2YHOA

The idol-ube2d complex mediates sterol-dependent degradation of the ldl receptor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
RVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYLPTHTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MYLIP
publication title The Idol-Ube2D Complex Mediates Sterol-Dependent Degradation of the Ldl Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 16
structure length 67
sequence length 67
chains with identical sequence C, E, G
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yhoA00
2KGIA 2MA5A 4R7EA 3MHSA 2CSZA 2LV9A 3PURA 4BBQA 5LKTA 1F62A 5B78A 1U6GB 2PNXA 1FP0A 4LLBA 2YW8A 1WEVA 5H1TA 2F42A 2JRJA 4I7BA 2YYRA 5DKAA 2EA6A 4QF3A 3U5MA 4L58A 3DPLR 1BORA 2KGGA 3V43A 4I7CA 3ZVZB 4I7DA 4S3OB 5D1LB 2L80A 3MHHA 1ZBDB 1VYXA 4V3KC 4GNEA 4N4FA 2LXHC 4FK5A 5AIUA 3DQVR 4PTBA 4NN2A 2OXQC 4N3WA 3ZTGA 3IHPA 1N87A 5TABA 4CCGX 2LN0A 5C11A 5FERA 3GV4A 5B8DA 1LDJB 2LRIC 3L1ZB 3ZNIA 2ECGA 3SOXA 2UZGA 5B77A 4FIPA 3U5PA 3O33A 2C2VS 2KR4A 2FSAA 1WEOA 4S3OC 2FUIA 2VJEB 4B7YC 2XB1A 4AVXA 4YABA 2YUCA 5FEYA 2VJEA 4IC2A 2MNYA 3L11A 2M1RA 5H9MA 5D1MB 2FUUA 2G6QA 3LQJA 4A0CD 4GNDA 2G45A 3N9QA 3U5NA 2F6JA 4GB0A 3N9MA 1X4IA 2MD7B 2ECNA 5G0FA 2KIZA 1G25A 5KH7A 3RPGB 4WA6A 2E6SA 4GNFA 4X3GA 2H0DB 5FB0A 5AITA 2ECJA 4YBSA 5B75A 2YQLA 1Z60A 3O7AA 2CKLB 2YU4A 1DVPA 2EODA 2RSDA 2DX8A 2H0DA 1WILA 4YATA 1K2FA 5FB1A 3M63A 1WFKA 5KH9A 2KWKA 2LGKA 4AUQB 2CKLA 4LADB 2EGPA 3T6RA 3M99A 4B86C 4YBMA 2LGGA 2VPGA 1HYJA 3RPGC 4TKPB 5TBNA 4PPEA 2L75A 1MM3A 4LJNA 4IC3A 5LKUA 3ASLA 4MVTA 1WEMA 2K17A 2L0BA 2QICA 3LRQA 1RMDA 3ZVYA 4R8PK 3ZYQA 3N9NA 2Y43A 1IYMA 2VNFA 5JG6A 3N9LA 2ECVA 1WE9A 3O36A 2ECIA 2YURA 2L43A 4A4CA 2CSYA 1T1HA 4L7XA 2K16A 3PUQA 4CA1A 3SHBA 2QIZA 5C13A 2YHOA 2BAYA 3QZVA 1WEEA 5TRBA 4UP0A 2G43A 4GNGA 2KWOA 2C2LA 4WZ3B 4FO9A 4C9ZA 2Y1MA 1WEUA 5DINA 3O37A 3KQIA 2YSJA 2E6RA 2KWNA 3RTRB 1HYIA 2IDAA 3KV6A 5H1UA 2F6NA 4YAXA 3O34A 3LQIA 3N9PA 5KH3A 1CHCA 3O70A 2HYED 3HCTA 3KNVA 2MA6A 4BHWA 4ZDTA 5B76A 2KE1A 1VFYA 1WIMA 1V87A 3C6WA 4A4BA 2VPDA 2VJFB 3GL6A 2I50A 5TDWA 3VK6A 4F52B 2QJ0A 3ZPV1 3KV5A 2JMJA 2XEUA 2KWJA 2M6MA 1VD4A 3I2DA 3O35A 4LK9A 2VJFA 4P5OB 2MT5A 5LKZA 4ZQLA 2CT2A 3C5KA 1JOCA 4O64A 2LGVA 2LGLA 2LDRA 3SOUA 1WENA 3U5OA 4AYCB 4V3LC 4LKAA 1Z2QA 2LQ6A 2NAAA 2ZETC 2KYUA 2MNZA 4AP4A 2YREA 3M62A 1WEQA 3LQHA 4R2YA 5J3XA 4AYCA 4WZ0A 2M3HA 2YT5A 5LKXA 2KU3A 2VPBA 