2YHOA

The idol-ube2d complex mediates sterol-dependent degradation of the ldl receptor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
RVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYLPTHTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Idol-Ube2D Complex Mediates Sterol-Dependent Degradation of the Ldl Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MYLIP
total genus 16
structure length 67
sequence length 67
chains with identical sequence C, E, G
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yhoA00
2YW8A 2Y1NA 3SOWA 4GNFA 2Y43A 3L1XA 1FBVA 2VPDA 2CSYA 5H9MA 1N87A 1WEUA 5FB1A 1MM2A 3N9NA 1LDKC 5B77A 1WENA 2ECNA 4GNGA 2M3HA 1ZBDB 1WFKA 4MVTA 5KH3A 5FERA 2UZGA 2NAAA 2LV9A 4UP0A 4AVXA 5LKTA 3U5PA 4L58A 4UP5A 2HDPA 2M1RA 4NN2A 2MA5A 3O33A 2YT5A 2VP7A 1VD4A 2M6MA 1WEWA 2K4DA 3EB6A 4Q6FA 4L7XA 5C11A 3U5MA 3QZVA 2YREA 5LKZA 2C2LA 3O35A 1WIMA 4YBTA 3DPLR 3M63A 3C5KA 3MHSA 2MNZA 3PURA 5C13A 2KGGA 4GNDA 1X4JA 5TBNA 1FP0A 2E6RA 5FB0A 3V43A 2L5UA 4A4CA 1VFYA 2F6JA 3M62A 2ECGA 1E4UA 2HYED 4V3KC 2EA6A 4YBSA 3T6RA 4B7YC 2AN6A 4YABA 2KWNA 2MD7B 2RSDA 4O64A 3KQIA 4PPEA 4S3OC 4S3OB 5H1VA 4GNEA 2ECIA 5I3LA 4XI1A 4LK9A 4A4BA 2JMDA 3T7LA 2VJEB 4WZ2A 4I7DA 2LGKA 4I7BA 4YC9A 2KIZA 4R8PK 1LDJB 4LLBA 2ECWA 2ECJA 2VJFB 4QF3A 4R2YA 1WEOA 1Z6UA 1WEPA 2K1JA 1X4IA 3FL2A 3DQVR 4WZ3B 2MD8C 5G0FA 5LCWB 4P5OB 5B79A 5D1KB 4YAXA 5G05B 4X3GA 5DINA 2RI7A 2H0DA 2KYUA 2LRIC 2PNXA 5DKAA 4GB0A 2LDRA 2MA6A 3L11A 3MHHA 1VYXA 3VK6A 5H1UA 2LGVA 2LGGA 2ECVA 2E6SA 4IC2A 3ZTGA 5LKXA 1WESA 2BAYA 1WEEA 1V87A 2XEUA 2YQLA 4LADB 5EYAF 5KH7A 4FIPA 4AP4A 3N9QA 2K17A 1XWHA 2OXQC 1G25A 2VJFA 1X4UA 5D1MB 5JG6A 2I50A 2VJEA 2VPEA 2CT2A 1WILA 2YYRA 3HCSA 4UI9B 2L75A 2FSAA 1Z2QA 2K16A 4TKPB 4YATA 4WA6A 3N9OA 5J3XA 4LJNA 3N9MA 3HCTA 2JMIA 3O7AA 3I2DA 3EB5A 1CHCA 3O37A 3SOXA 4N4FA 2QICA 4FO9A 1HYIA 5B78A 4A49A 2KE1A 2YSMA 2DX8A 4WZ0A 1WEMA 3O36A 4QF2A 1IYMA 3ZPV1 1WEVA 4I7CA 2FUUA 4V3LC 2CKLB 4IC3A 2VPGA 4W4UA 3SHBA 5AITA 2LGLA 3ZVYA 3LQHA 3U5OA 3ZYQA 2XB1A 5KH9A 5TABA 4C9ZA 1HYJA 2YU4A 5FEYA 4AUQB 4A0CD 2LXHC 2C2VS 5B8DA 4FJCA 5B75A 4F52B 2LN0A 3HTKC 4AYCA 2CSZA 3LQJA 4BBQA 4B86C 2KU3A 3O34A 2KGIA 1DVPA 3ZVZB 2ECTA 1WE9A 3NG2A 4BHWA 4LKAA 4CCGX 1Z60A 2ZETC 5LKUA 2M85A 3KV6A 2JMJA 3GL6A 4YBMA 5AIUA 2YUCA 3IHPA 1RMDA 4CA1A 3N9LA 2D8SA 2Y1MA 4YADA 1JM7A 2H0DB 1BORA 2MUMA 2F6NA 2JRJA 2KR4A 2YHOA 3RPGB 3RPGC 2L80A 1JOCA 