2YHOA

The idol-ube2d complex mediates sterol-dependent degradation of the ldl receptor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
b'RVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYLPTHTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MYLIP
publication title The Idol-Ube2D Complex Mediates Sterol-Dependent Degradation of the Ldl Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 16
structure length 67
sequence length 67
chains with identical sequence C, E, G
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yhoA00
2KWKA 1RMDA 3RPGC 3HCSA 2QJ0A 3KV6A 4R2YA 2KR4A 3PHDA 3L1XA 5TBNA 2LRIC 2KREA 2MA6A 1X4JA 3MHHA 2ZETC 2KWOA 4X3GA 2JMJA 1XWHA 4Q6FA 4ZUXU 2K16A 4GNGA 2CKLA 2LV9A 3ASLA 4ZDTA 2DX8A 4AP4A 2M6MA 3SOXA 4GNEA 5B77A 1WILA 3ZNIA 5H1TA 4AUQB 1WEQA 5G0FA 4MVTA 2L0BA 4L7XA 4AYCB 4YATA 5J3XA 1WEUA 5KH9A 1G25A 2VNFA 2MNZA 2E6RA 2ECJA 4N3WA 3FL2A 4YBSA 2VJFA 4PTBA 1T1HA 4GNFA 1WESA 3ZTGA 2MNYA 1WEWA 5LCWB 4FK5A 3HTKC 1Z6UA 2G45A 2OXQC 4FO9A 3SOUA 3N9NA 2KYUA 2KE1A 5C11A 3VK6A 3N9MA 2KWNA 3SOWA 2VPBA 2ECGA 2CT2A 2K4DA 5AIUA 5G04B 4B7YC 2L5UA 4QF3A 5B78A 1WFKA 4FJCA 4YBTA 5TRBA 3HCTA 4WZ0A 3N9LA 2AN6A 3ZPV1 5H9MA 2MD7B 2KWJA 2YQMA 1BORA 4N4FA 1WEPA 4BBQA 1MM2A 2FUUA 1Z60A 5LKZA 5I3LA 4WZ3B 4GB0A 2VPEA 4AVXA 4L58A 3LQHA 2XEUA 3T6RA 3I2DA 1WIMA 2ECWA 3DQVR 2YT5A 3O37A 2MIQA 4IC3A 2L43A 2YQLA 1WENA 2FSAA 2KGGA 3DPLR 2E6SA 3U5PA 4CA1A 2K1JA 2EA6A 4O64A 2H0DA 5FB1A 2H0DB 2CKLB 3QZVA 4LKAA 3PUQA 2ECVA 5DKAA 1N87A 1FP0A 1LDKC 1CHCA 2ECIA 5DINA 4BHWA 1FBVA 2YW8A 3ZVYA 5LKTA 1DVPA 5B79A 3ZPVE 5B76A 3RTRB 2EGPA 4UP0A 4V3LC 1WGMA 2VPDA 5G05B 4B86C 2KIZA 5TABA 4LLBA 4LADB 2VJFB 4YADA 1IYMA 2XB1A 2JRJA 2YREA 4I7DA 2LGVA 5D1KB 3NG2A 4W4UA 3EB5A 2Y1MA 2LN0A 1U6GB 4GNDA 3O33A 3L1ZB 4F52B 1ZBDB 5TDWA 5FEYA 1WEMA 2MUMA 5FB0A 2ECTA 3M99A 3KNVA 3O7AA 2YU4A 2BAYA 2F42A 2I50A 4LJNA 2VPGA 2VP7A 1VYXA 2LXPC 5D1LB 2YSMA 4UP5A 4A49A 2MA5A 2JMIA 3SHBA 2C2VS 4S3OB 4ZQLA 2KFTA 1LDJB 2D8SA 3IHPA 1X4IA 4NN2A 5B8DA 3U5OA 2HDPA 3C6WA 3PURA 3LRQA 4YABA 3LQJA 2ECNA 3N9OA 2MD8C 3O70A 3KV5A 2CSZA 1E4UA 4A4BA 1JM7A 4QF2A 2L75A 1JM7B 4FIPA 5KH3A 3HCUA 1VFYA 4UI9B 2UZGA 