4W4UA 2K1JA 1XWHA 3EB5A 3ZPVE 5H1VA 5G05B 2ECTA 5G04B 1MM2A 1X4UA 1X4JA 3SOWA 2JMIA 4YADA 2YSMA 1JM7B 2VP7A 2RI7A 4UP5A 3T7LA 2M85A 2Y1NA 1LDKC 5LCWB 3EB6A 3HCSA 2YQMA 4UI9B 4Q6FA 1JM7A 2JMDA 4YC9A 5B79A 3PHDA 2ECWA 4WZ2A 2KREA 2LXPC 4ZUXU 5EYAF 4A49A 1Z6UA 2K4DA 2MD8C 4QF2A 5D1KB 2VPEA 3HCUA 2PUYA 1E4UA 1WEPA 5TDRA 3L1XA 3FL2A 4YBTA 2AN6A 2MUMA 1WEWA 2YHNA 3NG2A 3N9OA 1WESA 4FJCA 2L5UA 4MSXA 2MIQA 2HDPA 3HTKC 5I3LA 2KFTA 1FBVA 2D8SA 4XI1A 1WGMA
chains in the Genus database with same CATH superfamily
2KGIA 2MA5A 4R7EA 3MHSA 2CSZA 2LV9A 3PURA 2CONA 4BBQA 5LKTA 1F62A 5B78A 1U6GB 2PNXA 1FP0A 4LLBA 2YW8A 3T9KA 3JUEA 1WEVA 5H1TA 2F42A 2JRJA 4I7BA 2YYRA 5DKAA 2EA6A 4QF3A 3U5MA 4L58A 3DPLR 1BORA 2KGGA 3V43A 4I7CA 3ZVZB 4I7DA 4S3OB 5D1LB 2L80A 3MHHA 1ZBDB 1VYXA 4V3KC 4GNEA 4H9DA 2LXHC 4N4FA 4FK5A 5AIUA 3DQVR 4PTBA 4NN2A 2OXQC 4N3WA 3ZTGA 4OGCA 3IHPA 1N87A 3LVQE 5TABA 4CCGX 2LN0A 5C11A 2KKYA 5FERA 3GV4A 5B8DA 1LDJB 2LRIC 3L1ZB 3KDEC 3ZNIA 2ECGA 3SOXA 2UZGA 5B77A 3MDBC 4FIPA 3U5PA 3O33A 2C2VS 2KR4A 2FSAA 1WEOA 4S3OC 2FUIA 2VJEB 4Z0RA 4B7YC 2XB1A 2DJAA 2M13A 4AVXA 4YABA 2YUCA 5FEYA 2VJEA 2CSVA 4IC2A 2MNYA 3L11A 2M1RA 5H9MA 5D1MB 2FUUA 2G6QA 3LQJA 4A0CD 4GNDA 2G45A 3N9QA 3U5NA 2F6JA 4GB0A 3N9MA 1X4IA 2MD7B 2ECNA 5G0FA 2KIZA 3E2DA 1G25A 4QQ4A 5KH7A 5K3QA 3RPGB 5SVYA 4WA6A 2E6SA 4GNFA 4X3GA 2H0DB 5FB0A 5AITA 2ECJA 4YBSA 5B75A 2YQLA 1Z60A 3O7AA 2CKLB 2YU4A 1DVPA 2EODA 2RSDA 2DX8A 2H0DA 1WILA 4YATA 2YVRA 1K2FA 5FB1A 3M63A 1WFKA 5KH9A 2KWKA 2LGKA 4AUQB 2JUNA 2CKLA 3FM8C 4LADB 2EGPA 3T6RA 3M99A 4B86C 4YBMA 2LGGA 2VPGA 3O47A 1HYJA 3RPGC 3PLWA 4TKPB 5TBNA 4PPEA 5SVIB 2L75A 1MM3A 4LJNA 4IC3A 5LKUA 3ASLA 2XOCA 4MVTA 1WEMA 2K17A 5SVIA 2L0BA 2QICA 3LRQA 1RMDA 3ZVYA 4R8PK 3ZYQA 3N9NA 2Y43A 1IYMA 2VNFA 5JG6A 3N9LA 2ECVA 1WE9A 3O36A 2ECIA 2YURA 2L43A 4A4CA 2CSYA 1T1HA 4L7XA 2K16A 3PUQA 4CA1A 3SHBA 2QIZA 5C13A 2MKEA 2YHOA 1DCQA 2BAYA 3QZVA 1WEEA 2FD4A 2OWAA 5TRBA 4UP0A 2G43A 4GNGA 2KWOA 2C2LA 4WZ3B 4FO9A 3FEHA 4C9ZA 2L7PA 2Y1MA 1WEUA 5DINA 2D8UA 3O37A 3KQIA 3DWDA 2YSJA 2E6RA 2KWNA 3RTRB 1HYIA 2IDAA 3KV6A 5H1UA 3DDTA 2F6NA 4YAXA 3O34A 2B0OE 3LQIA 3N9PA 5KH3A 3M7KA 1CHCA 3FAOA 3O70A 2HYED 3HCTA 4OGEA 3KNVA 2MA6A 4BHWA 4ZDTA 5B76A 2KE1A 1VFYA 1WIMA 1V87A 3C6WA 4A4BA 2VPDA 3LVRE 2VJFB 3GL6A 2I50A 5TDWA 3VK6A 4F52B 2QJ0A 3ZPV1 3KV5A 2IQJA 2JMJA 2XEUA 2KWJA 2M6MA 1VD4A 3I2DA 3O35A 4LK9A 2VJFA 4P5OB 2MT5A 5LKZA 