4UI9B

Atomic structure of the human anaphase-promoting complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
MKVKIKCWNGVALWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ui9B00
2CKLA 2MD7B 2QIZA 3DPLR 1WEVA 2YU4A 2C2LA 1WILA 2VPDA 1WEUA 3LQJA 4FIPA 2LV9A 2F6JA 4UP5A 5LKXA 5B78A 4WZ2A 2I50A 4CA1A 2YT5A 3U5PA 2PUYA 2YURA 4LK9A 2BAYA 1VFYA 1WEQA 2MUMA 2L5UA 2HDPA 1K2FA 5LKUA 2L43A 2KGIA 3NG2A 3ZTGA 1FBVA 2VPEA 2ZETC 2M85A 4TKPB 2YYRA 3PUQA 4GB0A 3SOUA 2EODA 2LXPC 4A49A 5B77A 4GNEA 4WA6A 2G6QA 1X4JA 2KYUA 4I7CA 2L0BA 4I7DA 4MVTA 4AYCB 2KWJA 4FJCA 3V43A 1WGMA 1X4IA 5FB1A 4GNGA 2H0DB 4B86C 3O70A 2JMIA 2FUUA 1MM2A 3EB5A 4I7BA 5B76A 2YSJA 2EGPA 2E6SA 2K16A 2LGVA 2PNXA 1HYIA 2KU3A 4A4CA 4R8PK 1WEWA 3ZPV1 3O35A 5B75A 5H9MA 3O36A 5DKAA 5FEYA 1VYXA 2Y43A 4BBQA 2VP7A 2G43A 1G25A 2L75A 5KH7A 4YBSA 1WIMA 4W4UA 3ZVYA 2XB1A 5G05B 3MHHA 2YHNA 2NAAA 3DQVR 5LKTA 4Q6FA 2KFTA 2M1RA 4XI1A 5TBNA 1Z60A 2M3HA 2KWNA 5B79A 2KE1A 4QF2A 2AN6A 5LCWB 1LDJB 3HCTA 4GNFA 5TRBA 4YBMA 2YQLA 4A4BA 2YQMA 4N3WA 4PTBA 2MNZA 3U5OA 3ZVZB 4YC9A 3L11A 2ECIA 4MSXA 1N87A 1E4UA 1Z2QA 3RPGC 2M6MA 1WEEA 4LKAA 2RI7A 1IYMA 5H1VA 1DVPA 2QJ0A 5LKZA 5AITA 3KV6A 2LN0A 5C13A 4AYCA 2QICA 3IHPA 4UP0A 3GL6A 2MNYA 2H0DA 5DINA 2KGGA 3N9MA 4CCGX 2ECVA 3KNVA 2EA6A 4ZUXU 4GNDA 1MM3A 1RMDA 2VPGA 2YW8A 3U5NA 3U5MA 2MD8C 2VJEB 5EYAF 3EB6A 3M63A 1U6GB 2VJFB 2CT2A 4LADB 5G0FA 5I3LA 2JRJA 3N9LA 3KV5A 4LLBA 4IC2A 4S3OB 1FP0A 2LXHC 5FERA 3FL2A 2FUIA 1WEMA 4P5OB 5D1KB 5B8DA 4AVXA 2LGKA 4S3OC 2XEUA 3L1ZB 1WEOA 2F42A 5KH3A 3ASLA 3LQIA 3LRQA 1JOCA 3O37A 5D1MB 3HCSA 1WE9A 2MT5A 3ZNIA 3HCUA 4L58A 1CHCA 3C5KA 2K17A 3ZPVE 3KQIA 4YATA 2YREA 2CKLB 4IC3A 5TDWA 2VJEA 2HYED 2JMDA 2MIQA 2MA5A 1XWHA 4WZ3B 2KWOA 5J3XA 4A0CD 3T6RA 2VNFA 5AIUA 1WEPA 3ZYQA 5TABA 4N4FA 2E6RA 2CSYA 2KR4A 2YHOA 2G45A 4O64A 1VD4A 1WFKA 2Y1NA 4BHWA 3LQHA 3N9NA 2C2VS 2ECWA 4X3GA 5H1TA 5G04B 4FO9A 2YSMA 2F6NA 4FK5A 3M99A 3PHDA 4R7EA 4AUQB 3C6WA 4V3LC 4ZDTA 4NN2A 4AP4A 1X4UA 4YADA 3T7LA 3O33A 2ECGA 2ECJA 3N9QA 2KREA 3HTKC 5C11A 4QF3A 2JMJA 2ECTA 4F52B 1V87A 2LDRA 2LRIC 4UI9B 2LGGA 4L7XA 4LJNA 2UZGA 2FSAA 1WENA 3VK6A 1T1HA 3O7AA 4V3KC 4B7YC 3L1XA 1ZBDB 2OXQC 2D8SA 4R2YA 4YAXA 3GV4A 3M62A 1WESA 5D1LB 3O34A 5FB0A 3PURA 3RPGB 2Y1MA 5JG6A 2VPBA 4YBTA 1HYJA 4YABA 2KIZA 3N9PA 3MHSA 4ZQLA 5H1UA 3N9OA 5TDRA 1JM7A 2VJFA 2YUCA 2LGLA 5KH9A 3SOWA 4PPEA 2MA6A 2CSZA 1JM7B 1Z6UA 2IDAA 3SHBA 4C9ZA 1LDKC 2K1JA 2LQ6A 1BORA 2L80A 3SOXA 2ECNA 2K4DA 3I2DA 3RTRB 4WZ0A 1F62A 2RSDA 2DX8A 3QZVA 2KWKA