3C5KA 4R7EA 4I7BA 4V3KC 3V43A 2M85A 5B75A 2IDAA 3T7LA 1WEVA 5H1VA 5H1UA 2FUIA 2CSYA 5KH7A 4YC9A 2F6JA 1WEEA 5JG6A 2KU3A 4C9ZA 5D1MB 2RSDA 2YYRA 3KQIA 3GV4A 3O34A 2PUYA 2NAAA 3EB6A 2VJEA 2VJEB 3N9PA 3O36A 2M1RA 3LQIA 5EYAF 4LK9A 1JOCA 2LGLA 4XI1A 3MHSA 2EODA 3U5MA 5AITA 1K2FA 1Z2QA 2YUCA 3N9QA 4PPEA 4AYCA 2G43A 2YURA 1HYIA 4WA6A 4CCGX 2K17A 3GL6A 4YBMA 3O35A 3M62A 3ZYQA 2YHOA 5LKUA 1X4UA 2LGGA 4WZ2A 1MM3A 2MT5A 3L11A 2JMDA 5FERA 2G6QA 2HYED 4YAXA 3U5NA 4I7CA 2QICA 2YSJA 4R8PK 1WE9A 2LQ6A 2PNXA 4IC2A 2LXHC 2L80A 4P5OB 1HYJA 2Y43A 3M63A 3RPGB 4TKPB 2QIZA 2LDRA 2M3HA 1F62A 2KGIA 3ZVZB 2F6NA 4A0CD 2YHNA 2LGKA 5LKXA 2C2LA 4MSXA 1VD4A 4A4CA 1WEOA 5C13A 2RI7A 5TDRA 4S3OC 1V87A 2Y1NA
chains in the Genus database with same CATH superfamily
2M13A 2KWKA 1RMDA 2MKEA 3RPGC 3HCSA 2QJ0A 3KV6A 4R2YA 2D8UA 2KR4A 2CRRA 3PHDA 3L1XA 5TBNA 2LRIC 2KREA 2MA6A 1X4JA 3MHHA 2ZETC 2KWOA 4X3GA 2JMJA 1XWHA 5SVXA 4Q6FA 4QQ4A 4ZUXU 2K16A 4GNGA 2CKLA 2YVRA 2LV9A 3ASLA 4ZDTA 2DX8A 4AP4A 2M6MA 3SOXA 4GNEA 5B77A 1WILA 2E61A 3ZNIA 5H1TA 4AUQB 1WEQA 5G0FA 4MVTA 2L0BA 4L7XA 4AYCB 4YATA 5J3XA 1WEUA 5KH9A 1G25A 2VNFA 2EXUA 2MNZA 2E6RA 2ECJA 4N3WA 3FL2A 4YBSA 2VJFA 4PTBA 1T1HA 4GNFA 1WESA 2LAUA 3ZTGA 2MNYA 1WEWA 5LCWB 4FK5A 3HTKC 3Q1DA 1Z6UA 2G45A 2OXQC 4FO9A 3SOUA 3N9NA 2KYUA 2KE1A 5C11A 3FAOA 3VK6A 2XP0A 2KWNA 3N9MA 3SOWA 2VPBA 4H9DA 2ECGA 2CT2A 2K4DA 5AIUA 5G04B 3LVQE 4B7YC 2L5UA 2OWAA 4F1PA 3JUEA 4QF3A 5B78A 2XOCA 2KKYA 1WFKA 4FJCA 4YBTA 5TRBA 3HCTA 4WZ0A 3O47A 2P57A 3N9LA 1MBMA 2AN6A 3ZPV1 5H9MA 2MD7B 2KWJA 2YQMA 1BORA 4N4FA 1WEPA 4BBQA 1MM2A 2FUUA 1Z60A 5LKZA 5I3LA 4WZ3B 4GB0A 2VPEA 4AVXA 4L58A 2XOYA 3LQHA 2XEUA 4OGCA 3T6RA 3I2DA 1WIMA 2ECWA 3DQVR 2YT5A 3O37A 2IQJA 3T9KA 2MIQA 4IC3A 2L43A 4Z0RA 2YQLA 1WENA 2FSAA 2KGGA 3DPLR 2E6SA 3U5PA 4CA1A 2K1JA 2EA6A 4O64A 2H0DA 5FB1A 2H0DB 2CKLB 3QZVA 4LKAA 3FM8C 3PUQA 2ECVA 5DKAA 1N87A 1FP0A 1LDKC 1CHCA 2XOZA 2ECIA 5DINA 4BHWA 1FBVA 2YW8A 3ZVYA 5LKTA 1DVPA 4O62A 5B79A 3ZPVE 5B76A 3RTRB 2EGPA 4UP0A 4V3LC 1WGMA 3SUBA 2VPDA 5G05B 4B86C 2KIZA 5TABA 4LLBA 4LADB 2VJFB 4YADA 1IYMA 2XB1A 2JRJA 2YREA 4I7DA 2LGVA 5D1KB 3NG2A 4W4UA 3EB5A 2Y1MA 2LN0A 1U6GB 