R A;  2OXQ C;  3SHB A;  1DVP A;  4MSX A;  4YAD A;  4B86 C;  4UP5 A;  1Z2Q A;  4Q6F A;  3RPG C;  3O35 A;  4IC2 A;  2G43 A;  3PHD A;  4WA6 A;  3SOX A;  4N4F A;  2JMD A;  4QF3 A;  1JM7 B;  4FK5 A;  2HYE D;  3ZPV 1;  2KGG A;  3U5P A;  2ECN A;  2M3H A;  5KH7 A;  1MM3 A;  5AIT A;  4AP4 A;  5LKX A;  2KWK A;  5FER A;  2KWN A;  4O64 A;  3SOU A;  4LKA A;  5DKA A;  2LN0 A;  1XWH A;  3ZNI A;  1VD4 A;  1E4U A;  2FSA A;  1WEU A;  1HYI A;  1LDK C;  2C2V S;  2JRJ A;  2YHN A;  2MD7 B;  3EB5 A;  5KH3 A;  4ZQL A;  4UI9 B;  5B76 A;  1VYX A;  2ECG A;  3ZVY A;  4A4B A;  2CT2 A;  1RMD A;  5FEY A;  4QF2 A;  3ZYQ A;  2KIZ A;  4S3O B;  2MNY A;  4CCG X;  1ZBD B;  5KH9 A;  4AYC A;  3U5M A;  1IYM A;  1U6G B;  2YRE A;  1N87 A;  2E6R A;  5C13 A;  2MNZ A;  5H1U A;  1LDJ B;  2DX8 A;  2EOD A;  2CSY A;  2VNF A;  2K17 A;  2YSM A;  2K1J A;  4GNE A;  3N9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...