chains in the Genus database with same CATH superfamily
2CKLA 2MD7B 2QIZA 3DPLR 1WEVA 3PLWA 2YU4A 2C2LA 1WILA 2VPDA 1WEUA 3LQJA 4FIPA 2LV9A 2F6JA 4UP5A 5LKXA 5B78A 4WZ2A 2I50A 4CA1A 2P57A 2YT5A 3U5PA 2PUYA 2YURA 4LK9A 2BAYA 1VFYA 1WEQA 2MUMA 2L5UA 2HDPA 1K2FA 5LKUA 2L43A 2KGIA 3NG2A 3ZTGA 1FBVA 2VPEA 2EGMA 2ZETC 1MBMA 3M7KA 3FM8C 2M85A 4TKPB 2YYRA 3PUQA 3FAOA 4GB0A 3SOUA 2EODA 2LXPC 4Z0RA 4A49A 5B77A 2CONA 4GNEA 4WA6A 2G6QA 2CSVA 1X4JA 2KYUA 4I7CA 2L0BA 3DWDA 4I7DA 2DSMA 4MVTA 5SVIB 4AYCB 2KWJA 4FJCA 3V43A 1WGMA 1X4IA 2FD4A 5FB1A 4GNGA 2H0DB 4B86C 3O70A 3LDYA 2JMIA 2FUUA 1MM2A 2JM3A 3EB5A 4I7BA 5B76A 2YSJA 2EGPA 2E6SA 2K16A 2LGVA 2PNXA 1HYIA 2KU3A 4A4CA 4R8PK 1WEWA 3ZPV1 3O35A 5B75A 5H9MA 3O36A 5DKAA 5FEYA 1VYXA 2Y43A 4BBQA 2VP7A 4O62A 2G43A 1G25A 2L75A 3T9KA 5KH7A 4YBSA 1WIMA 4W4UA 3ZVYA 2XB1A 3JUEA 5G05B 3MHHA 3LJUX 2YHNA 2NAAA 3DQVR 5LKTA 4Q6FA 2KFTA 2M1RA 4XI1A 5TBNA 1Z60A 2M3HA 2IQJA 2KWNA 5B79A 2KE1A 4QF2A 2AN6A 5LCWB 1LDJB 3HCTA 4GNFA 5TRBA 4YBMA 2YQLA 4A4BA 2YVRA 2YQMA 4N3WA 5SVXA 4PTBA 2MNZA 3U5OA 3ZVZB 4YC9A 3L11A 2ECIA 4MSXA 1N87A 1E4UA 1Z2QA 3RPGC 2M6MA 3MDBC 4H9DA 1WEEA 4LKAA 2RI7A 1IYMA 5H1VA 1DVPA 2QJ0A 5LKZA 5AITA 2XOZA 3KV6A 2LN0A 5C13A 4AYCA 4OGCA 2QICA 3IHPA 4UP0A 3GL6A 4F1PA 2MNYA 2H0DA 5DINA 2KGGA 3N9MA 4CCGX 2ECVA 3KNVA 2EA6A 4ZUXU 2CRRA 4GNDA 2LAUA 3LVQE 1MM3A 1RMDA 2VPGA 2YW8A 3U5NA 3U5MA 2MD8C 2VJEB 5EYAF 3EB6A 3M63A 1U6GB 2VJFB 3Q1DA 2CT2A 4LADB 5G0FA 5I3LA 2JRJA 3N9LA 3KV5A 4LLBA 4IC2A 4S3OB 1FP0A 2LXHC 5FERA 3FL2A 2FUIA 1WEMA 2E61A 4P5OB 3E2DA 5D1KB 4QQ4A 2OWAA 5B8DA 4AVXA 2LGKA 4S3OC 2XEUA 3L1ZB 1WEOA 2F42A 5KH3A 3ASLA 3LQIA 3LRQA 1JOCA 2XOYA 3O37A 5D1MB 3HCSA 1WE9A 2MT5A 3ZNIA 1DCQA 3HCUA 4L58A 1CHCA 3C5KA 2DJAA 2K17A 3ZPVE 3KQIA 4YATA 2YREA 2CKLB 4IC3A 5TDWA 2VJEA 2HYED 2JMDA 2MIQA 2MA5A 1XWHA 4WZ3B 2KWOA 2M13A 5J3XA 4A0CD 3T6RA 3FEHA 2VNFA 5AIUA 1WEPA 3ZYQA 5TABA 4N4FA 2D8UA 2E6RA 2CSYA 2YHOA 2KR4A 2G45A 2MKEA 1VD4A 2KKYA 4O64A 1WFKA 2Y1NA 4BHWA 2RR4A 3LQHA 3N9NA 2C2VS 2ECWA 4X3GA 5H1TA 5G04B 4FO9A 2YSMA 2EXUA 2F6NA 4FK5A 2B0OE 3M99A 3PHDA 4R7EA 4AUQB 3C6WA 4V3LC 4ZDTA 4NN2A 4AP4A 1X4UA 4YADA 3T7LA 3O33A 2ECGA 2ECJA 2JUNA 3N9QA 2KREA 3HTKC 5C11A 4QF3A 5SVYA 2JMJA 2ECTA 