4GNDA 3O33A 3L1ZB 4F52B 1ZBDB 2CONA 5TDWA 5FEYA 1WEMA 3FANA 2MUMA 5FB0A 2ECTA 3M99A 3KNVA 3O7AA 2YU4A 2BAYA 2F42A 2I50A 4LJNA 5SVYA 2VPGA 2VP7A 1VYXA 2LXPC 5D1LB 2YSMA 3H7HA 4UP5A 2DSMA 4A49A 2MA5A 2JMIA 3KDEC 3SHBA 2C2VS 2JUNA 3LJUX 4S3OB 4ZQLA 2KFTA 3M7KA 4Z0OA 1LDJB 2D8SA 3IHPA 1X4IA 4NN2A 5B8DA 3U5OA 2HDPA 3C6WA 3PURA 3LRQA 4YABA 3LQJA 2ECNA 3N9OA 3DWDA 2MD8C 3O70A 3KV5A 2CSZA 2CSVA 4A4BA 1E4UA 4QF2A 1JM7A 2L75A 1JM7B 4FIPA 5KH3A 3HCUA 1VFYA 4UI9B 2UZGA 3C5KA 4R7EA 2KKXA 4I7BA 4V3KC 3V43A 3FJUB 2M85A 5B75A 2IDAA 3T7LA 1WEVA 5H1VA 5H1UA 2FFWA 2FUIA 2CSYA 5KH7A 4YC9A 3E2DA 2F6JA 1WEEA 5JG6A 2KU3A 4C9ZA 3LVRE 5D1MB 2RSDA 2YYRA 3KQIA 3GV4A 2DJAA 3O34A 2PUYA 5K3QA 2NAAA 3EB6A 2VJEA 2VJEB 3N9PA 3O36A 2M1RA 3LQIA 5EYAF 4LK9A 1JOCA 2LGLA 4XI1A 3MHSA 2EODA 3U5MA 5AITA 3MDBC 1K2FA 1Z2QA 2YUCA 3N9QA 4PPEA 4AYCA 2G43A 2YURA 1HYIA 4WA6A 4OGEA 3FEHA 4CCGX 2K17A 3GL6A 4YBMA 3DDTA 3O35A 3M62A 2B0OE 3ZYQA 2YHOA 5LKUA 1X4UA 2LGGA 4WZ2A 1MM3A 2MT5A 3L11A 2EGMA 2JMDA 2L7PA 5FERA 2G6QA 2HYED 4YAXA 3U5NA 4I7CA 2QICA 2YSJA 4R8PK 1WE9A 2LQ6A 1DCQA 5SVIA 5SVIB 2PNXA 3LDYA 2RR4A 4IC2A 2LXHC 2L80A 2CRWA 4P5OB 1HYJA 3PLWA 2Y43A 2FD4A 3M63A 3RPGB 4TKPB 2QIZA 2LDRA 2M3HA 1F62A 2KGIA 3ZVZB 2F6NA 4A0CD 2YHNA 2LGKA 5LKXA 2C2LA 2JM3A 4MSXA 1VD4A 4A4CA 1WEOA 5C13A 2RI7A 5TDRA 4S3OC 1V87A 2Y1NA
chains in the Genus database with same CATH topology
2KWKA 1RMDA 3RPGC 3HCSA 2QJ0A 3KV6A 4R2YA 2KR4A 3PHDA 3L1XA 5TBNA 2LRIC 2KREA 2MA6A 1X4JA 3MHHA 2ZETC 2KWOA 4X3GA 2JMJA 1XWHA 4Q6FA 4ZUXU 2K16A 4GNGA 2CKLA 2LV9A 3ASLA 4ZDTA 2DX8A 4AP4A 2M6MA 3SOXA 4GNEA 5B77A 1WILA 3ZNIA 5H1TA 4AUQB 1WEQA 5G0FA 4MVTA 2L0BA 4L7XA 4AYCB 4YATA 5J3XA 1WEUA 5KH9A 1G25A 2VNFA 2MNZA 2E6RA 2ECJA 4N3WA 3FL2A 4YBSA 2VJFA 4PTBA 1T1HA 4GNFA 1WESA 3ZTGA 2MNYA 1WEWA 5LCWB 4FK5A 3HTKC 1Z6UA 2G45A 2OXQC 4FO9A 3SOUA 3N9NA 2KYUA 2KE1A 5C11A 3VK6A 3N9MA 2KWNA 3SOWA 2VPBA 2ECGA 2CT2A 2K4DA 5AIUA 5G04B 4B7YC 2L5UA 4QF3A 5B78A 1WFKA 4FJCA 4YBTA 5TRBA 3HCTA 4WZ0A 3N9LA 2AN6A 3ZPV1 5H9MA 2MD7B 2KWJA 2YQMA 1BORA 4N4FA 1WEPA 4BBQA 1MM2A 2FUUA 1Z60A 5LKZA 5I3LA 4WZ3B 4GB0A 2VPEA 4AVXA 4L58A 3LQHA 2XEUA 3T6RA 3I2DA 1WIMA 2ECWA 3DQVR 