4ZQLA 2E61A 2CT2A 3C5KA 1JOCA 3Q1DA 4O64A 2LGVA 2LGLA 2LDRA 3SOUA 1WENA 3U5OA 4AYCB 4V3LC 4LKAA 1Z2QA 2LQ6A 2NAAA 3SUBA 2ZETC 3FJUB 2KYUA 2MNZA 4AP4A 2YREA 3M62A 1WEQA 3LQHA 2LAUA 4R2YA 5J3XA 4AYCA 4WZ0A 2M3HA 2EXUA 2YT5A 5LKXA 2KU3A 2VPBA 4W4UA 2RR4A 2K1JA 1XWHA 3EB5A 3FANA 3ZPVE 5H1VA 5G05B 2ECTA 5G04B 1MM2A 1X4UA 1X4JA 3LDYA 2XOZA 3SOWA 2JMIA 2XP0A 4YADA 2YSMA 1JM7B 2VP7A 2RI7A 1MBMA 3T7LA 4UP5A 2M85A 4O62A 2Y1NA 2JM3A 1LDKC 5LCWB 3EB6A 3HCSA 2YQMA 4UI9B 2KKXA 4Q6FA 2DSMA 2XOYA 1JM7A 2JMDA 4YC9A 2P57A 5B79A 3PHDA 2ECWA 4WZ2A 2KREA 2LXPC 4ZUXU 5EYAF 4A49A 1Z6UA 2K4DA 2MD8C 4QF2A 5D1KB 4Z0OA 2EGMA 2VPEA 3HCUA 2PUYA 1E4UA 1WEPA 2FFWA 5TDRA 3L1XA 3FL2A 2CRWA 4YBTA 2AN6A 2MUMA 4F1PA 1WEWA 2YHNA 3NG2A 3N9OA 1WESA 4FJCA 2L5UA 4MSXA 5SVXA 2MIQA 2HDPA 3HTKC 5I3LA 2KFTA 1FBVA 2D8SA 3LJUX 4XI1A 3H7HA 1WGMA 2CRRA
chains in the Genus database with same CATH topology
2KGIA 2MA5A 4R7EA 3MHSA 2CSZA 2LV9A 3PURA 4BBQA 5LKTA 1F62A 5B78A 1U6GB 2PNXA 1FP0A 4LLBA 2YW8A 1WEVA 5H1TA 2F42A 2JRJA 4I7BA 2YYRA 5DKAA 2EA6A 4QF3A 3U5MA 4L58A 3DPLR 1BORA 2KGGA 3V43A 4I7CA 3ZVZB 4I7DA 4S3OB 5D1LB 2L80A 3MHHA 1ZBDB 1VYXA 4V3KC 4GNEA 4N4FA 2LXHC 4FK5A 5AIUA 3DQVR 4PTBA 4NN2A 2OXQC 4N3WA 3ZTGA 3IHPA 1N87A 5TABA 4CCGX 2LN0A 5C11A 5FERA 3GV4A 5B8DA 1LDJB 2LRIC 3L1ZB 3ZNIA 2ECGA 3SOXA 2UZGA 5B77A 4FIPA 3U5PA 3O33A 2C2VS 2KR4A 2FSAA 1WEOA 4S3OC 2FUIA 2VJEB 4B7YC 2XB1A 4AVXA 4YABA 2YUCA 5FEYA 2VJEA 4IC2A 2MNYA 3L11A 2M1RA 5H9MA 5D1MB 2FUUA 2G6QA 3LQJA 4A0CD 4GNDA 2G45A 3N9QA 3U5NA 2F6JA 4GB0A 3N9MA 1X4IA 2MD7B 2ECNA 5G0FA 2KIZA 1G25A 5KH7A 3RPGB 4WA6A 2E6SA 4GNFA 4X3GA 2H0DB 5FB0A 5AITA 2ECJA 4YBSA 5B75A 2YQLA 1Z60A 3O7AA 2CKLB 2YU4A 1DVPA 2EODA 2RSDA 2DX8A 2H0DA 1WILA 4YATA 1K2FA 5FB1A 3M63A 1WFKA 5KH9A 2KWKA 2LGKA 4AUQB 2CKLA 4LADB 2EGPA 3T6RA 3M99A 4B86C 4YBMA 2LGGA 2VPGA 1HYJA 3RPGC 4TKPB 5TBNA 4PPEA 2L75A 1MM3A 4LJNA 4IC3A 5LKUA 3ASLA 4MVTA 1WEMA 2K17A 2L0BA 2QICA 3LRQA 1RMDA 3ZVYA 4R8PK 3ZYQA 3N9NA 2Y43A 1IYMA 2VNFA 5JG6A 3N9LA 2ECVA 1WE9A 3O36A 2ECIA 2YURA 2L43A 4A4CA 2CSYA 1T1HA 4L7XA 2K16A 3PUQA 4CA1A 3SHBA 2QIZA 5C13A 2YHOA 2BAYA 3QZVA 1WEEA 5TRBA 4UP0A 2G43A 4GNGA 2KWOA 2C2LA 4WZ3B 4FO9A 4C9ZA 2Y1MA 1WEUA 5DINA 3O37A 3KQIA 2YSJA 2E6RA 2KWNA 3RTRB 1HYIA 2IDAA 3KV6A 5H1UA 2F6NA 4YAXA 3O34A 3LQIA 3N9PA 5KH3A 1CHCA 3O70A 2HYED 3HCTA 3KNVA 2MA6A 4BHWA 4ZDTA 5B76A 2KE1A 1VFYA 1WIMA 1V87A 3C6WA 4A4BA 2VPDA 2VJFB 