4UI9B

Atomic structure of the human anaphase-promoting complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
84
structure length
84
Chain Sequence
MKVKIKCWNGVALWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
total genus 11
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ui9B00
5FERA 2EA6A 3SHBA 3O34A 4YBMA 1WGMA 2XB1A 1FBVA 3RTRB 2YU4A 1N87A 4FJCA 3U5PA 3DPLR 2C2LA 2IDAA 3U5MA 5KH3A 2MD8C 5H9MA 2QJ0A 2KREA 4UP0A 1WEMA 2LGKA 1MM3A 3C6WA 2MUMA 1MM2A 3ZVYA 2VJEB 3SOWA 3L1XA 2F6JA 5AIUA 3QZVA 2ZETC 5D1LB 2VJEA 4NN2A 2KFTA 4YATA 5D1MB 2YREA 2ECTA 2M1RA 2VPDA 1WEVA 4MVTA 1T1HA 2E6SA 2YW8A 1VD4A 3N9QA 3RPGC 2LQ6A 1X4IA 4UP5A 2OXQC 1JOCA 4B86C 3KV6A 1WFKA 2AN6A 3L11A 2YT5A 5LKXA 2K16A 2EODA 2M6MA 3LQHA 5H1UA 2LXHC 2L0BA 4BHWA 1CHCA 2KWJA 2KWKA 2CKLB 2L5UA 4YBTA 2QIZA 4GNDA 2E6RA 5G04B 4YAXA 2LGGA 4LKAA 2NAAA 1WE9A 3ZPV1 5H1VA 1K2FA 4CA1A 4L7XA 2KYUA 2KWOA 3ASLA 5TBNA 1WILA 2ECVA 3HCUA 1WEPA 3ZTGA 4O64A 2YYRA 2YQMA 5FEYA 2D8SA 4AYCA 1Z2QA 3T7LA 3O70A 1LDKC 3HCTA 2ECGA 3I2DA 3PURA 1LDJB 3N9OA 3KQIA 5I3LA 2FUIA 5G05B 2YSJA 3L1ZB 2L75A 2PUYA 3KV5A 5KH9A 2DX8A 3SOUA 1ZBDB 2EGPA 2LN0A 1V87A 2CT2A 1JM7B 1VFYA 1HYIA 3LQIA 2K1JA 1Z6UA 1U6GB 2I50A 2K4DA 2KE1A 3SOXA 3ZNIA 5B79A 3T6RA 5B78A 2VJFB 3O35A 3V43A 4F52B 5D1KB 2BAYA 1JM7A 4YADA 4IC2A 1BORA 4V3LC 2C2VS 3DQVR 4WZ0A 4WZ2A 4LK9A 5TDRA 4B7YC 3N9PA 4YBSA 3HTKC 2M3HA 2MA5A 2LRIC 2L80A 1RMDA 4PTBA 4A4BA 4TKPB 4Q6FA 4A0CD 2VPEA 5AITA 2G45A 1F62A 4S3OB 4IC3A 2PNXA 1Z60A 4FO9A 3MHSA 2K17A 1WEOA 4GB0A 4WZ3B 2MNYA 5TABA 4ZUXU 5LKTA 5LKZA 1WEUA 4ZDTA 4A49A 1FP0A 3U5OA 4GNEA 2MIQA 5TDWA 3N9NA 3HCSA 2HDPA 4AYCB 2JRJA 2YUCA 4YABA 2VNFA 5J3XA 4A4CA 4AUQB 2KWNA 3M99A 4W4UA 3LRQA 3MHHA 5FB1A 2JMJA 4LLBA 2CSYA 1WIMA 4I7BA 4WA6A 5B75A 2YSMA 4UI9B 5EYAF 5B76A 2VPBA 4R2YA 3FL2A 2XEUA 2JMDA 4GNGA 3EB5A 2H0DB 4ZQLA 5G0FA 2KR4A 3N9LA 4AP4A 3U5NA 5LCWB 4L58A 5LKUA 2JMIA 1WESA 2Y1MA 2MNZA 3ZYQA 2FUUA 1WEWA 4X3GA 5FB0A 5H1TA 4PPEA 3ZPVE 4YC9A 3RPGB 2Y1NA 2RSDA 4AVXA 3EB6A 5C11A 1E4UA 3PHDA 2YHOA 2LGLA 4QF2A 1WEEA 2LGVA 2MA6A 3M62A 2CSZA 4C9ZA 1XWHA 2KU3A 3O33A 2HYED 2G6QA 3O37A 3GV4A 4R8PK 1HYJA 3PUQA 1X4JA 2MD7B 4V3KC 5C13A 5TRBA 4P5OB 5DKAA 2LV9A 3O36A 3M63A 3LQJA 4I7DA 2ECJA 3IHPA 4I7CA 4LADB 2VP7A 2LXPC 2F6NA 2FSAA 1X4UA 4N3WA 1WENA 2MT5A 3C5KA 2YURA 2RI7A 2YQLA 5KH7A 2KIZA 4R7EA 2CKLA 2QICA 3ZVZB 4BBQA 2ECWA 3N9MA 1G25A 2VPGA 4N4FA 3NG2A 4LJNA 5DINA 2ECIA 2G43A 2KGGA 2ECNA 4FK5A 2VJFA 4GNFA 2KGIA 4FIPA 4MSXA 4XI1A 1DVPA 1IYMA 3VK6A 4S3OC 5B77A 2H0DA 2YHNA 3GL6A 4QF3A 5JG6A 2M85A 3O7AA 2Y43A 1WEQA 3KNVA 2L43A 2UZGA 2F42A 2LDRA 1VYXA 4CCGX 5B8DA