2KFTA 5B76A 3HCUA 4ZQLA 2G43A 2MIQA 2L43A 2G6QA 1WEQA 1U6GB 3SOUA 2KWJA 5TDRA 4AYCB 3LRQA 4PTBA 1MM3A 2MT5A 2YQMA 3ASLA 3ZNIA 2MNYA 2LXPC 3U5NA 3GV4A 5H1TA 4FK5A 3O70A 3KNVA 2KWOA 4R7EA 3PUQA 2PUYA 4ZDTA 4N3WA 5D1LB 2YURA 2G45A 2EODA 2F42A 1JM7B 3C6WA 5G04B 2YHNA 2LQ6A 2QJ0A 1T1HA 4MSXA 2QIZA 3L1ZB 3ZPVE 2IDAA 1K2FA 2L0BA 1WGMA 3M99A 2EGPA 2KWKA 3LQIA 3N9PA 2CKLA 3KV5A 3RTRB 5TRBA 1F62A 5TDWA 2YSJA 2KREA 2FUIA 2VPBA 3PHDA 2VNFA 4ZUXU
chains in the Genus database with same CATH superfamily
2YW8A 2Y1NA 2XOCA 3SOWA 3LVRE 4GNFA 5SVXA 3H7HA 2D8UA 2FFWA 2Y43A 3L1XA 1FBVA 2VPDA 2CSYA 3FM8C 5H9MA 1N87A 1WEUA 5FB1A 1MM2A 3N9NA 1LDKC 5B77A 1WENA 2ECNA 4GNGA 2M3HA 1ZBDB 1WFKA 4MVTA 5KH3A 3SUBA 2E61A 5FERA 2UZGA 2CRWA 2NAAA 2LV9A 4UP0A 4AVXA 5LKTA 3U5PA 4L58A 4UP5A 2HDPA 2M1RA 4NN2A 2MA5A 2EXUA 3O33A 2YT5A 2VP7A 1VD4A 2M6MA 1WEWA 2K4DA 2DJAA 3EB6A 4Q6FA 4L7XA 5C11A 3U5MA 2CSVA 3QZVA 2YREA 3FAOA 5LKZA 2C2LA 3O35A 1WIMA 5K3QA 4YBTA 3DPLR 3M63A 3C5KA 3MHSA 2MNZA 3PURA 5C13A 2KGGA 4GNDA 1X4JA 5TBNA 1FP0A 2E6RA 5FB0A 3V43A 2L5UA 4A4CA 2P57A 1VFYA 2F6JA 3M62A 2ECGA 2B0OE 1E4UA 2HYED 4V3KC 2EA6A 4YBSA 3T6RA 4B7YC 2AN6A 4YABA 2KWNA 2MD7B 2RSDA 4O64A 3KQIA 4PPEA 4S3OC 4S3OB 2KKXA 5H1VA 4GNEA 2ECIA 5I3LA 4XI1A 4OGEA 4LK9A 4A4BA 2JMDA 3T7LA 2VJEB 4WZ2A 4I7DA 3O47A 2LGKA 4I7BA 4YC9A 2KIZA 4R8PK 1LDJB 4LLBA 2ECWA 2ECJA 2VJFB 4QF3A 4R2YA 1WEOA 1Z6UA 1WEPA 4F1PA 2K1JA 1X4IA 3FL2A 3FEHA 3DQVR 4WZ3B 2MD8C 5G0FA 3DDTA 5LCWB 4P5OB 5B79A 5D1KB 4YAXA 5G05B 4X3GA 5DINA 2RI7A 2H0DA 2KYUA 2LRIC 2PNXA 5DKAA 4GB0A 2KKYA 2EGMA 2LDRA 2MA6A 3L11A 3MHHA 1VYXA 3VK6A 5H1UA 2LGVA 2LGGA 2ECVA 2E6SA 4IC2A 3ZTGA 5LKXA 2M13A 1WESA 2BAYA 1WEEA 1V87A 3LVQE 2XEUA 3LDYA 2YQLA 4LADB 5EYAF 5KH7A 4FIPA 4AP4A 4Z0OA 3N9QA 2K17A 3FANA 1XWHA 2OXQC 1G25A 2VJFA 1X4UA 5D1MB 5JG6A 2I50A 2VJEA 2VPEA 2CT2A 1WILA 2YYRA 3HCSA 4UI9B 4Z0RA 2L75A 2FSAA 3M7KA 1Z2QA 2OWAA 2K16A 4TKPB 4YATA 2XOYA 3MDBC 4WA6A 3N9OA 3DWDA 5J3XA 4LJNA 3N9MA 3HCTA 2JMIA 3O7AA 3I2DA 2IQJA 3EB5A 1CHCA 3O37A 3SOXA 4N4FA 2QICA 4FO9A 1HYIA 5B78A 4A49A 2KE1A 2YSMA 2DX8A 4WZ0A 1WEMA 3O36A 4QF2A 1IYMA 3ZPV1 1WEVA 4I7CA 2FUUA 4V3LC 2MKEA 2CKLB 4IC3A 2VPGA 4W4UA 3LJUX 3SHBA 5AITA 2LGLA 3ZVYA 5SVYA 3LQHA 3U5OA 3ZYQA 2XB1A 5KH9A 5TABA 3T9KA 4C9ZA 1HYJA 2YU4A 4QQ4A 5FEYA 2RR4A 4AUQB 4A0CD 2LXHC 2C2VS 5B8DA 4FJCA 5B75A 4F52B 2LN0A 3HTKC 4AYCA 2CSZA 3LQJA 4BBQA 4B86C 2KU3A 3O34A 2KGIA 