4F52B 1V87A 2LDRA 4Z0OA 2LRIC 4UI9B 2LGGA 4L7XA 2L7PA 4LJNA 2UZGA 2FSAA 1WENA 3VK6A 1T1HA 3O7AA 2CRWA 4V3KC 4B7YC 2KKXA 3L1XA 5K3QA 1ZBDB 2OXQC 2D8SA 4R2YA 4YAXA 3GV4A 2XOCA 3M62A 1WESA 5D1LB 3O34A 3KDEC 5FB0A 3PURA 3FANA 3RPGB 2Y1MA 5JG6A 2VPBA 4YBTA 1HYJA 4YABA 2KIZA 3N9PA 3MHSA 4ZQLA 3SUBA 5H1UA 3DDTA 3N9OA 5TDRA 1JM7A 2VJFA 2YUCA 2LGLA 5KH9A 3SOWA 4PPEA 2MA6A 2CSZA 3H7HA 1JM7B 1Z6UA 3FJUB 2IDAA 3SHBA 4C9ZA 1LDKC 2K1JA 2LQ6A 1BORA 2L80A 3SOXA 2ECNA 2K4DA 3I2DA 3RTRB 4WZ0A 3O47A 1F62A 2RSDA 2DX8A 5SVIA 4OGEA 3LVRE 3QZVA 2XP0A 2KWKA 2FFWA
chains in the Genus database with same CATH topology
2CKLA 2MD7B 2QIZA 3DPLR 1WEVA 2YU4A 2C2LA 1WILA 2VPDA 1WEUA 3LQJA 4FIPA 2LV9A 2F6JA 4UP5A 5LKXA 5B78A 4WZ2A 2I50A 4CA1A 2YT5A 3U5PA 2PUYA 2YURA 4LK9A 2BAYA 1VFYA 1WEQA 2MUMA 2L5UA 2HDPA 1K2FA 5LKUA 2L43A 2KGIA 3NG2A 3ZTGA 1FBVA 2VPEA 2ZETC 2M85A 4TKPB 2YYRA 3PUQA 4GB0A 3SOUA 2EODA 2LXPC 4A49A 5B77A 4GNEA 4WA6A 2G6QA 1X4JA 2KYUA 4I7CA 2L0BA 4I7DA 4MVTA 4AYCB 2KWJA 4FJCA 3V43A 1WGMA 1X4IA 5FB1A 4GNGA 2H0DB 4B86C 3O70A 2JMIA 2FUUA 1MM2A 3EB5A 4I7BA 5B76A 2YSJA 2EGPA 2E6SA 2K16A 2LGVA 2PNXA 1HYIA 2KU3A 4A4CA 4R8PK 1WEWA 3ZPV1 3O35A 5B75A 5H9MA 3O36A 5DKAA 5FEYA 1VYXA 2Y43A 4BBQA 2VP7A 2G43A 1G25A 2L75A 5KH7A 4YBSA 1WIMA 4W4UA 3ZVYA 2XB1A 5G05B 3MHHA 2YHNA 2NAAA 3DQVR 5LKTA 4Q6FA 2KFTA 2M1RA 4XI1A 5TBNA 1Z60A 2M3HA 2KWNA 5B79A 2KE1A 4QF2A 2AN6A 5LCWB 1LDJB 3HCTA 4GNFA 5TRBA 4YBMA 2YQLA 4A4BA 2YQMA 4N3WA 4PTBA 2MNZA 3U5OA 3ZVZB 4YC9A 3L11A 2ECIA 4MSXA 1N87A 1E4UA 1Z2QA 3RPGC 2M6MA 1WEEA 4LKAA 2RI7A 1IYMA 5H1VA 1DVPA 2QJ0A 5LKZA 5AITA 3KV6A 2LN0A 5C13A 4AYCA 2QICA 3IHPA 4UP0A 3GL6A 2MNYA 2H0DA 5DINA 2KGGA 3N9MA 4CCGX 2ECVA 3KNVA 2EA6A 4ZUXU 4GNDA 1MM3A 1RMDA 2VPGA 2YW8A 3U5NA 3U5MA 2MD8C 2VJEB 5EYAF 3EB6A 3M63A 1U6GB 2VJFB 2CT2A 4LADB 5G0FA 5I3LA 2JRJA 3N9LA 3KV5A 4LLBA 4IC2A 4S3OB 1FP0A 2LXHC 5FERA 3FL2A 2FUIA 1WEMA 4P5OB 5D1KB 5B8DA 4AVXA 2LGKA 4S3OC 2XEUA 3L1ZB 1WEOA 2F42A 5KH3A 3ASLA 3LQIA 3LRQA 1JOCA 3O37A 5D1MB 3HCSA 1WE9A 2MT5A 3ZNIA 3HCUA 4L58A 1CHCA 3C5KA 2K17A 3ZPVE 3KQIA 4YATA 2YREA 2CKLB 4IC3A 5TDWA 2VJEA 2HYED 2JMDA 2MIQA 2MA5A 1XWHA 4WZ3B 2KWOA 5J3XA 4A0CD 3T6RA 2VNFA 5AIUA 1WEPA 3ZYQA 5TABA 4N4FA 2E6RA 2CSYA 2KR4A 2YHOA 2G45A 4O64A 1VD4A 1WFKA 2Y1NA 4BHWA 3LQHA 3N9NA 2C2VS 2ECWA 4X3GA 5H1TA 5G04B 4FO9A 2YSMA 2F6NA 4FK5A 3M99A 3PHDA 4R7EA 