chains in the Genus database with same CATH superfamily
5FERA 2EA6A 3SHBA 3O34A 2FFWA 3LJUX 4YBMA 2KKYA 4Z0OA 1WGMA 2XB1A 3FEHA 1FBVA 2XP0A 3RTRB 2YU4A 1N87A 4FJCA 3U5PA 3DPLR 2C2LA 2IDAA 2JM3A 3U5MA 5KH3A 2MD8C 5H9MA 2QJ0A 2KREA 4UP0A 3DDTA 1WEMA 2LGKA 1MM3A 3C6WA 2MUMA 1MM2A 3ZVYA 2VJEB 3SOWA 3T9KA 3L1XA 2F6JA 5AIUA 5K3QA 3QZVA 2ZETC 5D1LB 2VJEA 2CRWA 4NN2A 2XOYA 2KFTA 4YATA 5D1MB 2YREA 2ECTA 2M1RA 2EGMA 2VPDA 1WEVA 4MVTA 1T1HA 4O62A 2E6SA 2YW8A 1VD4A 3N9QA 3RPGC 2LQ6A 1X4IA 4UP5A 2OXQC 1JOCA 2DJAA 4B86C 3KV6A 1WFKA 2AN6A 3L11A 2YT5A 2IQJA 5LKXA 2K16A 2EODA 2M6MA 3LQHA 5H1UA 2LXHC 2L0BA 4BHWA 1CHCA 1DCQA 2KWJA 2KWKA 2CKLB 2L5UA 4YBTA 2QIZA 4GNDA 2E6RA 5G04B 4YAXA 2LGGA 4LKAA 2NAAA 1WE9A 3ZPV1 5H1VA 1K2FA 3O47A 4CA1A 4L7XA 2KYUA 3E2DA 2KWOA 3ASLA 5TBNA 1WILA 2ECVA 3HCUA 1WEPA 3ZTGA 4O64A 2YYRA 2DSMA 2YQMA 5FEYA 2D8SA 4AYCA 1Z2QA 2OWAA 3T7LA 3O70A 1LDKC 2XOCA 3HCTA 3KDEC 2ECGA 5B8DA 3I2DA 3PURA 1LDJB 3N9OA 3KQIA 5I3LA 2FUIA 2E61A 5G05B 2YSJA 3L1ZB 2L75A 2PUYA 3KV5A 5KH9A 2RR4A 2DX8A 3SOUA 1ZBDB 2EGPA 2LN0A 3FM8C 1V87A 2YVRA 2CT2A 1JM7B 1VFYA 1HYIA 3LQIA 2K1JA 4OGCA 1Z6UA 1U6GB 3FAOA 2I50A 2K4DA 2KE1A 3SOXA 3ZNIA 5B79A 3T6RA 5B78A 3PLWA 2VJFB 3O35A 4OGEA 3V43A 4F52B 5D1KB 2BAYA 1JM7A 4YADA 4IC2A 1BORA 4V3LC 2C2VS 3DQVR 4WZ0A 4WZ2A 4LK9A 2CRRA 5TDRA 4B7YC 2D8UA 3N9PA 4YBSA 3HTKC 2M3HA 2MA5A 2LRIC 2L80A 1RMDA 4PTBA 4A4BA 4TKPB 4Q6FA 4F1PA 4Z0RA 4A0CD 5SVIB 2VPEA 3FANA 5AITA 2G45A 1F62A 4S3OB 2M13A 4IC3A 2PNXA 1Z60A 4FO9A 3MHSA 2K17A 1WEOA 4GB0A 4WZ3B 2MNYA 5TABA 4ZUXU 5LKTA 2KKXA 5LKZA 2L7PA 1WEUA 4ZDTA 4A49A 2CSVA 4H9DA 1FP0A 3U5OA 4GNEA 2MIQA 5TDWA 3N9NA 3HCSA 2HDPA 4AYCB 2JRJA 2YUCA 4YABA 3LDYA 2VNFA 3FJUB 4QQ4A 5J3XA 4A4CA 4AUQB 2KWNA 3M99A 3SUBA 4W4UA 3LRQA 3LVRE 3MHHA 5FB1A 2JMJA 4LLBA 2CSYA 1WIMA 4I7BA 4WA6A 5B75A 2YSMA 4UI9B 5EYAF 5B76A 3M7KA 2VPBA 4R2YA 3FL2A 2XEUA 2JMDA 4GNGA 3EB5A 2H0DB 4ZQLA 5G0FA 2KR4A 3N9LA 4AP4A 3U5NA 5LCWB 4L58A 3H7HA 5LKUA 2JMIA 1WESA 2Y1MA 2MNZA 2LAUA 5SVIA 3ZYQA 2FUUA 4X3GA 5FB0A 2FD4A 5SVYA 5H1TA 4PPEA 2P57A 3ZPVE 4YC9A 3RPGB 2Y1NA 2RSDA 4AVXA 3EB6A 5C11A 1E4UA 3PHDA 2YHOA 2LGLA 2XOZA 