2YT5A 3O37A 2MIQA 4IC3A 2L43A 2YQLA 1WENA 2FSAA 2KGGA 3DPLR 2E6SA 3U5PA 4CA1A 2K1JA 2EA6A 4O64A 2H0DA 5FB1A 2H0DB 2CKLB 3QZVA 4LKAA 3PUQA 2ECVA 5DKAA 1N87A 1FP0A 1LDKC 1CHCA 2ECIA 5DINA 4BHWA 1FBVA 2YW8A 3ZVYA 5LKTA 1DVPA 5B79A 3ZPVE 5B76A 3RTRB 2EGPA 4UP0A 4V3LC 1WGMA 2VPDA 5G05B 4B86C 2KIZA 5TABA 4LLBA 4LADB 2VJFB 4YADA 1IYMA 2XB1A 2JRJA 2YREA 4I7DA 2LGVA 5D1KB 3NG2A 4W4UA 3EB5A 2Y1MA 2LN0A 1U6GB 4GNDA 3O33A 3L1ZB 4F52B 1ZBDB 5TDWA 5FEYA 1WEMA 2MUMA 5FB0A 2ECTA 3M99A 3KNVA 3O7AA 2YU4A 2BAYA 2F42A 2I50A 4LJNA 2VPGA 2VP7A 1VYXA 2LXPC 5D1LB 2YSMA 4UP5A 4A49A 2MA5A 2JMIA 3SHBA 2C2VS 4S3OB 4ZQLA 2KFTA 1LDJB 2D8SA 3IHPA 1X4IA 4NN2A 5B8DA 3U5OA 2HDPA 3C6WA 3PURA 3LRQA 4YABA 3LQJA 2ECNA 3N9OA 2MD8C 3O70A 3KV5A 2CSZA 1E4UA 4A4BA 1JM7A 4QF2A 2L75A 1JM7B 4FIPA 5KH3A 3HCUA 1VFYA 4UI9B 2UZGA 3C5KA 4R7EA 4I7BA 4V3KC 3V43A 2M85A 5B75A 2IDAA 3T7LA 1WEVA 5H1VA 5H1UA 2FUIA 2CSYA 5KH7A 4YC9A 2F6JA 1WEEA 5JG6A 2KU3A 4C9ZA 5D1MB 2RSDA 2YYRA 3KQIA 3GV4A 3O34A 2PUYA 2NAAA 3EB6A 2VJEA 2VJEB 3N9PA 3O36A 2M1RA 3LQIA 5EYAF 4LK9A 1JOCA 2LGLA 4XI1A 3MHSA 2EODA 3U5MA 5AITA 1K2FA 1Z2QA 2YUCA 3N9QA 4PPEA 4AYCA 2G43A 2YURA 1HYIA 4WA6A 4CCGX 2K17A 3GL6A 4YBMA 3O35A 3M62A 3ZYQA 2YHOA 5LKUA 1X4UA 2LGGA 4WZ2A 1MM3A 2MT5A 3L11A 2JMDA 5FERA 2G6QA 2HYED 4YAXA 3U5NA 4I7CA 2QICA 2YSJA 4R8PK 1WE9A 2LQ6A 2PNXA 4IC2A 2LXHC 2L80A 4P5OB 1HYJA 2Y43A 3M63A 3RPGB 4TKPB 2QIZA 2LDRA 2M3HA 1F62A 2KGIA 3ZVZB 2F6NA 4A0CD 2YHNA 2LGKA 5LKXA 2C2LA 4MSXA 1VD4A 4A4CA 1WEOA 5C13A 2RI7A 5TDRA 4S3OC 1V87A 2Y1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWK A;  1RMD A;  3RPG C;  3HCS A;  2QJ0 A;  3KV6 A;  4R2Y A;  2KR4 A;  3PHD A;  3L1X A;  5TBN A;  2LRI C;  2KRE A;  2MA6 A;  1X4J A;  3MHH A;  2ZET C;  2KWO A;  4X3G A;  2JMJ A;  1XWH A;  4Q6F A;  4ZUX U;  2K16 A;  4GNG A;  2CKL A;  2LV9 A;  3ASL A;  4ZDT A;  2DX8 A;  4AP4 A;  2M6M A;  3SOX A;  4GNE A;  5B77 A;  1WIL A;  3ZNI A;  5H1T A;  4AUQ B;  1WEQ A;  5G0F A;  4MVT A;  2L0B A;  4L7X A;  4AYC B;  4YAT A;  5J3X A;  1WEU A;  5KH9 A;  1G25 A;  2VNF A;  2MNZ A;  2E6R A;  2ECJ A;  4N3W A;  3FL2 A;  4YBS A;  2VJF A;  4PTB A;  1T1H A;  4GNF A;  1WES A;  3ZTG A;  2MNY A;  1WEW A;  5LCW B;  4FK5 A;  3HTK C;  1Z6U A;  2G45 A;  2OXQ C;  4FO9 A;  3SOU A;  3N9N A;  2KYU A;  2KE1 A;  5C11 A;  3VK6 A;  3N9M A;  2KWN A;  3SOW A;  2VPB A;  2ECG A;  2CT2 A;  2K4D A;  5AIU A;  5G04 B;  4B7Y C;  2L5U A;  4QF3 A;  5B78 A;  1WFK A;  4FJC A;  4YBT A;  5TRB A;  3HCT A;  4WZ0 A;  3N9L A;  2AN6 A;  3ZPV 1;  5H9M A;  2MD7 B;  2KWJ A;  2YQM A;  1BOR A;  4N4F A;  1WEP A;  4BBQ A;  1MM2 A;  2FUU A;  1Z60 A;  5LKZ A;  5I3L A;  4WZ3 B;  4GB0 A;  2VPE A;  4AVX A;  4L58 A;  3LQH A;  2XEU A;  3T6R A;  3I2D A;  1WIM A;  2ECW A;  3DQV R;  2YT5 A;  3O37 A;  2MIQ A;  4IC3 A;  2L43 A;  2YQL A;  1WEN A;  2FSA A;  2KGG A;  3DPL R;  2E6S A;  3U5P A;  4CA1 A;  2K1J A;  2EA6 A;  4O64 A;  2H0D A;  5FB1 A;  2H0D B;  2CKL B;  3QZV A;  4LKA A;  3PUQ A;  2ECV A;  5DKA A;  1N87 A;  1FP0 A;  1LDK C;  1CHC A;  2ECI A;  5DIN A;  4BHW A;  1FBV A;  2YW8 A;  3ZVY A;  5LKT A;  1DVP A;  5B79 A;  3ZPV E;  5B76 A;  3RTR B;  2EGP A;  4UP0 A;  4V3L C;  1WGM A;  2VPD A;  5G05 B;  4B86 C;  2KIZ A;  5TAB A;  4LLB A;  4LAD B;  2VJF B;  4YAD A;  1IYM A;  2XB1 A;  2JRJ A;  2YRE A;  4I7D A;  2LGV A;  5D1K B;  3NG2 A;  4W4U A;  3EB5 A;  2Y1M A;  2LN0 A;  1U6G B;  4GND A;  3O33 A;  3L1Z B;  4F52 B;  1ZBD B;  5TDW A;  5FEY A;  1WEM A;  2MUM A;  5FB0 A;  2ECT A;  3M99 A;  3KNV A;  3O7A A;  2YU4 A;  2BAY A;  2F42 A;  2I50 A;  4LJN A;  2VPG A;  2VP7 A;  1VYX A;  2LXP C;  5D1L B;  2YSM A;  4UP5 A;  4A49 A;  2MA5 A;  2JMI A;  3SHB A;  2C2V S;  4S3O B;  4ZQL A;  2KFT A;  1LDJ B;  2D8S A;  3IHP A;  1X4I A;  4NN2 A;  5B8D A;  3U5O A;  2HDP A;  3C6W A;  3PUR A;  3LRQ A;  4YAB A;  3LQJ A;  2ECN A;  3N9O A;  2MD8 C;  3O70 A;  3KV5 A;  2CSZ A;  1E4U A;  4A4B A;  1JM7 A;  4QF2 A;  2L75 A;  1JM7 B;  4FIP A;  5KH3 A;  3HCU A;  1VFY A;  4UI9 B;  2UZG A;  3C5K A;  4R7E A;  4I7B A;  4V3K C;  3V43 A;  2M85 A;  5B75 A;  2IDA A;  3T7L A;  1WEV A;  5H1V A;  5H1U A;  2FUI A;  2CSY A;  5KH7 A;  4YC9 A;  2F6J A;  1WEE A;  5JG6 A;  2KU3 A;  4C9Z A;  5D1M B;  2RSD A;  2YYR A;  3KQI A;  3GV4 A;  3O34 A;  2PUY A;  2NAA A;  3EB6 A;  2VJE A;  2VJE B;  3N9P A;  3O36 A;  2M1R A;  3LQI A;  5EYA F;  4LK9 