4AUQB 3C6WA 4V3LC 4ZDTA 4NN2A 4AP4A 1X4UA 4YADA 3T7LA 3O33A 2ECGA 2ECJA 3N9QA 2KREA 3HTKC 5C11A 4QF3A 2JMJA 2ECTA 4F52B 1V87A 2LDRA 2LRIC 4UI9B 2LGGA 4L7XA 4LJNA 2UZGA 2FSAA 1WENA 3VK6A 1T1HA 3O7AA 4V3KC 4B7YC 3L1XA 1ZBDB 2OXQC 2D8SA 4R2YA 4YAXA 3GV4A 3M62A 1WESA 5D1LB 3O34A 5FB0A 3PURA 3RPGB 2Y1MA 5JG6A 2VPBA 4YBTA 1HYJA 4YABA 2KIZA 3N9PA 3MHSA 4ZQLA 5H1UA 3N9OA 5TDRA 1JM7A 2VJFA 2YUCA 2LGLA 5KH9A 3SOWA 4PPEA 2MA6A 2CSZA 1JM7B 1Z6UA 2IDAA 3SHBA 4C9ZA 1LDKC 2K1JA 2LQ6A 1BORA 2L80A 3SOXA 2ECNA 2K4DA 3I2DA 3RTRB 4WZ0A 1F62A 2RSDA 2DX8A 3QZVA 2KWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKL A;  2MD7 B;  2QIZ A;  3DPL R;  1WEV A;  2YU4 A;  2C2L A;  1WIL A;  2VPD A;  1WEU A;  3LQJ A;  4FIP A;  2LV9 A;  2F6J A;  4UP5 A;  5LKX A;  5B78 A;  4WZ2 A;  2I50 A;  4CA1 A;  2YT5 A;  3U5P A;  2PUY A;  2YUR A;  4LK9 A;  2BAY A;  1VFY A;  1WEQ A;  2MUM A;  2L5U A;  2HDP A;  1K2F A;  5LKU A;  2L43 A;  2KGI A;  3NG2 A;  3ZTG A;  1FBV A;  2VPE A;  2ZET C;  2M85 A;  4TKP B;  2YYR A;  3PUQ A;  4GB0 A;  3SOU A;  2EOD A;  2LXP C;  4A49 A;  5B77 A;  4GNE A;  4WA6 A;  2G6Q A;  1X4J A;  2KYU A;  4I7C A;  2L0B A;  4I7D A;  4MVT A;  4AYC B;  2KWJ A;  4FJC A;  3V43 A;  1WGM A;  1X4I A;  5FB1 A;  4GNG A;  2H0D B;  4B86 C;  3O70 A;  2JMI A;  2FUU A;  1MM2 A;  3EB5 A;  4I7B A;  5B76 A;  2YSJ A;  2EGP A;  2E6S A;  2K16 A;  2LGV A;  2PNX A;  1HYI A;  2KU3 A;  4A4C A;  4R8P K;  1WEW A;  3ZPV 1;  3O35 A;  5B75 A;  5H9M A;  3O36 A;  5DKA A;  5FEY A;  1VYX A;  2Y43 A;  4BBQ A;  2VP7 A;  2G43 A;  1G25 A;  2L75 A;  5KH7 A;  4YBS A;  1WIM A;  4W4U A;  3ZVY A;  2XB1 A;  5G05 B;  3MHH A;  2YHN A;  2NAA A;  3DQV R;  5LKT A;  4Q6F A;  2KFT A;  2M1R A;  4XI1 A;  5TBN A;  1Z60 A;  2M3H A;  2KWN A;  5B79 A;  2KE1 A;  4QF2 A;  2AN6 A;  5LCW B;  1LDJ B;  3HCT A;  4GNF A;  5TRB A;  4YBM A;  2YQL A;  4A4B A;  2YQM A;  4N3W A;  4PTB A;  2MNZ A;  3U5O A;  3ZVZ B;  4YC9 A;  3L11 A;  2ECI A;  4MSX A;  1N87 A;  1E4U A;  1Z2Q A;  3RPG C;  2M6M A;  1WEE A;  4LKA A;  2RI7 A;  1IYM A;  5H1V A;  1DVP A;  2QJ0 A;  5LKZ A;  5AIT A;  3KV6 A;  2LN0 A;  5C13 A;  4AYC A;  2QIC A;  3IHP A;  4UP0 A;  3GL6 A;  2MNY A;  2H0D A;  5DIN A;  2KGG A;  3N9M A;  4CCG X;  2ECV A;  3KNV A;  2EA6 A;  4ZUX U;  4GND A;  1MM3 A;  1RMD A;  2VPG A;  2YW8 A;  3U5N A;  3U5M A;  2MD8 C;  2VJE B;  5EYA F;  3EB6 A;  3M63 