1DVPA 2JUNA 3ZVZB 2CONA 2ECTA 1WE9A 2FD4A 2JM3A 2LAUA 4O62A 3NG2A 4BHWA 4LKAA 4CCGX 1Z60A 2ZETC 5LKUA 2M85A 3KV6A 2JMJA 3GL6A 4YBMA 5AIUA 2YUCA 2L7PA 3IHPA 1RMDA 2XOZA 3N9LA 4CA1A 2D8SA 2Y1MA 4YADA 1JM7A 2H0DB 1BORA 2MUMA 2F6NA 2JRJA 2KR4A 2YHOA 3RPGB 3RPGC 2L80A 1JOCA 2KFTA 5B76A 3HCUA 4ZQLA 2G43A 2MIQA 2L43A 2G6QA 1WEQA 1U6GB 3SOUA 2KWJA 5TDRA 1DCQA 4AYCB 3LRQA 4H9DA 4PTBA 1MM3A 2MT5A 2YQMA 3ASLA 4OGCA 3ZNIA 2MNYA 2LXPC 3PLWA 3U5NA 3Q1DA 3FJUB 2CRRA 3GV4A 5H1TA 4FK5A 3O70A 3KNVA 2KWOA 4R7EA 3PUQA 2PUYA 4ZDTA 4N3WA 5D1LB 2YVRA 2XP0A 2YURA 2G45A 2DSMA 2EODA 2F42A 1JM7B 3KDEC 1MBMA 5SVIB 3C6WA 5G04B 2YHNA 2LQ6A 2QJ0A 1T1HA 4MSXA 2QIZA 3L1ZB 3ZPVE 2IDAA 1K2FA 3E2DA 2L0BA 1WGMA 3M99A 2EGPA 2KWKA 3LQIA 3N9PA 2CKLA 3KV5A 3RTRB 5TRBA 1F62A 5TDWA 2YSJA 3JUEA 2KREA 2FUIA 5SVIA 2VPBA 3PHDA 2VNFA 4ZUXU
chains in the Genus database with same CATH topology
2YW8A 2Y1NA 3SOWA 4GNFA 2Y43A 3L1XA 1FBVA 2VPDA 2CSYA 5H9MA 1N87A 1WEUA 5FB1A 1MM2A 3N9NA 1LDKC 5B77A 1WENA 2ECNA 4GNGA 2M3HA 1ZBDB 1WFKA 4MVTA 5KH3A 5FERA 2UZGA 2NAAA 2LV9A 4UP0A 4AVXA 5LKTA 3U5PA 4L58A 4UP5A 2HDPA 2M1RA 4NN2A 2MA5A 3O33A 2YT5A 2VP7A 1VD4A 2M6MA 1WEWA 2K4DA 3EB6A 4Q6FA 4L7XA 5C11A 3U5MA 3QZVA 2YREA 5LKZA 2C2LA 3O35A 1WIMA 4YBTA 3DPLR 3M63A 3C5KA 3MHSA 2MNZA 3PURA 5C13A 2KGGA 4GNDA 1X4JA 5TBNA 1FP0A 2E6RA 5FB0A 3V43A 2L5UA 4A4CA 1VFYA 2F6JA 3M62A 2ECGA 1E4UA 2HYED 4V3KC 2EA6A 4YBSA 3T6RA 4B7YC 2AN6A 4YABA 2KWNA 2MD7B 2RSDA 4O64A 3KQIA 4PPEA 4S3OC 4S3OB 5H1VA 4GNEA 2ECIA 5I3LA 4XI1A 4LK9A 4A4BA 2JMDA 3T7LA 2VJEB 4WZ2A 4I7DA 2LGKA 4I7BA 4YC9A 2KIZA 4R8PK 1LDJB 4LLBA 2ECWA 2ECJA 2VJFB 4QF3A 4R2YA 1WEOA 1Z6UA 1WEPA 2K1JA 1X4IA 3FL2A 3DQVR 4WZ3B 2MD8C 5G0FA 5LCWB 4P5OB 5B79A 5D1KB 4YAXA 5G05B 4X3GA 5DINA 2RI7A 2H0DA 2KYUA 2LRIC 2PNXA 5DKAA 4GB0A 2LDRA 2MA6A 3L11A 3MHHA 1VYXA 3VK6A 5H1UA 2LGVA 2LGGA 2ECVA 2E6SA 4IC2A 3ZTGA 5LKXA 1WESA 2BAYA 1WEEA 1V87A 2XEUA 2YQLA 4LADB 5EYAF 5KH7A 4FIPA 4AP4A 3N9QA 2K17A 1XWHA 2OXQC 1G25A 2VJFA 1X4UA 5D1MB 5JG6A 2I50A 2VJEA 2VPEA 2CT2A 1WILA 2YYRA 3HCSA 4UI9B 2L75A 2FSAA 1Z2QA 2K16A 4TKPB 4YATA 4WA6A 3N9OA 5J3XA 4LJNA 3N9MA 3HCTA 2JMIA 3O7AA 3I2DA 3EB5A 1CHCA 3O37A 3SOXA 4N4FA 2QICA 4FO9A 1HYIA 5B78A 4A49A 2KE1A 2YSMA 2DX8A 4WZ0A 1WEMA 3O36A 4QF2A 1IYMA 3ZPV1 1WEVA 4I7CA 2FUUA 4V3LC 2CKLB 4IC3A 2VPGA 4W4UA 3SHBA 5AITA 2LGLA 3ZVYA 3LQHA 3U5OA 3ZYQA 2XB1A 5KH9A 5TABA 4C9ZA 1HYJA 2YU4A 5FEYA 4AUQB 