A;  1JOC A;  2LGL A;  4XI1 A;  3MHS A;  2EOD A;  3U5M A;  5AIT A;  1K2F A;  1Z2Q A;  2YUC A;  3N9Q A;  4PPE A;  4AYC A;  2G43 A;  2YUR A;  1HYI A;  4WA6 A;  4CCG X;  2K17 A;  3GL6 A;  4YBM A;  3O35 A;  3M62 A;  3ZYQ A;  2YHO A;  5LKU A;  1X4U A;  2LGG A;  4WZ2 A;  1MM3 A;  2MT5 A;  3L11 A;  2JMD A;  5FER A;  2G6Q A;  2HYE D;  4YAX A;  3U5N A;  4I7C A;  2QIC A;  2YSJ A;  4R8P K;  1WE9 A;  2LQ6 A;  2PNX A;  4IC2 A;  2LXH C;  2L80 A;  4P5O B;  1HYJ A;  2Y43 A;  3M63 A;  3RPG B;  4TKP B;  2QIZ A;  2LDR A;  2M3H A;  1F62 A;  2KGI A;  3ZVZ B;  2F6N A;  4A0C D;  2YHN A;  2LGK A;  5LKX A;  2C2L A;  4MSX A;  1VD4 A;  4A4C A;  1WEO A;  5C13 A;  2RI7 A;  5TDR A;  4S3O C;  1V87 A;  2Y1N A; 
#chains in the Genus database with same CATH topology
 2M13 A;  2KWK A;  1RMD A;  2MKE A;  3RPG C;  3HCS A;  2QJ0 A;  3KV6 A;  4R2Y A;  2D8U A;  2KR4 A;  2CRR A;  3PHD A;  3L1X A;  5TBN A;  2LRI C;  2KRE A;  2MA6 A;  1X4J A;  3MHH A;  2ZET C;  2KWO A;  4X3G A;  2JMJ A;  1XWH A;  5SVX A;  4Q6F A;  4QQ4 A;  4ZUX U;  2K16 A;  4GNG A;  2CKL A;  2YVR A;  2LV9 A;  3ASL A;  4ZDT A;  2DX8 A;  4AP4 A;  2M6M A;  3SOX A;  4GNE A;  5B77 A;  1WIL A;  2E61 A;  3ZNI A;  5H1T A;  4AUQ B;  1WEQ A;  5G0F A;  4MVT A;  2L0B A;  4L7X A;  4AYC B;  4YAT A;  5J3X A;  1WEU A;  5KH9 A;  1G25 A;  2VNF A;  2EXU A;  2MNZ A;  2E6R A;  2ECJ A;  4N3W A;  3FL2 A;  4YBS A;  2VJF A;  4PTB A;  1T1H A;  4GNF A;  1WES A;  2LAU A;  3ZTG A;  2MNY A;  1WEW A;  5LCW B;  4FK5 A;  3HTK C;  3Q1D A;  1Z6U A;  2G45 A;  2OXQ C;  4FO9 A;  3SOU A;  3N9N A;  2KYU A;  2KE1 A;  5C11 A;  3FAO A;  3VK6 A;  2XP0 A;  2KWN A;  3N9M A;  3SOW A;  2VPB A;  4H9D A;  2ECG A;  2CT2 A;  2K4D A;  5AIU A;  5G04 B;  3LVQ E;  4B7Y C;  2L5U A;  2OWA A;  4F1P A;  3JUE A;  4QF3 A;  5B78 A;  2XOC A;  2KKY A;  1WFK A;  4FJC A;  4YBT A;  5TRB A;  3HCT A;  4WZ0 A;  3O47 A;  2P57 A;  3N9L A;  1MBM A;  2AN6 A;  3ZPV 1;  5H9M A;  2MD7 B;  2KWJ A;  2YQM A;  1BOR A;  4N4F A;  1WEP A;  4BBQ A;  1MM2 A;  2FUU A;  1Z60 A;  5LKZ A;  5I3L A;  4WZ3 B;  4GB0 A;  2VPE A;  4AVX A;  4L58 A;  2XOY A;  3LQH A;  2XEU A;  4OGC A;  3T6R A;  3I2D A;  1WIM A;  2ECW A;  