4QF2A 1WEEA 2LGVA 2MA6A 3Q1DA 3M62A 2CSZA 4C9ZA 1XWHA 2CONA 2EXUA 2KU3A 3O33A 2HYED 2G6QA 3O37A 3GV4A 4R8PK 1HYJA 3PUQA 1X4JA 2B0OE 2MD7B 4V3KC 5C13A 5TRBA 4P5OB 5DKAA 2LV9A 3O36A 3M63A 3LQJA 4I7DA 2MKEA 1MBMA 2ECJA 3IHPA 4I7CA 4LADB 2VP7A 2LXPC 2F6NA 2FSAA 1X4UA 4N3WA 3MDBC 1WENA 2MT5A 3C5KA 2YURA 3LVQE 2RI7A 2YQLA 5KH7A 2KIZA 4R7EA 2CKLA 2QICA 3ZVZB 4BBQA 2ECWA 3N9MA 1G25A 2VPGA 4N4FA 3NG2A 4LJNA 5DINA 2ECIA 2G43A 2KGGA 3JUEA 2ECNA 4FK5A 2VJFA 4GNFA 2KGIA 4FIPA 4MSXA 4XI1A 1DVPA 5SVXA 1IYMA 3VK6A 4S3OC 5B77A 2H0DA 2YHNA 4QF3A 3GL6A 5JG6A 2M85A 3O7AA 2Y43A 1WEQA 3KNVA 3DWDA 2L43A 2UZGA 2JUNA 2F42A 2LDRA 1VYXA 4CCGX 1WEWA
chains in the Genus database with same CATH topology
5FERA 2EA6A 3SHBA 3O34A 4YBMA 1WGMA 2XB1A 1FBVA 3RTRB 2YU4A 1N87A 4FJCA 3U5PA 3DPLR 2C2LA 2IDAA 3U5MA 5KH3A 2MD8C 5H9MA 2QJ0A 2KREA 4UP0A 1WEMA 2LGKA 1MM3A 3C6WA 2MUMA 1MM2A 3ZVYA 2VJEB 3SOWA 3L1XA 2F6JA 5AIUA 3QZVA 2ZETC 5D1LB 2VJEA 4NN2A 2KFTA 4YATA 5D1MB 2YREA 2ECTA 2M1RA 2VPDA 1WEVA 4MVTA 1T1HA 2E6SA 2YW8A 1VD4A 3N9QA 3RPGC 2LQ6A 1X4IA 4UP5A 2OXQC 1JOCA 4B86C 3KV6A 1WFKA 2AN6A 3L11A 2YT5A 5LKXA 2K16A 2EODA 2M6MA 3LQHA 5H1UA 2LXHC 2L0BA 4BHWA 1CHCA 2KWJA 2KWKA 2CKLB 2L5UA 4YBTA 2QIZA 4GNDA 2E6RA 5G04B 4YAXA 2LGGA 4LKAA 2NAAA 1WE9A 3ZPV1 5H1VA 1K2FA 4CA1A 4L7XA 2KYUA 2KWOA 3ASLA 5TBNA 1WILA 2ECVA 3HCUA 1WEPA 3ZTGA 4O64A 2YYRA 2YQMA 5FEYA 2D8SA 4AYCA 1Z2QA 3T7LA 3O70A 1LDKC 3HCTA 2ECGA 3I2DA 3PURA 1LDJB 3N9OA 3KQIA 5I3LA 2FUIA 5G05B 2YSJA 3L1ZB 2L75A 2PUYA 3KV5A 5KH9A 2DX8A 3SOUA 1ZBDB 2EGPA 2LN0A 1V87A 2CT2A 1JM7B 1VFYA 1HYIA 3LQIA 2K1JA 1Z6UA 1U6GB 2I50A 2K4DA 2KE1A 3SOXA 3ZNIA 5B79A 3T6RA 5B78A 2VJFB 3O35A 3V43A 4F52B 5D1KB 2BAYA 1JM7A 4YADA 4IC2A 1BORA 4V3LC 2C2VS 3DQVR 4WZ0A 4WZ2A 4LK9A 5TDRA 4B7YC 3N9PA 4YBSA 3HTKC 2M3HA 2MA5A 2LRIC 2L80A 1RMDA 4PTBA 4A4BA 4TKPB 4Q6FA 4A0CD 2VPEA 5AITA 2G45A 1F62A 4S3OB 4IC3A 2PNXA 1Z60A 4FO9A 3MHSA 2K17A 1WEOA 4GB0A 4WZ3B 2MNYA 5TABA 4ZUXU 5LKTA 5LKZA 1WEUA 4ZDTA 4A49A 1FP0A 3U5OA 4GNEA 2MIQA 5TDWA 3N9NA 3HCSA 2HDPA 4AYCB 2JRJA 2YUCA 4YABA 2VNFA 5J3XA 4A4CA 4AUQB 2KWNA 3M99A 4W4UA 3LRQA 3MHHA 5FB1A 2JMJA 4LLBA 2CSYA 1WIMA 4I7BA 4WA6A 5B75A 2YSMA 4UI9B 5EYAF 5B76A 2VPBA 4R2YA 3FL2A 2XEUA 2JMDA 4GNGA 3EB5A 2H0DB 4ZQLA 5G0FA 2KR4A 3N9LA 4AP4A 3U5NA 5LCWB 4L58A 5LKUA 2JMIA 1WESA 2Y1MA 2MNZA 3ZYQA 2FUUA 1WEWA 4X3GA 5FB0A 5H1TA 4PPEA 3ZPVE 4YC9A 