4A0CD 2LXHC 2C2VS 5B8DA 4FJCA 5B75A 4F52B 2LN0A 3HTKC 4AYCA 2CSZA 3LQJA 4BBQA 4B86C 2KU3A 3O34A 2KGIA 1DVPA 3ZVZB 2ECTA 1WE9A 3NG2A 4BHWA 4LKAA 4CCGX 1Z60A 2ZETC 5LKUA 2M85A 3KV6A 2JMJA 3GL6A 4YBMA 5AIUA 2YUCA 3IHPA 1RMDA 4CA1A 3N9LA 2D8SA 2Y1MA 4YADA 1JM7A 2H0DB 1BORA 2MUMA 2F6NA 2JRJA 2KR4A 2YHOA 3RPGB 3RPGC 2L80A 1JOCA 2KFTA 5B76A 3HCUA 4ZQLA 2G43A 2MIQA 2L43A 2G6QA 1WEQA 1U6GB 3SOUA 2KWJA 5TDRA 4AYCB 3LRQA 4PTBA 1MM3A 2MT5A 2YQMA 3ASLA 3ZNIA 2MNYA 2LXPC 3U5NA 3GV4A 5H1TA 4FK5A 3O70A 3KNVA 2KWOA 4R7EA 3PUQA 2PUYA 4ZDTA 4N3WA 5D1LB 2YURA 2G45A 2EODA 2F42A 1JM7B 3C6WA 5G04B 2YHNA 2LQ6A 2QJ0A 1T1HA 4MSXA 2QIZA 3L1ZB 3ZPVE 2IDAA 1K2FA 2L0BA 1WGMA 3M99A 2EGPA 2KWKA 3LQIA 3N9PA 2CKLA 3KV5A 3RTRB 5TRBA 1F62A 5TDWA 2YSJA 2KREA 2FUIA 2VPBA 3PHDA 2VNFA 4ZUXU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YW8 A;  2Y1N A;  3SOW A;  4GNF A;  2Y43 A;  3L1X A;  1FBV A;  2VPD A;  2CSY A;  5H9M A;  1N87 A;  1WEU A;  5FB1 A;  1MM2 A;  3N9N A;  1LDK C;  5B77 A;  1WEN A;  2ECN A;  4GNG A;  2M3H A;  1ZBD B;  1WFK A;  4MVT A;  5KH3 A;  5FER A;  2UZG A;  2NAA A;  2LV9 A;  4UP0 A;  4AVX A;  5LKT A;  3U5P A;  4L58 A;  4UP5 A;  2HDP A;  2M1R A;  4NN2 A;  2MA5 A;  3O33 A;  2YT5 A;  2VP7 A;  1VD4 A;  2M6M A;  1WEW A;  2K4D A;  3EB6 A;  4Q6F A;  4L7X A;  5C11 A;  3U5M A;  3QZV A;  2YRE A;  5LKZ A;  2C2L A;  3O35 A;  1WIM A;  4YBT A;  3DPL R;  3M63 A;  3C5K A;  3MHS A;  2MNZ A;  3PUR A;  5C13 A;  2KGG A;  4GND A;  1X4J A;  5TBN A;  1FP0 A;  2E6R A;  5FB0 A;  3V43 A;  2L5U A;  4A4C A;  1VFY A;  2F6J A;  3M62 A;  2ECG A;  1E4U A;  2HYE D;  4V3K C;  2EA6 A;  4YBS A;  3T6R A;  4B7Y C;  2AN6 A;  4YAB A;  2KWN A;  2MD7 B;  2RSD A;  4O64 A;  3KQI A;  4PPE A;  4S3O C;  4S3O B;  5H1V A;  4GNE A;  2ECI A;  5I3L A;  4XI1 A;  4LK9 A;  4A4B A;  2JMD A;  3T7L A;  2VJE B;  4WZ2 A;  4I7D A;  2LGK A;  4I7B A;  4YC9 A;  2KIZ A;  4R8P K;  1LDJ B;  4LLB A;  2ECW A;  2ECJ A;  2VJF B;  4QF3 A;  4R2Y A;  1WEO A;  1Z6U A;  1WEP A;  2K1J A;  1X4I A;  3FL2 A;  3DQV R;  4WZ3 B;  2MD8 C;  5G0F A;  5LCW B;  4P5O B;  5B79 A;  5D1K B;  4YAX A;  5G05 B;  4X3G A;  5DIN A;  2RI7 A;  2H0D A;  2KYU A;  2LRI C;  2PNX A;  5DKA A;  4GB0 A;  2LDR A;  2MA6 A;  3L11 A;  3MHH A;  1VYX A;  3VK6 A;  5H1U A;  2LGV A;  2LGG A;  2ECV A;  2E6S A;  4IC2 A;  3ZTG A;  5LKX A;  1WES A;  2BAY A;  1WEE A;  1V87 A;  2XEU A;  2YQL A;  4LAD B;  5EYA F;  