3DQV R;  2YT5 A;  3O37 A;  2IQJ A;  3T9K A;  2MIQ A;  4IC3 A;  2L43 A;  4Z0R A;  2YQL A;  1WEN A;  2FSA A;  2KGG A;  3DPL R;  2E6S A;  3U5P A;  4CA1 A;  2K1J A;  2EA6 A;  4O64 A;  2H0D A;  5FB1 A;  2H0D B;  2CKL B;  3QZV A;  4LKA A;  3FM8 C;  3PUQ A;  2ECV A;  5DKA A;  1N87 A;  1FP0 A;  1LDK C;  1CHC A;  2XOZ A;  2ECI A;  5DIN A;  4BHW A;  1FBV A;  2YW8 A;  3ZVY A;  5LKT A;  1DVP A;  4O62 A;  5B79 A;  3ZPV E;  5B76 A;  3RTR B;  2EGP A;  4UP0 A;  4V3L C;  1WGM A;  3SUB A;  2VPD A;  5G05 B;  4B86 C;  2KIZ A;  5TAB A;  4LLB A;  4LAD B;  2VJF B;  4YAD A;  1IYM A;  2XB1 A;  2JRJ A;  2YRE A;  4I7D A;  2LGV A;  5D1K B;  3NG2 A;  4W4U A;  3EB5 A;  2Y1M A;  2LN0 A;  1U6G B;  4GND A;  3O33 A;  3L1Z B;  4F52 B;  1ZBD B;  2CON A;  5TDW A;  5FEY A;  1WEM A;  3FAN A;  2MUM A;  5FB0 A;  2ECT A;  3M99 A;  3KNV A;  3O7A A;  2YU4 A;  2BAY A;  2F42 A;  2I50 A;  4LJN A;  5SVY A;  2VPG A;  2VP7 A;  1VYX A;  2LXP C;  5D1L B;  2YSM A;  3H7H A;  4UP5 A;  2DSM A;  4A49 A;  2MA5 A;  2JMI A;  3KDE C;  3SHB A;  2C2V S;  2JUN A;  3LJU X;  4S3O B;  4ZQL A;  2KFT A;  3M7K A;  4Z0O A;  1LDJ B;  2D8S A;  3IHP A;  1X4I A;  4NN2 A;  5B8D A;  3U5O A;  2HDP A;  3C6W A;  3PUR A;  3LRQ A;  4YAB A;  3LQJ A;  2ECN A;  3N9O A;  3DWD A;  2MD8 C;  3O70 A;  3KV5 A;  2CSZ A;  2CSV A;  4A4B A;  1E4U A;  4QF2 A;  1JM7 A;  2L75 A;  1JM7 B;  4FIP A;  5KH3 A;  3HCU A;  1VFY A;  4UI9 B;  2UZG A;  3C5K A;  4R7E A;  2KKX A;  4I7B A;  4V3K C;  3V43 A;  3FJU B;  2M85 A;  5B75 A;  2IDA A;  3T7L A;  1WEV A;  5H1V A;  5H1U A;  2FFW A;  2FUI A;  2CSY A;  5KH7 A;  4YC9 A;  3E2D A;  2F6J A;  1WEE A;  5JG6 A;  2KU3 A;  4C9Z A;  3LVR E;  5D1M B;  2RSD A;  2YYR A;  3KQI A;  3GV4 A;  2DJA A;  3O34 A;  2PUY A;  5K3Q A;  2NAA A;  3EB6 A;  2VJE A;  2VJE B;  3N9P A;  3O36 A;  2M1R A;  3LQI A;  5EYA F;  4LK9 A;  1JOC A;  2LGL A;  4XI1 A;  3MHS A;  2EOD A;  3U5M A;  5AIT A;  3MDB C;  1K2F A;  1Z2Q A;  2YUC A;  3N9Q A;  4PPE A;  4AYC A;  2G43 A;  2YUR A;  1HYI A;  4WA6 A;  4OGE A;  3FEH A;  4CCG X;  2K17 A;  3GL6 A;  4YBM A;  3DDT A;  3O35 A;  3M62 A;  2B0O E;  3ZYQ A;  2YHO A;  5LKU A;  1X4U A;  2LGG A;  4WZ2 A;  1MM3 A;  