3GL6A 2I50A 5TDWA 3VK6A 4F52B 2QJ0A 3ZPV1 3KV5A 2JMJA 2XEUA 2KWJA 2M6MA 1VD4A 3I2DA 3O35A 4LK9A 2VJFA 4P5OB 2MT5A 5LKZA 4ZQLA 2CT2A 3C5KA 1JOCA 4O64A 2LGVA 2LGLA 2LDRA 3SOUA 1WENA 3U5OA 4AYCB 4V3LC 4LKAA 1Z2QA 2LQ6A 2NAAA 2ZETC 2KYUA 2MNZA 4AP4A 2YREA 3M62A 1WEQA 3LQHA 4R2YA 5J3XA 4AYCA 4WZ0A 2M3HA 2YT5A 5LKXA 2KU3A 2VPBA 4W4UA 2K1JA 1XWHA 3EB5A 3ZPVE 5H1VA 5G05B 2ECTA 5G04B 1MM2A 1X4UA 1X4JA 3SOWA 2JMIA 4YADA 2YSMA 1JM7B 2VP7A 2RI7A 4UP5A 3T7LA 2M85A 2Y1NA 1LDKC 5LCWB 3EB6A 3HCSA 2YQMA 4UI9B 4Q6FA 1JM7A 2JMDA 4YC9A 5B79A 3PHDA 2ECWA 4WZ2A 2KREA 2LXPC 4ZUXU 5EYAF 4A49A 1Z6UA 2K4DA 2MD8C 4QF2A 5D1KB 2VPEA 3HCUA 2PUYA 1E4UA 1WEPA 5TDRA 3L1XA 3FL2A 4YBTA 2AN6A 2MUMA 1WEWA 2YHNA 3NG2A 3N9OA 1WESA 4FJCA 2L5UA 4MSXA 2MIQA 2HDPA 3HTKC 5I3LA 2KFTA 1FBVA 2D8SA 4XI1A 1WGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGI A;  2MA5 A;  4R7E A;  3MHS A;  2CSZ A;  2LV9 A;  3PUR A;  4BBQ A;  5LKT A;  1F62 A;  5B78 A;  1U6G B;  2PNX A;  1FP0 A;  4LLB A;  2YW8 A;  1WEV A;  5H1T A;  2F42 A;  2JRJ A;  4I7B A;  2YYR A;  5DKA A;  2EA6 A;  4QF3 A;  3U5M A;  4L58 A;  3DPL R;  1BOR A;  2KGG A;  3V43 A;  4I7C A;  3ZVZ B;  4I7D A;  4S3O B;  5D1L B;  2L80 A;  3MHH A;  1ZBD B;  1VYX A;  4V3K C;  4GNE A;  4N4F A;  2LXH C;  4FK5 A;  5AIU A;  3DQV R;  4PTB A;  4NN2 A;  2OXQ C;  4N3W A;  3ZTG A;  3IHP A;  1N87 A;  5TAB A;  4CCG X;  2LN0 A;  5C11 A;  5FER A;  3GV4 A;  5B8D A;  1LDJ B;  2LRI C;  3L1Z B;  3ZNI A;  2ECG A;  3SOX A;  2UZG A;  5B77 A;  4FIP A;  3U5P A;  3O33 A;  2C2V S;  2KR4 A;  2FSA A;  1WEO A;  4S3O C;  2FUI A;  2VJE B;  4B7Y C;  2XB1 A;  4AVX A;  4YAB A;  2YUC A;  5FEY A;  2VJE A;  4IC2 A;  2MNY A;  3L11 A;  2M1R A;  5H9M A;  5D1M B;  2FUU A;  2G6Q A;  3LQJ A;  4A0C D;  4GND A;  2G45 A;  3N9Q A;  3U5N A;  2F6J A;  4GB0 A;  3N9M A;  1X4I A;  2MD7 B;  2ECN A;  5G0F A;  2KIZ A;  1G25 A;  5KH7 A;  3RPG B;  4WA6 A;  2E6S A;  4GNF A;  4X3G A;  2H0D B;  5FB0 A;  5AIT A;  2ECJ A;  4YBS A;  5B75 A;  2YQL A;  1Z60 A;  3O7A A;  2CKL B;  2YU4 A;  1DVP A;  2EOD A;  2RSD A;  2DX8 A;  2H0D A;  1WIL A;  4YAT A;  1K2F A;  5FB1 A;  3M63 A;  1WFK A;  5KH9 A;  2KWK A;  2LGK A;  4AUQ B;  2CKL A;  4LAD B;  2EGP A;  3T6R A;  3M99 A;  4B86 C;  4YBM A;  2LGG A;  2VPG A;  1HYJ A;  3RPG C;  4TKP B;  5TBN A;  4PPE A;  2L75 A;  1MM3 A;  4LJN A;  4IC3 A;  5LKU A;  3ASL A;  4MVT A;  1WEM A;  2K17 A;  2L0B A;  2QIC A;  3LRQ A;  1RMD A;  3ZVY A;  4R8P K;  3ZYQ A;  3N9N A;  2Y43 A;  1IYM A;  2VNF A;  5JG6 A;  3N9L A;  2ECV A;  1WE9 A;  3O36 A;  2ECI A;  2YUR A;  2L43 A;  4A4C A;  2CSY A;  1T1H A;  4L7X A;  2K16 A;  3PUQ A;  4CA1 A;  3SHB A;  2QIZ A;  5C13 A;  2YHO A;  2BAY A;  3QZV A;  1WEE A;  5TRB A;  4UP0 A;  2G43 A;  4GNG A;  2KWO A;  2C2L A;  4WZ3 B;  4FO9 A;  4C9Z A;  2Y1M A;  1WEU A;  5DIN A;  3O37 A;  3KQI A;  2YSJ A;  2E6R A;  2KWN A;  3RTR B;  1HYI A;  2IDA A;  3KV6 A;  5H1U A;  2F6N A;  4YAX A;  3O34 A;  3LQI A;  3N9P A;  5KH3 A;  1CHC A;  3O70 A;  2HYE D;  3HCT A;  3KNV A;  2MA6 A;  4BHW A;  4ZDT A;  5B76 A;  2KE1 A;  1VFY A;  1WIM A;  1V87 A;  3C6W A;  4A4B A;  2VPD A;  2VJF B;  3GL6 A;  2I50 A;  5TDW A;  3VK6 A;  4F52 B;  2QJ0 A;  3ZPV 1;  3KV5 A;  2JMJ A;  2XEU A;  2KWJ A;  2M6M A;  1VD4 A;  3I2D A;  3O35 A;  4LK9 A;  2VJF A;  4P5O B;  2MT5 A;  5LKZ A;  4ZQL A;  2CT2 A;  3C5K A;  1JOC A;  4O64 A;  2LGV A;  2LGL A;  2LDR A;  3SOU A;  1WEN A;  3U5O A;  4AYC B;  4V3L C;  4LKA A;  1Z2Q A;  2LQ6 A;  2NAA A;  2ZET C;  2KYU A;  2MNZ A;  4AP4 A;  2YRE A;  3M62 A;  1WEQ A;  3LQH A;  4R2Y A;  5J3X A;  4AYC A;  4WZ0 A;  2M3H A;  2YT5 A;  5LKX A;  2KU3 A;  2VPB A;  4W4U A;  2K1J A;  1XWH A;  3EB5 A;  3ZPV E;  5H1V A;  5G05 B;  2ECT A;  5G04 B;  1MM2 A;  1X4U A;  1X4J A;  3SOW A;  2JMI A;  4YAD A;  2YSM A;  1JM7 B;  2VP7 A;  2RI7 A;  4UP5 A;  3T7L A;  2M85 A;  2Y1N A;  1LDK C;  5LCW B;  3EB6 A;  3HCS A;  2YQM A;  4UI9 B;  4Q6F A;  1JM7 A;  2JMD A;  4YC9 A;  5B79 A;  3PHD A;  2ECW A;  4WZ2 A;  2KRE A;  2LXP C;  4ZUX U;  5EYA F;  4A49 A;  1Z6U A;  2K4D A;  2MD8 C;  4QF2 A;  5D1K B;  2VPE A;  3HCU A;  2PUY A;  1E4U A;  1WEP A;  5TDR A;  3L1X A;  3FL2 A;  4YBT A;  2AN6 A;  2MUM A;  1WEW A;  2YHN A;  3NG2 A;  3N9O A;  1WES A;  4FJC A;  2L5U A;  4MSX A;  2MIQ A;  2HDP A;  3HTK C;  5I3L A;  2KFT A;  1FBV A;  2D8S A;  4XI1 A;  1WGM A; 
#chains in the Genus database with same CATH topology
 2KGI A;  2MA5 A;  4R7E A;  3MHS A;  2CSZ A;  2LV9 A;  3PUR A;  2CON A;  4BBQ A;  5LKT A;  1F62 A;  5B78 A;  1U6G B;  2PNX A;  1FP0 A;  4LLB A;  2YW8 A;  3T9K A;  3JUE A;  1WEV A;  5H1T A;  2F42 A;  2JRJ A;  4I7B A;  2YYR A;  5DKA A;  2EA6 A;  4QF3 A;  3U5M A;  4L58 A;  3DPL R;  1BOR A;  2KGG A;  3V43 A;  4I7C A;  3ZVZ B;  4I7D A;  4S3O B;  5D1L B;  2L80 A;  3MHH A;  1ZBD B;  1VYX A;  4V3K C;  4GNE A;  4H9D A;  2LXH C;  