3RPGB 2Y1NA 2RSDA 4AVXA 3EB6A 5C11A 1E4UA 3PHDA 2YHOA 2LGLA 4QF2A 1WEEA 2LGVA 2MA6A 3M62A 2CSZA 4C9ZA 1XWHA 2KU3A 3O33A 2HYED 2G6QA 3O37A 3GV4A 4R8PK 1HYJA 3PUQA 1X4JA 2MD7B 4V3KC 5C13A 5TRBA 4P5OB 5DKAA 2LV9A 3O36A 3M63A 3LQJA 4I7DA 2ECJA 3IHPA 4I7CA 4LADB 2VP7A 2LXPC 2F6NA 2FSAA 1X4UA 4N3WA 1WENA 2MT5A 3C5KA 2YURA 2RI7A 2YQLA 5KH7A 2KIZA 4R7EA 2CKLA 2QICA 3ZVZB 4BBQA 2ECWA 3N9MA 1G25A 2VPGA 4N4FA 3NG2A 4LJNA 5DINA 2ECIA 2G43A 2KGGA 2ECNA 4FK5A 2VJFA 4GNFA 2KGIA 4FIPA 4MSXA 4XI1A 1DVPA 1IYMA 3VK6A 4S3OC 5B77A 2H0DA 2YHNA 3GL6A 4QF3A 5JG6A 2M85A 3O7AA 2Y43A 1WEQA 3KNVA 2L43A 2UZGA 2F42A 2LDRA 1VYXA 4CCGX 5B8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FER A;  2EA6 A;  3SHB A;  3O34 A;  4YBM A;  1WGM A;  2XB1 A;  1FBV A;  3RTR B;  2YU4 A;  1N87 A;  4FJC A;  3U5P A;  3DPL R;  2C2L A;  2IDA A;  3U5M A;  5KH3 A;  2MD8 C;  5H9M A;  2QJ0 A;  2KRE A;  4UP0 A;  1WEM A;  2LGK A;  1MM3 A;  3C6W A;  2MUM A;  1MM2 A;  3ZVY A;  2VJE B;  3SOW A;  3L1X A;  2F6J A;  5AIU A;  3QZV A;  2ZET C;  5D1L B;  2VJE A;  4NN2 A;  2KFT A;  4YAT A;  5D1M B;  2YRE A;  2ECT A;  2M1R A;  2VPD A;  1WEV A;  4MVT A;  1T1H A;  2E6S A;  2YW8 A;  1VD4 A;  3N9Q A;  3RPG C;  2LQ6 A;  1X4I A;  4UP5 A;  2OXQ C;  1JOC A;  4B86 C;  3KV6 A;  1WFK A;  2AN6 A;  3L11 A;  2YT5 A;  5LKX A;  2K16 A;  2EOD A;  2M6M A;  3LQH A;  5H1U A;  2LXH C;  2L0B A;  4BHW A;  1CHC A;  2KWJ A;  2KWK A;  2CKL B;  2L5U A;  4YBT A;  2QIZ A;  4GND A;  2E6R A;  5G04 B;  4YAX A;  2LGG A;  4LKA A;  2NAA A;  1WE9 A;  3ZPV 1;  5H1V A;  1K2F A;  4CA1 A;  4L7X A;  2KYU A;  2KWO A;  3ASL A;  5TBN A;  1WIL A;  2ECV A;  3HCU A;  1WEP A;  3ZTG A;  4O64 A;  2YYR A;  2YQM A;  5FEY A;  2D8S A;  4AYC A;  1Z2Q A;  3T7L A;  3O70 A;  1LDK C;  3HCT A;  2ECG A;  3I2D A;  3PUR A;  1LDJ B;  3N9O A;  3KQI A;  5I3L A;  2FUI A;  5G05 B;  2YSJ A;  3L1Z B;  2L75 A;  2PUY A;  3KV5 A;  5KH9 A;  2DX8 A;  3SOU A;  1ZBD B;  2EGP A;  2LN0 A;  1V87 A;  2CT2 A;  1JM7 B;  1VFY A;  1HYI A;  3LQI A;  2K1J A;  1Z6U A;  1U6G B;  2I50 A;  2K4D A;  2KE1 A;  3SOX A;  3ZNI A;  5B79 A;  3T6R A;  5B78 A;  2VJF B;  3O35 A;  3V43 A;  4F52 B;  5D1K B;  2BAY A;  1JM7 A;  4YAD A;  4IC2 A;  1BOR A;  4V3L C;  2C2V S;  3DQV R;  4WZ0 A;  4WZ2 A;  4LK9 A;  5TDR A;  4B7Y C;  3N9P A;  4YBS A;  3HTK C;  2M3H A;  2MA5 A;  2LRI C;  2L80 A;  1RMD A;  4PTB A;  4A4B A;  4TKP