5KH7 A;  4FIP A;  4AP4 A;  3N9Q A;  2K17 A;  1XWH A;  2OXQ C;  1G25 A;  2VJF A;  1X4U A;  5D1M B;  5JG6 A;  2I50 A;  2VJE A;  2VPE A;  2CT2 A;  1WIL A;  2YYR A;  3HCS A;  4UI9 B;  2L75 A;  2FSA A;  1Z2Q A;  2K16 A;  4TKP B;  4YAT A;  4WA6 A;  3N9O A;  5J3X A;  4LJN A;  3N9M A;  3HCT A;  2JMI A;  3O7A A;  3I2D A;  3EB5 A;  1CHC A;  3O37 A;  3SOX A;  4N4F A;  2QIC A;  4FO9 A;  1HYI A;  5B78 A;  4A49 A;  2KE1 A;  2YSM A;  2DX8 A;  4WZ0 A;  1WEM A;  3O36 A;  4QF2 A;  1IYM A;  3ZPV 1;  1WEV A;  4I7C A;  2FUU A;  4V3L C;  2CKL B;  4IC3 A;  2VPG A;  4W4U A;  3SHB A;  5AIT A;  2LGL A;  3ZVY A;  3LQH A;  3U5O A;  3ZYQ A;  2XB1 A;  5KH9 A;  5TAB A;  4C9Z A;  1HYJ A;  2YU4 A;  5FEY A;  4AUQ B;  4A0C D;  2LXH C;  2C2V S;  5B8D A;  4FJC A;  5B75 A;  4F52 B;  2LN0 A;  3HTK C;  4AYC A;  2CSZ A;  3LQJ A;  4BBQ A;  4B86 C;  2KU3 A;  3O34 A;  2KGI A;  1DVP A;  3ZVZ B;  2ECT A;  1WE9 A;  3NG2 A;  4BHW A;  4LKA A;  4CCG X;  1Z60 A;  2ZET C;  5LKU A;  2M85 A;  3KV6 A;  2JMJ A;  3GL6 A;  4YBM A;  5AIU A;  2YUC A;  3IHP A;  1RMD A;  4CA1 A;  3N9L A;  2D8S A;  2Y1M A;  4YAD A;  1JM7 A;  2H0D B;  1BOR A;  2MUM A;  2F6N A;  2JRJ A;  2KR4 A;  2YHO A;  3RPG B;  3RPG C;  2L80 A;  1JOC A;  2KFT A;  5B76 A;  3HCU A;  4ZQL A;  2G43 A;  2MIQ A;  2L43 A;  2G6Q A;  1WEQ A;  1U6G B;  3SOU A;  2KWJ A;  5TDR A;  4AYC B;  3LRQ A;  4PTB A;  1MM3 A;  2MT5 A;  2YQM A;  3ASL A;  3ZNI A;  2MNY A;  2LXP C;  3U5N A;  3GV4 A;  5H1T A;  4FK5 A;  3O70 A;  3KNV A;  2KWO A;  4R7E A;  3PUQ A;  2PUY A;  4ZDT A;  4N3W A;  5D1L B;  2YUR A;  2G45 A;  2EOD A;  2F42 A;  1JM7 B;  3C6W A;  5G04 B;  2YHN A;  2LQ6 A;  2QJ0 A;  1T1H A;  4MSX A;  2QIZ A;  3L1Z B;  3ZPV E;  2IDA A;  1K2F A;  2L0B A;  1WGM A;  3M99 A;  2EGP A;  2KWK A;  3LQI A;  3N9P A;  2CKL A;  3KV5 A;  3RTR B;  5TRB A;  1F62 A;  5TDW A;  2YSJ A;  2KRE A;  2FUI A;  2VPB A;  3PHD A;  2VNF A;  4ZUX U; 
#chains in the Genus database with same CATH topology
 2YW8 A;  2Y1N A;  2XOC A;  3SOW A;  3LVR E;  4GNF A;  5SVX A;  3H7H A;  2D8U A;  2FFW A;  2Y43 A;  3L1X A;  1FBV A;  2VPD A;  2CSY A;  3FM8 C;  5H9M A;  1N87 A;  1WEU A;  5FB1 A;  1MM2 A;  3N9N A;  1LDK C;  5B77 A;  1WEN A;  2ECN A;  4GNG A;  2M3H A;  1ZBD B;  1WFK A;  4MVT A;  5KH3 A;  3SUB A;  2E61 A;  5FER A;  2UZG A;  2CRW A;  2NAA A;  2LV9 A;  4UP0 A;  4AVX A;  5LKT A;  3U5P A;  4L58 A;  4UP5 A;  2HDP A;  2M1R A;  4NN2 A;  2MA5 A;  2EXU A;  3O33 A;  2YT5 A;  2VP7 A;  1VD4 A;  2M6M A;  1WEW A;  2K4D A;  2DJA A;  3EB6 A;  4Q6F A;  4L7X A;  5C11 A;  3U5M A;  2CSV A;  3QZV A;  2YRE A;  3FAO A;  5LKZ A;  2C2L A;  3O35 A;  1WIM A;  5K3Q A;  4YBT A;  3DPL R;  3M63 A;  3C5K A;  3MHS A;  2MNZ A;  3PUR A;  5C13 A;  2KGG A;  4GND A;  1X4J A;  5TBN A;  1FP0 A;  2E6R A;  5FB0 A;  3V43 A;  2L5U A;  4A4C A;  2P57 A;  1VFY A;  2F6J A;  3M62 A;  2ECG A;  2B0O E;  1E4U A;  2HYE D;  4V3K C;  2EA6 A;  4YBS A;  3T6R A;  4B7Y C;  2AN6 A;  4YAB A;  2KWN A;  2MD7 B;  2RSD A;  4O64 A;  3KQI A;  4PPE A;  4S3O C;  4S3O B;  2KKX A;  5H1V A;  4GNE A;  2ECI A;  5I3L A;  4XI1 A;  4OGE A;  4LK9 A;  4A4B A;  2JMD A;  3T7L A;  2VJE B;  4WZ2 A;  4I7D A;  3O47 A;  2LGK A;  4I7B A;  4YC9 A;  2KIZ A;  4R8P K;  1LDJ B;  4LLB A;  2ECW A;  2ECJ A;  2VJF B;  4QF3 A;  4R2Y A;  1WEO A;  1Z6U A;  1WEP A;  4F1P A;  2K1J A;  1X4I A;  3FL2 A;  3FEH A;  3DQV R;  4WZ3 B;  2MD8 C;  5G0F A;  3DDT A;  5LCW B;  4P5O B;  5B79 A;  5D1K B;  4YAX A;  5G05 B;  4X3G A;  5DIN A;  2RI7 A;  2H0D A;  2KYU A;  2LRI C;  2PNX A;  5DKA A;  4GB0 A;  2KKY A;  2EGM A;  2LDR A;  2MA6 A;  3L11 A;  3MHH A;  1VYX A;  3VK6 A;  5H1U A;  2LGV A;  2LGG A;  2ECV A;  2E6S A;  4IC2 A;  3ZTG A;  5LKX A;  2M13 A;  1WES A;  2BAY A;  1WEE A;  1V87 A;  3LVQ E;  2XEU A;  3LDY A;  2YQL A;  4LAD B;  5EYA F;  5KH7 A;  4FIP A;  4AP4 A;  4Z0O A;  3N9Q A;  2K17 A;  3FAN A;  1XWH A;  2OXQ C;  1G25 A;  2VJF A;  1X4U A;  5D1M B;  5JG6 A;  2I50 A;  2VJE A;  2VPE A;  2CT2 A;  1WIL A;  2YYR A;  3HCS A;  4UI9 B;  4Z0R A;  2L75 A;  2FSA A;  3M7K A;  1Z2Q A;  2OWA A;  2K16 A;  4TKP B;  4YAT A;  2XOY A;  3MDB C;  4WA6 A;  3N9O A;  3DWD A;  5J3X A;  4LJN A;  3N9M A;  3HCT A;  2JMI A;  3O7A A;  3I2D A;  2IQJ A;  3EB5 A;  1CHC A;  3O37 A;  3SOX A;  4N4F A;  2QIC A;  4FO9 A;  1HYI A;  5B78 A;  4A49 A;  2KE1 A;  2YSM A;  2DX8 A;  4WZ0 A;  1WEM A;  3O36 A;  4QF2 A;  1IYM A;  3ZPV 1;  1WEV A;  4I7C A;  2FUU A;  4V3L C;  2MKE A;  2CKL B;  4IC3 A;  2VPG A;  4W4U A;  3LJU X;  3SHB A;  5AIT A;  2LGL A;  3ZVY A;  5SVY A;  3LQH A;  3U5O A;  3ZYQ A;  2XB1 A;  5KH9 A;  5TAB A;  3T9K A;  4C9Z A;  1HYJ A;  2YU4 A;  4QQ4 A;  5FEY A;  2RR4 A;  4AUQ B;  4A0C D;  2LXH C;  2C2V S;  5B8D A;  4FJC A;  5B75 A;  4F52 B;  2LN0 A;  3HTK C;  4AYC A;  2CSZ A;  3LQJ A;  4BBQ A;  4B86 C;  2KU3 A;  3O34 A;  2KGI A;  1DVP A;  2JUN