4N4F A;  4FK5 A;  5AIU A;  3DQV R;  4PTB A;  4NN2 A;  2OXQ C;  4N3W A;  3ZTG A;  4OGC A;  3IHP A;  1N87 A;  3LVQ E;  5TAB A;  4CCG X;  2LN0 A;  5C11 A;  2KKY A;  5FER A;  3GV4 A;  5B8D A;  1LDJ B;  2LRI C;  3L1Z B;  3KDE C;  3ZNI A;  2ECG A;  3SOX A;  2UZG A;  5B77 A;  3MDB C;  4FIP A;  3U5P A;  3O33 A;  2C2V S;  2KR4 A;  2FSA A;  1WEO A;  4S3O C;  2FUI A;  2VJE B;  4Z0R A;  4B7Y C;  2XB1 A;  2DJA A;  2M13 A;  4AVX A;  4YAB A;  2YUC A;  5FEY A;  2VJE A;  2CSV A;  4IC2 A;  2MNY A;  3L11 A;  2M1R A;  5H9M A;  5D1M B;  2FUU A;  2G6Q A;  3LQJ A;  4A0C D;  4GND A;  2G45 A;  3N9Q A;  3U5N A;  2F6J A;  4GB0 A;  3N9M A;  1X4I A;  2MD7 B;  2ECN A;  5G0F A;  2KIZ A;  3E2D A;  1G25 A;  4QQ4 A;  5KH7 A;  5K3Q A;  3RPG B;  5SVY A;  4WA6 A;  2E6S A;  4GNF A;  4X3G A;  2H0D B;  5FB0 A;  5AIT A;  2ECJ A;  4YBS A;  5B75 A;  2YQL A;  1Z60 A;  3O7A A;  2CKL B;  2YU4 A;  1DVP A;  2EOD A;  2RSD A;  2DX8 A;  2H0D A;  1WIL A;  4YAT A;  2YVR A;  1K2F A;  5FB1 A;  3M63 A;  1WFK A;  5KH9 A;  2KWK A;  2LGK A;  4AUQ B;  2JUN A;  2CKL A;  3FM8 C;  4LAD B;  2EGP A;  3T6R A;  3M99 A;  4B86 C;  4YBM A;  2LGG A;  2VPG A;  3O47 A;  1HYJ A;  3RPG C;  3PLW A;  4TKP B;  5TBN A;  4PPE A;  5SVI B;  2L75 A;  1MM3 A;  4LJN A;  4IC3 A;  5LKU A;  3ASL A;  2XOC A;  4MVT A;  1WEM A;  2K17 A;  5SVI A;  2L0B A;  2QIC A;  3LRQ A;  1RMD A;  3ZVY A;  4R8P K;  3ZYQ A;  3N9N A;  2Y43 A;  1IYM A;  2VNF A;  5JG6 A;  3N9L A;  2ECV A;  1WE9 A;  3O36 A;  2ECI A;  2YUR A;  2L43 A;  4A4C A;  2CSY A;  1T1H A;  4L7X A;  2K16 A;  3PUQ A;  4CA1 A;  3SHB A;  2QIZ A;  5C13 A;  2MKE A;  2YHO A;  1DCQ A;  2BAY A;  3QZV A;  1WEE A;  2FD4 A;  2OWA A;  5TRB A;  4UP0 A;  2G43 A;  4GNG A;  2KWO A;  2C2L A;  4WZ3 B;  4FO9 A;  3FEH A;  4C9Z A;  2L7P A;  2Y1M A;  1WEU A;  5DIN A;  2D8U A;  3O37 A;  3KQI A;  3DWD A;  2YSJ A;  2E6R A;  2KWN A;  3RTR B;  1HYI A;  2IDA A;  3KV6 A;  5H1U A;  3DDT A;  2F6N A;  4YAX A;  3O34 A;  2B0O E;  3LQI A;  3N9P A;  5KH3 A;  3M7K A;  1CHC A;  3FAO A;  3O70 A;  2HYE D;  3HCT A;  4OGE A;  3KNV A;  2MA6 A;  4BHW A;  4ZDT A;  5B76 A;  2KE1 A;  1VFY A;  1WIM A;  1V87 A;  3C6W A;  4A4B A;  2VPD A;  3LVR E;  2VJF B;  3GL6 A;  2I50 A;  5TDW A;  3VK6 A;  4F52 B;  2QJ0 A;  3ZPV 1;  3KV5 A;  2IQJ A;  2JMJ A;  2XEU A;  2KWJ A;  2M6M A;  1VD4 A;  3I2D A;  3O35 A;  4LK9 A;  2VJF A;  4P5O B;  2MT5 A;  5LKZ A;  4ZQL A;  2E61 A;  2CT2 A;  