A;  1U6G B;  2VJF B;  2CT2 A;  4LAD B;  5G0F A;  5I3L A;  2JRJ A;  3N9L A;  3KV5 A;  4LLB A;  4IC2 A;  4S3O B;  1FP0 A;  2LXH C;  5FER A;  3FL2 A;  2FUI A;  1WEM A;  4P5O B;  5D1K B;  5B8D A;  4AVX A;  2LGK A;  4S3O C;  2XEU A;  3L1Z B;  1WEO A;  2F42 A;  5KH3 A;  3ASL A;  3LQI A;  3LRQ A;  1JOC A;  3O37 A;  5D1M B;  3HCS A;  1WE9 A;  2MT5 A;  3ZNI A;  3HCU A;  4L58 A;  1CHC A;  3C5K A;  2K17 A;  3ZPV E;  3KQI A;  4YAT A;  2YRE A;  2CKL B;  4IC3 A;  5TDW A;  2VJE A;  2HYE D;  2JMD A;  2MIQ A;  2MA5 A;  1XWH A;  4WZ3 B;  2KWO A;  5J3X A;  4A0C D;  3T6R A;  2VNF A;  5AIU A;  1WEP A;  3ZYQ A;  5TAB A;  4N4F A;  2E6R A;  2CSY A;  2KR4 A;  2YHO A;  2G45 A;  4O64 A;  1VD4 A;  1WFK A;  2Y1N A;  4BHW A;  3LQH A;  3N9N A;  2C2V S;  2ECW A;  4X3G A;  5H1T A;  5G04 B;  4FO9 A;  2YSM A;  2F6N A;  4FK5 A;  3M99 A;  3PHD A;  4R7E A;  4AUQ B;  3C6W A;  4V3L C;  4ZDT A;  4NN2 A;  4AP4 A;  1X4U A;  4YAD A;  3T7L A;  3O33 A;  2ECG A;  2ECJ A;  3N9Q A;  2KRE A;  3HTK C;  5C11 A;  4QF3 A;  2JMJ A;  2ECT A;  4F52 B;  1V87 A;  2LDR A;  2LRI C;  4UI9 B;  2LGG A;  4L7X A;  4LJN A;  2UZG A;  2FSA A;  1WEN A;  3VK6 A;  1T1H A;  3O7A A;  4V3K C;  4B7Y C;  3L1X A;  1ZBD B;  2OXQ C;  2D8S A;  4R2Y A;  4YAX A;  3GV4 A;  3M62 A;  1WES A;  5D1L B;  3O34 A;  5FB0 A;  3PUR A;  3RPG B;  2Y1M A;  5JG6 A;  2VPB A;  4YBT A;  1HYJ A;  4YAB A;  2KIZ A;  3N9P A;  3MHS A;  4ZQL A;  5H1U A;  3N9O A;  5TDR A;  1JM7 A;  2VJF A;  2YUC A;  2LGL A;  5KH9 A;  3SOW A;  4PPE A;  2MA6 A;  2CSZ A;  1JM7 B;  1Z6U A;  2IDA A;  3SHB A;  4C9Z A;  1LDK C;  2K1J A;  2LQ6 A;  1BOR A;  2L80 A;  3SOX A;  2ECN A;  2K4D A;  3I2D A;  3RTR B;  4WZ0 A;  1F62 A;  2RSD A;  2DX8 A;  3QZV A;  2KWK A; 
#chains in the Genus database with same CATH topology
 2CKL A;  2MD7 B;  2QIZ A;  3DPL R;  1WEV A;  3PLW A;  2YU4 A;  2C2L A;  1WIL A;  2VPD A;  1WEU A;  3LQJ A;  4FIP A;  2LV9 A;  2F6J A;  4UP5 A;  5LKX A;  5B78 A;  4WZ2 A;  2I50 A;  4CA1 A;  2P57 A;  2YT5 A;  3U5P A;  2PUY A;  2YUR A;  4LK9 A;  2BAY A;  1VFY A;  1WEQ A;  2MUM A;  2L5U A;  2HDP A;  1K2F A;  5LKU A;  2L43 A;  2KGI A;  3NG2 A;  3ZTG A;  1FBV A;  2VPE A;  2EGM A;  2ZET C;  1MBM A;  3M7K A;  3FM8 C;  2M85 A;  4TKP B;  2YYR A;  3PUQ A;  3FAO A;  4GB0 A;  3SOU A;  2EOD A;  2LXP C;  4Z0R A;  4A49 A;  5B77 A;  2CON A;  4GNE A;  4WA6 A;  2G6Q A;  