B;  4Q6F A;  4A0C D;  2VPE A;  5AIT A;  2G45 A;  1F62 A;  4S3O B;  4IC3 A;  2PNX A;  1Z60 A;  4FO9 A;  3MHS A;  2K17 A;  1WEO A;  4GB0 A;  4WZ3 B;  2MNY A;  5TAB A;  4ZUX U;  5LKT A;  5LKZ A;  1WEU A;  4ZDT A;  4A49 A;  1FP0 A;  3U5O A;  4GNE A;  2MIQ A;  5TDW A;  3N9N A;  3HCS A;  2HDP A;  4AYC B;  2JRJ A;  2YUC A;  4YAB A;  2VNF A;  5J3X A;  4A4C A;  4AUQ B;  2KWN A;  3M99 A;  4W4U A;  3LRQ A;  3MHH A;  5FB1 A;  2JMJ A;  4LLB A;  2CSY A;  1WIM A;  4I7B A;  4WA6 A;  5B75 A;  2YSM A;  4UI9 B;  5EYA F;  5B76 A;  2VPB A;  4R2Y A;  3FL2 A;  2XEU A;  2JMD A;  4GNG A;  3EB5 A;  2H0D B;  4ZQL A;  5G0F A;  2KR4 A;  3N9L A;  4AP4 A;  3U5N A;  5LCW B;  4L58 A;  5LKU A;  2JMI A;  1WES A;  2Y1M A;  2MNZ A;  3ZYQ A;  2FUU A;  1WEW A;  4X3G A;  5FB0 A;  5H1T A;  4PPE A;  3ZPV E;  4YC9 A;  3RPG B;  2Y1N A;  2RSD A;  4AVX A;  3EB6 A;  5C11 A;  1E4U A;  3PHD A;  2YHO A;  2LGL A;  4QF2 A;  1WEE A;  2LGV A;  2MA6 A;  3M62 A;  2CSZ A;  4C9Z A;  1XWH A;  2KU3 A;  3O33 A;  2HYE D;  2G6Q A;  3O37 A;  3GV4 A;  4R8P K;  1HYJ A;  3PUQ A;  1X4J A;  2MD7 B;  4V3K C;  5C13 A;  5TRB A;  4P5O B;  5DKA A;  2LV9 A;  3O36 A;  3M63 A;  3LQJ A;  4I7D A;  2ECJ A;  3IHP A;  4I7C A;  4LAD B;  2VP7 A;  2LXP C;  2F6N A;  2FSA A;  1X4U A;  4N3W A;  1WEN A;  2MT5 A;  3C5K A;  2YUR A;  2RI7 A;  2YQL A;  5KH7 A;  2KIZ A;  4R7E A;  2CKL A;  2QIC A;  3ZVZ B;  4BBQ A;  2ECW A;  3N9M A;  1G25 A;  2VPG A;  4N4F A;  3NG2 A;  4LJN A;  5DIN A;  2ECI A;  2G43 A;  2KGG A;  2ECN A;  4FK5 A;  2VJF A;  4GNF A;  2KGI A;  4FIP A;  4MSX A;  4XI1 A;  1DVP A;  1IYM A;  3VK6 A;  4S3O C;  5B77 A;  2H0D A;  2YHN A;  3GL6 A;  4QF3 A;  5JG6 A;  2M85 A;  3O7A A;  2Y43 A;  1WEQ A;  3KNV A;  2L43 A;  2UZG A;  2F42 A;  2LDR A;  1VYX A;  4CCG X;  5B8D A; 
#chains in the Genus database with same CATH topology
 5FER A;  2EA6 A;  3SHB A;  3O34 A;  2FFW A;  3LJU X;  4YBM A;  2KKY A;  4Z0O A;  1WGM A;  2XB1 A;  3FEH A;  1FBV A;  2XP0 A;  3RTR B;  2YU4 A;  1N87 A;  4FJC A;  3U5P A;  3DPL R;  2C2L A;  2IDA A;  2JM3 A;  3U5M A;  5KH3 A;  2MD8 C;  5H9M A;  2QJ0 A;  2KRE A;  4UP0 A;  3DDT A;  1WEM A;  2LGK A;  1MM3 A;  3C6W A;  2MUM A;  1MM2 A;  3ZVY A;  2VJE B;  3SOW A;  3T9K A;  3L1X A;  2F6J A;  5AIU A;  5K3Q A;  3QZV A;  2ZET C;  5D1L B;  2VJE A;  2CRW A;  4NN2 A;  2XOY A;  2KFT A;  4YAT A;  5D1M B;  2YRE A;  2ECT A;  2M1R