3C5K A;  1JOC A;  3Q1D A;  4O64 A;  2LGV A;  2LGL A;  2LDR A;  3SOU A;  1WEN A;  3U5O A;  4AYC B;  4V3L C;  4LKA A;  1Z2Q A;  2LQ6 A;  2NAA A;  3SUB A;  2ZET C;  3FJU B;  2KYU A;  2MNZ A;  4AP4 A;  2YRE A;  3M62 A;  1WEQ A;  3LQH A;  2LAU A;  4R2Y A;  5J3X A;  4AYC A;  4WZ0 A;  2M3H A;  2EXU A;  2YT5 A;  5LKX A;  2KU3 A;  2VPB A;  4W4U A;  2RR4 A;  2K1J A;  1XWH A;  3EB5 A;  3FAN A;  3ZPV E;  5H1V A;  5G05 B;  2ECT A;  5G04 B;  1MM2 A;  1X4U A;  1X4J A;  3LDY A;  2XOZ A;  3SOW A;  2JMI A;  2XP0 A;  4YAD A;  2YSM A;  1JM7 B;  2VP7 A;  2RI7 A;  1MBM A;  3T7L A;  4UP5 A;  2M85 A;  4O62 A;  2Y1N A;  2JM3 A;  1LDK C;  5LCW B;  3EB6 A;  3HCS A;  2YQM A;  4UI9 B;  2KKX A;  4Q6F A;  2DSM A;  2XOY A;  1JM7 A;  2JMD A;  4YC9 A;  2P57 A;  5B79 A;  3PHD A;  2ECW A;  4WZ2 A;  2KRE A;  2LXP C;  4ZUX U;  5EYA F;  4A49 A;  1Z6U A;  2K4D A;  2MD8 C;  4QF2 A;  5D1K B;  4Z0O A;  2EGM A;  2VPE A;  3HCU A;  2PUY A;  1E4U A;  1WEP A;  2FFW A;  5TDR A;  3L1X A;  3FL2 A;  2CRW A;  4YBT A;  2AN6 A;  2MUM A;  4F1P A;  1WEW A;  2YHN A;  3NG2 A;  3N9O A;  1WES A;  4FJC A;  2L5U A;  4MSX A;  5SVX A;  2MIQ A;  2HDP A;  3HTK C;  5I3L A;  2KFT A;  1FBV A;  2D8S A;  3LJU X;  4XI1 A;  3H7H A;  1WGM A;  2CRR A; 
#chains in the Genus database with same CATH homology
 2KGI A;  2MA5 A;  4R7E A;  3MHS A;  2CSZ A;  2LV9 A;  3PUR A;  4BBQ A;  5LKT A;  1F62 A;  5B78 A;  1U6G B;  2PNX A;  1FP0 A;  4LLB A;  2YW8 A;  1WEV A;  5H1T A;  2F42 A;  2JRJ A;  4I7B A;  2YYR A;  5DKA A;  2EA6 A;  4QF3 A;  3U5M A;  4L58 A;  3DPL R;  1BOR A;  2KGG A;  3V43 A;  4I7C A;  3ZVZ B;  4I7D A;  4S3O B;  5D1L B;  2L80 A;  3MHH A;  1ZBD B;  1VYX A;  4V3K C;  4GNE A;  4N4F A;  2LXH C;  4FK5 A;  5AIU A;  3DQV R;  4PTB A;  4NN2 A;  2OXQ C;  4N3W A;  3ZTG A;  3IHP A;  1N87 A;  5TAB A;  4CCG X;  2LN0 A;  5C11 A;  5FER A;  3GV4 A;  5B8D A;  1LDJ B;  2LRI C;  3L1Z B;  3ZNI A;  2ECG A;  3SOX A;  2UZG A;  5B77 A;  4FIP A;  3U5P A;  3O33 A;  2C2V S;  2KR4 A;  2FSA A;  1WEO A;  4S3O C;  2FUI A;  2VJE B;  4B7Y C;  2XB1 A;  4AVX A;  4YAB A;  2YUC A;  5FEY A;  2VJE A;  4IC2 A;  2MNY A;  3L11 A;  2M1R A;  5H9M A;  5D1M B;  2FUU A;  2G6Q A;  3LQJ A;  4A0C D;  4GND A;  2G45 A;  3N9Q A;  3U5N A;  2F6J A;  4GB0 A;  3N9M A;  1X4I A;  2MD7 B;  2ECN A;  5G0F A;  2KIZ A;  1G25 A;  5KH7 A;  3RPG B;  4WA6 A;  2E6S A;  4GNF A;  4X3G A;  2H0D B;  5FB0 A;  5AIT A;  2ECJ A;  4YBS A;  5B75 A;  2YQL A;  1Z60 A;  3O7A A;  2CKL B;  2YU4 A;  1DVP A;  2EOD A;  2RSD A;  2DX8 A;  2H0D A;  1WIL A;  4YAT A;  1K2F A;  5FB1 A;  3M63 A;  1WFK A;  5KH9 A;  2KWK A;  2LGK A;  4AUQ B;  2CKL A;  4LAD B;  2EGP A;  3T6R A;  3M99 A;  4B86 C;  4YBM A;  2LGG A;  2VPG A;  1HYJ A;  3RPG C;  4TKP B;  5TBN A;  4PPE A;  2L75 A;  1MM3 A;  4LJN A;  4IC3 A;  5LKU A;  3ASL A;  4MVT A;  1WEM A;  2K17 A;  2L0B A;  2QIC A;  3LRQ A;  1RMD A;  3ZVY A;  4R8P K;  3ZYQ A;  3N9N A;  2Y43 A;  1IYM A;  2VNF A;  5JG6 A;  3N9L A;  2ECV A;  1WE9 A;  3O36 A;  2ECI A;  2YUR A;  2L43 A;  4A4C A;  2CSY A;  1T1H A;  4L7X A;  2K16 A;  3PUQ A;  4CA1 A;  3SHB A;  2QIZ A;  5C13 A;  2YHO A;  2BAY A;  3QZV A;  1WEE A;  5TRB A;  4UP0 A;  2G43 A;  4GNG A;  2KWO A;  2C2L A;  4WZ3 B;  4FO9 A;  4C9Z A;  2Y1M A;  1WEU A;  5DIN A;  3O37 A;  3KQI A;  2YSJ A;  2E6R A;  2KWN A;  3RTR B;  1HYI A;  2IDA A;  3KV6 A;  5H1U A;  2F6N A;  4YAX A;  3O34 A;  3LQI A;  3N9P A;  5KH3 A;  1CHC A;  3O70 A;  2HYE D;  3HCT A;  3KNV A;  2MA6 A;  4BHW A;  4ZDT A;  5B76 A;  2KE1 A;  1VFY A;  1WIM A;  1V87 A;  3C6W A;  4A4B A;  2VPD A;  2VJF B;  3GL6 A;  2I50 A;  5TDW A;  3VK6 A;  4F52 B;  2QJ0 A;  3ZPV 1;  3KV5 A;  2JMJ A;  2XEU A;  2KWJ A;  2M6M A;  1VD4 A;  3I2D A;  3O35 A;  4LK9 A;  2VJF A;  4P5O B;  2MT5 A;  5LKZ A;  4ZQL A;  2CT2 A;  3C5K A;  1JOC A;  4O64 A;  2LGV A;  2LGL A;  2LDR A;  3SOU A;  1WEN A;  3U5O A;  4AYC B;  4V3L C;  4LKA A;  1Z2Q A;  2LQ6 A;  2NAA A;  2ZET C;  2KYU A;  2MNZ A;  4AP4 A;  2YRE A;  3M62 A;  1WEQ A;  3LQH A;  4R2Y A;  5J3X A;  4AYC A;  4WZ0 A;  2M3H A;  2YT5 A;  5LKX A;  2KU3 A;  2VPB A;  4W4U A;  2K1J A;  1XWH A;  3EB5 A;  3ZPV E;  5H1V A;  5G05 B;  2ECT A;  5G04 B;  1MM2 A;  1X4U A;  1X4J A;  3SOW A;  2JMI A;  4YAD A;  2YSM A;  1JM7 B;  2VP7 A;  2RI7 A;  4UP5 A;  3T7L A;  2M85 A;  2Y1N A;  1LDK C;  5LCW B;  3EB6 A;  3HCS A;  2YQM A;  4UI9 B;  4Q6F A;  1JM7 A;  2JMD A;  4YC9 A;  5B79 A;  3PHD A;  2ECW A;  4WZ2 A;  2KRE A;  2LXP C;  4ZUX U;  5EYA F;  4A49 A;  1Z6U A;  2K4D A;  2MD8 C;  4QF2 A;  5D1K B;  2VPE A;  3HCU A;  2PUY A;  1E4U A;  1WEP A;  5TDR A;  3L1X A;  3FL2 A;  4YBT A;  2AN6 A;  2MUM A;  1WEW A;  2YHN A;  3NG2 A;  3N9O A;  1WES A;  4FJC A;  2L5U A;  4MSX A;  2MIQ A;  2HDP A;  3HTK C;  5I3L A;  2KFT A;  1FBV A;  2D8S A;  4XI1 A;  1WGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...