2CSV A;  1X4J A;  2KYU A;  4I7C A;  2L0B A;  3DWD A;  4I7D A;  2DSM A;  4MVT A;  5SVI B;  4AYC B;  2KWJ A;  4FJC A;  3V43 A;  1WGM A;  1X4I A;  2FD4 A;  5FB1 A;  4GNG A;  2H0D B;  4B86 C;  3O70 A;  3LDY A;  2JMI A;  2FUU A;  1MM2 A;  2JM3 A;  3EB5 A;  4I7B A;  5B76 A;  2YSJ A;  2EGP A;  2E6S A;  2K16 A;  2LGV A;  2PNX A;  1HYI A;  2KU3 A;  4A4C A;  4R8P K;  1WEW A;  3ZPV 1;  3O35 A;  5B75 A;  5H9M A;  3O36 A;  5DKA A;  5FEY A;  1VYX A;  2Y43 A;  4BBQ A;  2VP7 A;  4O62 A;  2G43 A;  1G25 A;  2L75 A;  3T9K A;  5KH7 A;  4YBS A;  1WIM A;  4W4U A;  3ZVY A;  2XB1 A;  3JUE A;  5G05 B;  3MHH A;  3LJU X;  2YHN A;  2NAA A;  3DQV R;  5LKT A;  4Q6F A;  2KFT A;  2M1R A;  4XI1 A;  5TBN A;  1Z60 A;  2M3H A;  2IQJ A;  2KWN A;  5B79 A;  2KE1 A;  4QF2 A;  2AN6 A;  5LCW B;  1LDJ B;  3HCT A;  4GNF A;  5TRB A;  4YBM A;  2YQL A;  4A4B A;  2YVR A;  2YQM A;  4N3W A;  5SVX A;  4PTB A;  2MNZ A;  3U5O A;  3ZVZ B;  4YC9 A;  3L11 A;  2ECI A;  4MSX A;  1N87 A;  1E4U A;  1Z2Q A;  3RPG C;  2M6M A;  3MDB C;  4H9D A;  1WEE A;  4LKA A;  2RI7 A;  1IYM A;  5H1V A;  1DVP A;  2QJ0 A;  5LKZ A;  5AIT A;  2XOZ A;  3KV6 A;  2LN0 A;  5C13 A;  4AYC A;  4OGC A;  2QIC A;  3IHP A;  4UP0 A;  3GL6 A;  4F1P A;  2MNY A;  2H0D A;  5DIN A;  2KGG A;  3N9M A;  4CCG X;  2ECV A;  3KNV A;  2EA6 A;  4ZUX U;  2CRR A;  4GND A;  2LAU A;  3LVQ E;  1MM3 A;  1RMD A;  2VPG A;  2YW8 A;  3U5N A;  3U5M A;  2MD8 C;  2VJE B;  5EYA F;  3EB6 A;  3M63 A;  1U6G B;  2VJF B;  3Q1D A;  2CT2 A;  4LAD B;  5G0F A;  5I3L A;  2JRJ A;  3N9L A;  3KV5 A;  4LLB A;  4IC2 A;  4S3O B;  1FP0 A;  2LXH C;  5FER A;  3FL2 A;  2FUI A;  1WEM A;  2E61 A;  4P5O B;  3E2D A;  5D1K B;  4QQ4 A;  2OWA A;  5B8D A;  4AVX A;  2LGK A;  4S3O C;  2XEU A;  3L1Z B;  1WEO A;  2F42 A;  5KH3 A;  3ASL A;  3LQI A;  3LRQ A;  1JOC A;  2XOY A;  3O37 A;  5D1M B;  3HCS A;  1WE9 A;  2MT5 A;  3ZNI A;  1DCQ A;  3HCU A;  4L58 A;  1CHC A;  3C5K A;  2DJA A;  2K17 A;  3ZPV E;  3KQI A;  4YAT A;  2YRE A;  2CKL B;  4IC3 A;  5TDW A;  2VJE A;  2HYE D;  2JMD A;  2MIQ A;  2MA5 A;  1XWH A;  4WZ3 B;  2KWO A;  2M13 A;  5J3X A;  4A0C D;  3T6R A;  3FEH A;  2VNF A;  5AIU A;  1WEP A;  3ZYQ A;  5TAB A;  4N4F A;  2D8U A;  2E6R A;  2CSY A;  2YHO A;  2KR4 A;  2G45 A;  2MKE A;  1VD4 A;  2KKY A;  4O64 A;  1WFK A;  2Y1N A;  4BHW A;  2RR4 A;  3LQH A;  3N9N A;  2C2V S;  2ECW A;  4X3G A;  