A;  2EGM A;  2VPD A;  1WEV A;  4MVT A;  1T1H A;  4O62 A;  2E6S A;  2YW8 A;  1VD4 A;  3N9Q A;  3RPG C;  2LQ6 A;  1X4I A;  4UP5 A;  2OXQ C;  1JOC A;  2DJA A;  4B86 C;  3KV6 A;  1WFK A;  2AN6 A;  3L11 A;  2YT5 A;  2IQJ A;  5LKX A;  2K16 A;  2EOD A;  2M6M A;  3LQH A;  5H1U A;  2LXH C;  2L0B A;  4BHW A;  1CHC A;  1DCQ A;  2KWJ A;  2KWK A;  2CKL B;  2L5U A;  4YBT A;  2QIZ A;  4GND A;  2E6R A;  5G04 B;  4YAX A;  2LGG A;  4LKA A;  2NAA A;  1WE9 A;  3ZPV 1;  5H1V A;  1K2F A;  3O47 A;  4CA1 A;  4L7X A;  2KYU A;  3E2D A;  2KWO A;  3ASL A;  5TBN A;  1WIL A;  2ECV A;  3HCU A;  1WEP A;  3ZTG A;  4O64 A;  2YYR A;  2DSM A;  2YQM A;  5FEY A;  2D8S A;  4AYC A;  1Z2Q A;  2OWA A;  3T7L A;  3O70 A;  1LDK C;  2XOC A;  3HCT A;  3KDE C;  2ECG A;  5B8D A;  3I2D A;  3PUR A;  1LDJ B;  3N9O A;  3KQI A;  5I3L A;  2FUI A;  2E61 A;  5G05 B;  2YSJ A;  3L1Z B;  2L75 A;  2PUY A;  3KV5 A;  5KH9 A;  2RR4 A;  2DX8 A;  3SOU A;  1ZBD B;  2EGP A;  2LN0 A;  3FM8 C;  1V87 A;  2YVR A;  2CT2 A;  1JM7 B;  1VFY A;  1HYI A;  3LQI A;  2K1J A;  4OGC A;  1Z6U A;  1U6G B;  3FAO A;  2I50 A;  2K4D A;  2KE1 A;  3SOX A;  3ZNI A;  5B79 A;  3T6R A;  5B78 A;  3PLW A;  2VJF B;  3O35 A;  4OGE A;  3V43 A;  4F52 B;  5D1K B;  2BAY A;  1JM7 A;  4YAD A;  4IC2 A;  1BOR A;  4V3L C;  2C2V S;  3DQV R;  4WZ0 A;  4WZ2 A;  4LK9 A;  2CRR A;  5TDR A;  4B7Y C;  2D8U A;  3N9P A;  4YBS A;  3HTK C;  2M3H A;  2MA5 A;  2LRI C;  2L80 A;  1RMD A;  4PTB A;  4A4B A;  4TKP B;  4Q6F A;  4F1P A;  4Z0R A;  4A0C D;  5SVI B;  2VPE A;  3FAN A;  5AIT A;  2G45 A;  1F62 A;  4S3O B;  2M13 A;  4IC3 A;  2PNX A;  1Z60 A;  4FO9 A;  3MHS A;  2K17 A;  1WEO A;  4GB0 A;  4WZ3 B;  2MNY A;  5TAB A;  4ZUX U;  5LKT A;  2KKX A;  5LKZ A;  2L7P A;  1WEU A;  4ZDT A;  4A49 A;  2CSV A;  4H9D A;  1FP0 A;  3U5O A;  4GNE A;  2MIQ A;  5TDW A;  3N9N A;  3HCS A;  2HDP A;  4AYC B;  2JRJ A;  2YUC A;  4YAB A;  3LDY A;  2VNF A;  3FJU B;  4QQ4 A;  5J3X A;  4A4C A;  4AUQ B;  2KWN A;  3M99 A;  3SUB A;  4W4U A;  3LRQ A;  3LVR E;  3MHH A;  5FB1 A;  2JMJ A;  4LLB A;  2CSY A;  1WIM A;  4I7B A;  4WA6 A;  5B75 A;  2YSM A;  4UI9 B;  5EYA F;  5B76 A;  3M7K A;  2VPB A;  4R2Y A;  3FL2 A;  2XEU A;  2JMD A;  4GNG A;  3EB5 A;  2H0D B;  4ZQL A;  5G0F A;  2KR4 A;  3N9L A;  4AP4 A;  3U5N A;  5LCW B;  4L58 A;  3H7H A;  5LKU A;  2JMI A;  1WES A;  2Y1M A;  2MNZ A;  2LAU A;  5SVI A;  3ZYQ A;  