A;  3ZVZ B;  2CON A;  2ECT A;  1WE9 A;  2FD4 A;  2JM3 A;  2LAU A;  4O62 A;  3NG2 A;  4BHW A;  4LKA A;  4CCG X;  1Z60 A;  2ZET C;  5LKU A;  2M85 A;  3KV6 A;  2JMJ A;  3GL6 A;  4YBM A;  5AIU A;  2YUC A;  2L7P A;  3IHP A;  1RMD A;  2XOZ A;  3N9L A;  4CA1 A;  2D8S A;  2Y1M A;  4YAD A;  1JM7 A;  2H0D B;  1BOR A;  2MUM A;  2F6N A;  2JRJ A;  2KR4 A;  2YHO A;  3RPG B;  3RPG C;  2L80 A;  1JOC A;  2KFT A;  5B76 A;  3HCU A;  4ZQL A;  2G43 A;  2MIQ A;  2L43 A;  2G6Q A;  1WEQ A;  1U6G B;  3SOU A;  2KWJ A;  5TDR A;  1DCQ A;  4AYC B;  3LRQ A;  4H9D A;  4PTB A;  1MM3 A;  2MT5 A;  2YQM A;  3ASL A;  4OGC A;  3ZNI A;  2MNY A;  2LXP C;  3PLW A;  3U5N A;  3Q1D A;  3FJU B;  2CRR A;  3GV4 A;  5H1T A;  4FK5 A;  3O70 A;  3KNV A;  2KWO A;  4R7E A;  3PUQ A;  2PUY A;  4ZDT A;  4N3W A;  5D1L B;  2YVR A;  2XP0 A;  2YUR A;  2G45 A;  2DSM A;  2EOD A;  2F42 A;  1JM7 B;  3KDE C;  1MBM A;  5SVI B;  3C6W A;  5G04 B;  2YHN A;  2LQ6 A;  2QJ0 A;  1T1H A;  4MSX A;  2QIZ A;  3L1Z B;  3ZPV E;  2IDA A;  1K2F A;  3E2D A;  2L0B A;  1WGM A;  3M99 A;  2EGP A;  2KWK A;  3LQI A;  3N9P A;  2CKL A;  3KV5 A;  3RTR B;  5TRB A;  1F62 A;  5TDW A;  2YSJ A;  3JUE A;  2KRE A;  2FUI A;  5SVI A;  2VPB A;  3PHD A;  2VNF A;  4ZUX U; 
#chains in the Genus database with same CATH homology
 2YW8 A;  2Y1N A;  3SOW A;  4GNF A;  2Y43 A;  3L1X A;  1FBV A;  2VPD A;  2CSY A;  5H9M A;  1N87 A;  1WEU A;  5FB1 A;  1MM2 A;  3N9N A;  1LDK C;  5B77 A;  1WEN A;  2ECN A;  4GNG A;  2M3H A;  1ZBD B;  1WFK A;  4MVT A;  5KH3 A;  5FER A;  2UZG A;  2NAA A;  2LV9 A;  4UP0 A;  4AVX A;  5LKT A;  3U5P A;  4L58 A;  4UP5 A;  2HDP A;  2M1R A;  4NN2 A;  2MA5 A;  3O33 A;  2YT5 A;  2VP7 A;  1VD4 A;  2M6M A;  1WEW A;  2K4D A;  3EB6 A;  4Q6F A;  4L7X A;  5C11 A;  3U5M A;  3QZV A;  2YRE A;  5LKZ A;  2C2L A;  3O35 A;  1WIM A;  4YBT A;  3DPL R;  3M63 A;  3C5K A;  3MHS A;  2MNZ A;  3PUR A;  5C13 A;  2KGG A;  4GND A;  1X4J A;  5TBN A;  1FP0 A;  2E6R A;  5FB0 A;  3V43 A;  2L5U A;  4A4C A;  1VFY A;  2F6J A;  3M62 A;  2ECG A;  1E4U A;  2HYE D;  4V3K C;  2EA6 A;  4YBS A;  3T6R A;  4B7Y C;  2AN6 A;  4YAB A;  2KWN A;  2MD7 B;  2RSD A;  4O64 A;  3KQI A;  4PPE A;  4S3O C;  4S3O B;  5H1V A;  4GNE A;  2ECI A;  5I3L A;  4XI1 A;  4LK9 A;  4A4B A;  2JMD A;  3T7L A;  2VJE B;  4WZ2 A;  4I7D A;  2LGK A;  4I7B A;  4YC9 A;  2KIZ A;  4R8P K;  1LDJ B;  4LLB A;  2ECW A;  2ECJ A;  2VJF B;  4QF3 A;  