5H1T A;  5G04 B;  4FO9 A;  2YSM A;  2EXU A;  2F6N A;  4FK5 A;  2B0O E;  3M99 A;  3PHD A;  4R7E A;  4AUQ B;  3C6W A;  4V3L C;  4ZDT A;  4NN2 A;  4AP4 A;  1X4U A;  4YAD A;  3T7L A;  3O33 A;  2ECG A;  2ECJ A;  2JUN A;  3N9Q A;  2KRE A;  3HTK C;  5C11 A;  4QF3 A;  5SVY A;  2JMJ A;  2ECT A;  4F52 B;  1V87 A;  2LDR A;  4Z0O A;  2LRI C;  4UI9 B;  2LGG A;  4L7X A;  2L7P A;  4LJN A;  2UZG A;  2FSA A;  1WEN A;  3VK6 A;  1T1H A;  3O7A A;  2CRW A;  4V3K C;  4B7Y C;  2KKX A;  3L1X A;  5K3Q A;  1ZBD B;  2OXQ C;  2D8S A;  4R2Y A;  4YAX A;  3GV4 A;  2XOC A;  3M62 A;  1WES A;  5D1L B;  3O34 A;  3KDE C;  5FB0 A;  3PUR A;  3FAN A;  3RPG B;  2Y1M A;  5JG6 A;  2VPB A;  4YBT A;  1HYJ A;  4YAB A;  2KIZ A;  3N9P A;  3MHS A;  4ZQL A;  3SUB A;  5H1U A;  3DDT A;  3N9O A;  5TDR A;  1JM7 A;  2VJF A;  2YUC A;  2LGL A;  5KH9 A;  3SOW A;  4PPE A;  2MA6 A;  2CSZ A;  3H7H A;  1JM7 B;  1Z6U A;  3FJU B;  2IDA A;  3SHB A;  4C9Z A;  1LDK C;  2K1J A;  2LQ6 A;  1BOR A;  2L80 A;  3SOX A;  2ECN A;  2K4D A;  3I2D A;  3RTR B;  4WZ0 A;  3O47 A;  1F62 A;  2RSD A;  2DX8 A;  5SVI A;  4OGE A;  3LVR E;  3QZV A;  2XP0 A;  2KWK A;  2FFW A; 
#chains in the Genus database with same CATH homology
 2CKL A;  2MD7 B;  2QIZ A;  3DPL R;  1WEV A;  2YU4 A;  2C2L A;  1WIL A;  2VPD A;  1WEU A;  3LQJ A;  4FIP A;  2LV9 A;  2F6J A;  4UP5 A;  5LKX A;  5B78 A;  4WZ2 A;  2I50 A;  4CA1 A;  2YT5 A;  3U5P A;  2PUY A;  2YUR A;  4LK9 A;  2BAY A;  1VFY A;  1WEQ A;  2MUM A;  2L5U A;  2HDP A;  1K2F A;  5LKU A;  2L43 A;  2KGI A;  3NG2 A;  3ZTG A;  1FBV A;  2VPE A;  2ZET C;  2M85 A;  4TKP B;  2YYR A;  3PUQ A;  4GB0 A;  3SOU A;  2EOD A;  2LXP C;  4A49 A;  5B77 A;  4GNE A;  4WA6 A;  2G6Q A;  1X4J A;  2KYU A;  4I7C A;  2L0B A;  4I7D A;  4MVT A;  4AYC B;  2KWJ A;  4FJC A;  3V43 A;  1WGM A;  1X4I A;  5FB1 A;  4GNG A;  2H0D B;  4B86 C;  3O70 A;  2JMI A;  2FUU A;  1MM2 A;  3EB5 A;  4I7B A;  5B76 A;  2YSJ A;  2EGP A;  2E6S A;  2K16 A;  2LGV A;  2PNX A;  1HYI A;  2KU3 A;  4A4C A;  4R8P K;  1WEW A;  3ZPV 1;  3O35 A;  5B75 A;  5H9M A;  3O36 A;  5DKA A;  5FEY A;  1VYX A;  2Y43 A;  4BBQ A;  2VP7 A;  2G43 A;  1G25 A;  2L75 A;  5KH7 A;  4YBS A;  1WIM A;  4W4U A;  3ZVY A;  2XB1 A;  5G05 B;  3MHH A;  2YHN A;  2NAA A;  3DQV R;  5LKT A;  4Q6F A;  2KFT A;  2M1R A;  4XI1 A;  5TBN A;  1Z60 A;  2M3H A;  2KWN A;  5B79 A;  2KE1 A;  4QF2 