2FUU A;  4X3G A;  5FB0 A;  2FD4 A;  5SVY A;  5H1T A;  4PPE A;  2P57 A;  3ZPV E;  4YC9 A;  3RPG B;  2Y1N A;  2RSD A;  4AVX A;  3EB6 A;  5C11 A;  1E4U A;  3PHD A;  2YHO A;  2LGL A;  2XOZ A;  4QF2 A;  1WEE A;  2LGV A;  2MA6 A;  3Q1D A;  3M62 A;  2CSZ A;  4C9Z A;  1XWH A;  2CON A;  2EXU A;  2KU3 A;  3O33 A;  2HYE D;  2G6Q A;  3O37 A;  3GV4 A;  4R8P K;  1HYJ A;  3PUQ A;  1X4J A;  2B0O E;  2MD7 B;  4V3K C;  5C13 A;  5TRB A;  4P5O B;  5DKA A;  2LV9 A;  3O36 A;  3M63 A;  3LQJ A;  4I7D A;  2MKE A;  1MBM A;  2ECJ A;  3IHP A;  4I7C A;  4LAD B;  2VP7 A;  2LXP C;  2F6N A;  2FSA A;  1X4U A;  4N3W A;  3MDB C;  1WEN A;  2MT5 A;  3C5K A;  2YUR A;  3LVQ E;  2RI7 A;  2YQL A;  5KH7 A;  2KIZ A;  4R7E A;  2CKL A;  2QIC A;  3ZVZ B;  4BBQ A;  2ECW A;  3N9M A;  1G25 A;  2VPG A;  4N4F A;  3NG2 A;  4LJN A;  5DIN A;  2ECI A;  2G43 A;  2KGG A;  3JUE A;  2ECN A;  4FK5 A;  2VJF A;  4GNF A;  2KGI A;  4FIP A;  4MSX A;  4XI1 A;  1DVP A;  5SVX A;  1IYM A;  3VK6 A;  4S3O C;  5B77 A;  2H0D A;  2YHN A;  4QF3 A;  3GL6 A;  5JG6 A;  2M85 A;  3O7A A;  2Y43 A;  1WEQ A;  3KNV A;  3DWD A;  2L43 A;  2UZG A;  2JUN A;  2F42 A;  2LDR A;  1VYX A;  4CCG X;  1WEW A; 
#chains in the Genus database with same CATH homology
 5FER A;  2EA6 A;  3SHB A;  3O34 A;  4YBM A;  1WGM A;  2XB1 A;  1FBV A;  3RTR B;  2YU4 A;  1N87 A;  4FJC A;  3U5P A;  3DPL R;  2C2L A;  2IDA A;  3U5M A;  5KH3 A;  2MD8 C;  5H9M A;  2QJ0 A;  2KRE A;  4UP0 A;  1WEM A;  2LGK A;  1MM3 A;  3C6W A;  2MUM A;  1MM2 A;  3ZVY A;  2VJE B;  3SOW A;  3L1X A;  2F6J A;  5AIU A;  3QZV A;  2ZET C;  5D1L B;  2VJE A;  4NN2 A;  2KFT A;  4YAT A;  5D1M B;  2YRE A;  2ECT A;  2M1R A;  2VPD A;  1WEV A;  4MVT A;  1T1H A;  2E6S A;  2YW8 A;  1VD4 A;  3N9Q A;  3RPG C;  2LQ6 A;  1X4I A;  4UP5 A;  2OXQ C;  1JOC A;  4B86 C;  3KV6 A;  1WFK A;  2AN6 A;  3L11 A;  2YT5 A;  5LKX A;  2K16 A;  2EOD A;  2M6M A;  3LQH A;  5H1U A;  2LXH C;  2L0B A;  4BHW A;  1CHC A;  2KWJ A;  2KWK A;  2CKL B;  2L5U A;  4YBT A;  2QIZ A;  4GND A;  2E6R A;  5G04 B;  4YAX A;  2LGG A;  4LKA A;  2NAA A;  1WE9 A;  3ZPV 1;  5H1V A;  1K2F A;  4CA1 A;  4L7X A;  2KYU A;  2KWO A;  3ASL A;  5TBN A;  1WIL A;  2ECV A;  3HCU A;  1WEP A;  3ZTG A;  4O64 A;  2YYR A;  2YQM A;  5FEY A;  2D8S A;  4AYC A;  1Z2Q A;  3T7L A;  3O70 A;  1LDK C;  3HCT A;  2ECG A;  3I2D A;  3PUR A;  1LDJ B;  3N9O A;  3KQI A;  5I3L A;  