4R2Y A;  1WEO A;  1Z6U A;  1WEP A;  2K1J A;  1X4I A;  3FL2 A;  3DQV R;  4WZ3 B;  2MD8 C;  5G0F A;  5LCW B;  4P5O B;  5B79 A;  5D1K B;  4YAX A;  5G05 B;  4X3G A;  5DIN A;  2RI7 A;  2H0D A;  2KYU A;  2LRI C;  2PNX A;  5DKA A;  4GB0 A;  2LDR A;  2MA6 A;  3L11 A;  3MHH A;  1VYX A;  3VK6 A;  5H1U A;  2LGV A;  2LGG A;  2ECV A;  2E6S A;  4IC2 A;  3ZTG A;  5LKX A;  1WES A;  2BAY A;  1WEE A;  1V87 A;  2XEU A;  2YQL A;  4LAD B;  5EYA F;  5KH7 A;  4FIP A;  4AP4 A;  3N9Q A;  2K17 A;  1XWH A;  2OXQ C;  1G25 A;  2VJF A;  1X4U A;  5D1M B;  5JG6 A;  2I50 A;  2VJE A;  2VPE A;  2CT2 A;  1WIL A;  2YYR A;  3HCS A;  4UI9 B;  2L75 A;  2FSA A;  1Z2Q A;  2K16 A;  4TKP B;  4YAT A;  4WA6 A;  3N9O A;  5J3X A;  4LJN A;  3N9M A;  3HCT A;  2JMI A;  3O7A A;  3I2D A;  3EB5 A;  1CHC A;  3O37 A;  3SOX A;  4N4F A;  2QIC A;  4FO9 A;  1HYI A;  5B78 A;  4A49 A;  2KE1 A;  2YSM A;  2DX8 A;  4WZ0 A;  1WEM A;  3O36 A;  4QF2 A;  1IYM A;  3ZPV 1;  1WEV A;  4I7C A;  2FUU A;  4V3L C;  2CKL B;  4IC3 A;  2VPG A;  4W4U A;  3SHB A;  5AIT A;  2LGL A;  3ZVY A;  3LQH A;  3U5O A;  3ZYQ A;  2XB1 A;  5KH9 A;  5TAB A;  4C9Z A;  1HYJ A;  2YU4 A;  5FEY A;  4AUQ B;  4A0C D;  2LXH C;  2C2V S;  5B8D A;  4FJC A;  5B75 A;  4F52 B;  2LN0 A;  3HTK C;  4AYC A;  2CSZ A;  3LQJ A;  4BBQ A;  4B86 C;  2KU3 A;  3O34 A;  2KGI A;  1DVP A;  3ZVZ B;  2ECT A;  1WE9 A;  3NG2 A;  4BHW A;  4LKA A;  4CCG X;  1Z60 A;  2ZET C;  5LKU A;  2M85 A;  3KV6 A;  2JMJ A;  3GL6 A;  4YBM A;  5AIU A;  2YUC A;  3IHP A;  1RMD A;  4CA1 A;  3N9L A;  2D8S A;  2Y1M A;  4YAD A;  1JM7 A;  2H0D B;  1BOR A;  2MUM A;  2F6N A;  2JRJ A;  2KR4 A;  2YHO A;  3RPG B;  3RPG C;  2L80 A;  1JOC A;  2KFT A;  5B76 A;  3HCU A;  4ZQL A;  2G43 A;  2MIQ A;  2L43 A;  2G6Q A;  1WEQ A;  1U6G B;  3SOU A;  2KWJ A;  5TDR A;  4AYC B;  3LRQ A;  4PTB A;  1MM3 A;  2MT5 A;  2YQM A;  3ASL A;  3ZNI A;  2MNY A;  2LXP C;  3U5N A;  3GV4 A;  5H1T A;  4FK5 A;  3O70 A;  3KNV A;  2KWO A;  4R7E A;  3PUQ A;  2PUY A;  4ZDT A;  4N3W A;  5D1L B;  2YUR A;  2G45 A;  2EOD A;  2F42 A;  1JM7 B;  3C6W A;  5G04 B;  2YHN A;  2LQ6 A;  2QJ0 A;  1T1H A;  4MSX A;  2QIZ A;  3L1Z B;  3ZPV E;  2IDA A;  1K2F A;  2L0B A;  1WGM A;  3M99 A;  2EGP A;  2KWK A;  3LQI A;  3N9P A;  2CKL A;  3KV5 A;  3RTR B;  5TRB A;  1F62 A;  5TDW A;  2YSJ A;  2KRE A;  2FUI A;  2VPB A;  3PHD A;  2VNF A;  4ZUX U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...