A;  2AN6 A;  5LCW B;  1LDJ B;  3HCT A;  4GNF A;  5TRB A;  4YBM A;  2YQL A;  4A4B A;  2YQM A;  4N3W A;  4PTB A;  2MNZ A;  3U5O A;  3ZVZ B;  4YC9 A;  3L11 A;  2ECI A;  4MSX A;  1N87 A;  1E4U A;  1Z2Q A;  3RPG C;  2M6M A;  1WEE A;  4LKA A;  2RI7 A;  1IYM A;  5H1V A;  1DVP A;  2QJ0 A;  5LKZ A;  5AIT A;  3KV6 A;  2LN0 A;  5C13 A;  4AYC A;  2QIC A;  3IHP A;  4UP0 A;  3GL6 A;  2MNY A;  2H0D A;  5DIN A;  2KGG A;  3N9M A;  4CCG X;  2ECV A;  3KNV A;  2EA6 A;  4ZUX U;  4GND A;  1MM3 A;  1RMD A;  2VPG A;  2YW8 A;  3U5N A;  3U5M A;  2MD8 C;  2VJE B;  5EYA F;  3EB6 A;  3M63 A;  1U6G B;  2VJF B;  2CT2 A;  4LAD B;  5G0F A;  5I3L A;  2JRJ A;  3N9L A;  3KV5 A;  4LLB A;  4IC2 A;  4S3O B;  1FP0 A;  2LXH C;  5FER A;  3FL2 A;  2FUI A;  1WEM A;  4P5O B;  5D1K B;  5B8D A;  4AVX A;  2LGK A;  4S3O C;  2XEU A;  3L1Z B;  1WEO A;  2F42 A;  5KH3 A;  3ASL A;  3LQI A;  3LRQ A;  1JOC A;  3O37 A;  5D1M B;  3HCS A;  1WE9 A;  2MT5 A;  3ZNI A;  3HCU A;  4L58 A;  1CHC A;  3C5K A;  2K17 A;  3ZPV E;  3KQI A;  4YAT A;  2YRE A;  2CKL B;  4IC3 A;  5TDW A;  2VJE A;  2HYE D;  2JMD A;  2MIQ A;  2MA5 A;  1XWH A;  4WZ3 B;  2KWO A;  5J3X A;  4A0C D;  3T6R A;  2VNF A;  5AIU A;  1WEP A;  3ZYQ A;  5TAB A;  4N4F A;  2E6R A;  2CSY A;  2KR4 A;  2YHO A;  2G45 A;  4O64 A;  1VD4 A;  1WFK A;  2Y1N A;  4BHW A;  3LQH A;  3N9N A;  2C2V S;  2ECW A;  4X3G A;  5H1T A;  5G04 B;  4FO9 A;  2YSM A;  2F6N A;  4FK5 A;  3M99 A;  3PHD A;  4R7E A;  4AUQ B;  3C6W A;  4V3L C;  4ZDT A;  4NN2 A;  4AP4 A;  1X4U A;  4YAD A;  3T7L A;  3O33 A;  2ECG A;  2ECJ A;  3N9Q A;  2KRE A;  3HTK C;  5C11 A;  4QF3 A;  2JMJ A;  2ECT A;  4F52 B;  1V87 A;  2LDR A;  2LRI C;  4UI9 B;  2LGG A;  4L7X A;  4LJN A;  2UZG A;  2FSA A;  1WEN A;  3VK6 A;  1T1H A;  3O7A A;  4V3K C;  4B7Y C;  3L1X A;  1ZBD B;  2OXQ C;  2D8S A;  4R2Y A;  4YAX A;  3GV4 A;  3M62 A;  1WES A;  5D1L B;  3O34 A;  5FB0 A;  3PUR A;  3RPG B;  2Y1M A;  5JG6 A;  2VPB A;  4YBT A;  1HYJ A;  4YAB A;  2KIZ A;  3N9P A;  3MHS A;  4ZQL A;  5H1U A;  3N9O A;  5TDR A;  1JM7 A;  2VJF A;  2YUC A;  2LGL A;  5KH9 A;  3SOW A;  4PPE A;  2MA6 A;  2CSZ A;  1JM7 B;  1Z6U A;  2IDA A;  3SHB A;  4C9Z A;  1LDK C;  2K1J A;  2LQ6 A;  1BOR A;  2L80 A;  3SOX A;  2ECN A;  2K4D A;  3I2D A;  3RTR B;  4WZ0 A;  1F62 A;  2RSD A;  2DX8 A;  3QZV A;  2KWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...