2FUI A;  5G05 B;  2YSJ A;  3L1Z B;  2L75 A;  2PUY A;  3KV5 A;  5KH9 A;  2DX8 A;  3SOU A;  1ZBD B;  2EGP A;  2LN0 A;  1V87 A;  2CT2 A;  1JM7 B;  1VFY A;  1HYI A;  3LQI A;  2K1J A;  1Z6U A;  1U6G B;  2I50 A;  2K4D A;  2KE1 A;  3SOX A;  3ZNI A;  5B79 A;  3T6R A;  5B78 A;  2VJF B;  3O35 A;  3V43 A;  4F52 B;  5D1K B;  2BAY A;  1JM7 A;  4YAD A;  4IC2 A;  1BOR A;  4V3L C;  2C2V S;  3DQV R;  4WZ0 A;  4WZ2 A;  4LK9 A;  5TDR A;  4B7Y C;  3N9P A;  4YBS A;  3HTK C;  2M3H A;  2MA5 A;  2LRI C;  2L80 A;  1RMD A;  4PTB A;  4A4B A;  4TKP B;  4Q6F A;  4A0C D;  2VPE A;  5AIT A;  2G45 A;  1F62 A;  4S3O B;  4IC3 A;  2PNX A;  1Z60 A;  4FO9 A;  3MHS A;  2K17 A;  1WEO A;  4GB0 A;  4WZ3 B;  2MNY A;  5TAB A;  4ZUX U;  5LKT A;  5LKZ A;  1WEU A;  4ZDT A;  4A49 A;  1FP0 A;  3U5O A;  4GNE A;  2MIQ A;  5TDW A;  3N9N A;  3HCS A;  2HDP A;  4AYC B;  2JRJ A;  2YUC A;  4YAB A;  2VNF A;  5J3X A;  4A4C A;  4AUQ B;  2KWN A;  3M99 A;  4W4U A;  3LRQ A;  3MHH A;  5FB1 A;  2JMJ A;  4LLB A;  2CSY A;  1WIM A;  4I7B A;  4WA6 A;  5B75 A;  2YSM A;  4UI9 B;  5EYA F;  5B76 A;  2VPB A;  4R2Y A;  3FL2 A;  2XEU A;  2JMD A;  4GNG A;  3EB5 A;  2H0D B;  4ZQL A;  5G0F A;  2KR4 A;  3N9L A;  4AP4 A;  3U5N A;  5LCW B;  4L58 A;  5LKU A;  2JMI A;  1WES A;  2Y1M A;  2MNZ A;  3ZYQ A;  2FUU A;  1WEW A;  4X3G A;  5FB0 A;  5H1T A;  4PPE A;  3ZPV E;  4YC9 A;  3RPG B;  2Y1N A;  2RSD A;  4AVX A;  3EB6 A;  5C11 A;  1E4U A;  3PHD A;  2YHO A;  2LGL A;  4QF2 A;  1WEE A;  2LGV A;  2MA6 A;  3M62 A;  2CSZ A;  4C9Z A;  1XWH A;  2KU3 A;  3O33 A;  2HYE D;  2G6Q A;  3O37 A;  3GV4 A;  4R8P K;  1HYJ A;  3PUQ A;  1X4J A;  2MD7 B;  4V3K C;  5C13 A;  5TRB A;  4P5O B;  5DKA A;  2LV9 A;  3O36 A;  3M63 A;  3LQJ A;  4I7D A;  2ECJ A;  3IHP A;  4I7C A;  4LAD B;  2VP7 A;  2LXP C;  2F6N A;  2FSA A;  1X4U A;  4N3W A;  1WEN A;  2MT5 A;  3C5K A;  2YUR A;  2RI7 A;  2YQL A;  5KH7 A;  2KIZ A;  4R7E A;  2CKL A;  2QIC A;  3ZVZ B;  4BBQ A;  2ECW A;  3N9M A;  1G25 A;  2VPG A;  4N4F A;  3NG2 A;  4LJN A;  5DIN A;  2ECI A;  2G43 A;  2KGG A;  2ECN A;  4FK5 A;  2VJF A;  4GNF A;  2KGI A;  4FIP A;  4MSX A;  4XI1 A;  1DVP A;  1IYM A;  3VK6 A;  4S3O C;  5B77 A;  2H0D A;  2YHN A;  3GL6 A;  4QF3 A;  5JG6 A;  2M85 A;  3O7A A;  2Y43 A;  1WEQ A;  3KNV A;  2L43 A;  2UZG A;  2F42 A;  2LDR A;  1VYX A;  4CCG X;  5B8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...