2MT5 A;  3L11 A;  2EGM A;  2JMD A;  2L7P A;  5FER A;  2G6Q A;  2HYE D;  4YAX A;  3U5N A;  4I7C A;  2QIC A;  2YSJ A;  4R8P K;  1WE9 A;  2LQ6 A;  1DCQ A;  5SVI A;  5SVI B;  2PNX A;  3LDY A;  2RR4 A;  4IC2 A;  2LXH C;  2L80 A;  2CRW A;  4P5O B;  1HYJ A;  3PLW A;  2Y43 A;  2FD4 A;  3M63 A;  3RPG B;  4TKP B;  2QIZ A;  2LDR A;  2M3H A;  1F62 A;  2KGI A;  3ZVZ B;  2F6N A;  4A0C D;  2YHN A;  2LGK A;  5LKX A;  2C2L A;  2JM3 A;  4MSX A;  1VD4 A;  4A4C A;  1WEO A;  5C13 A;  2RI7 A;  5TDR A;  4S3O C;  1V87 A;  2Y1N A; 
#chains in the Genus database with same CATH homology
 2KWK A;  1RMD A;  3RPG C;  3HCS A;  2QJ0 A;  3KV6 A;  4R2Y A;  2KR4 A;  3PHD A;  3L1X A;  5TBN A;  2LRI C;  2KRE A;  2MA6 A;  1X4J A;  3MHH A;  2ZET C;  2KWO A;  4X3G A;  2JMJ A;  1XWH A;  4Q6F A;  4ZUX U;  2K16 A;  4GNG A;  2CKL A;  2LV9 A;  3ASL A;  4ZDT A;  2DX8 A;  4AP4 A;  2M6M A;  3SOX A;  4GNE A;  5B77 A;  1WIL A;  3ZNI A;  5H1T A;  4AUQ B;  1WEQ A;  5G0F A;  4MVT A;  2L0B A;  4L7X A;  4AYC B;  4YAT A;  5J3X A;  1WEU A;  5KH9 A;  1G25 A;  2VNF A;  2MNZ A;  2E6R A;  2ECJ A;  4N3W A;  3FL2 A;  4YBS A;  2VJF A;  4PTB A;  1T1H A;  4GNF A;  1WES A;  3ZTG A;  2MNY A;  1WEW A;  5LCW B;  4FK5 A;  3HTK C;  1Z6U A;  2G45 A;  2OXQ C;  4FO9 A;  3SOU A;  3N9N A;  2KYU A;  2KE1 A;  5C11 A;  3VK6 A;  3N9M A;  2KWN A;  3SOW A;  2VPB A;  2ECG A;  2CT2 A;  2K4D A;  5AIU A;  5G04 B;  4B7Y C;  2L5U A;  4QF3 A;  5B78 A;  1WFK A;  4FJC A;  4YBT A;  5TRB A;  3HCT A;  4WZ0 A;  3N9L A;  2AN6 A;  3ZPV 1;  5H9M A;  2MD7 B;  2KWJ A;  2YQM A;  1BOR A;  4N4F A;  1WEP A;  4BBQ A;  1MM2 A;  2FUU A;  1Z60 A;  5LKZ A;  5I3L A;  4WZ3 B;  4GB0 A;  2VPE A;  4AVX A;  4L58 A;  3LQH A;  2XEU A;  3T6R A;  3I2D A;  1WIM A;  2ECW A;  3DQV R;  2YT5 A;  3O37 A;  2MIQ A;  4IC3 A;  2L43 A;  2YQL A;  1WEN A;  2FSA A;  2KGG A;  3DPL R;  2E6S A;  3U5P A;  4CA1 A;  2K1J A;  2EA6 A;  4O64 A;  2H0D A;  5FB1 A;  2H0D B;  2CKL B;  3QZV A;  4LKA A;  3PUQ A;  2ECV A;  5DKA A;  1N87 A;  1FP0 A;  1LDK C;  1CHC A;  2ECI A;  5DIN A;  4BHW A;  1FBV A;  2YW8 A;  3ZVY A;  5LKT A;  1DVP A;  5B79 A;  3ZPV E;  5B76 A;  3RTR B;  2EGP A;  4UP0 A;  4V3L C;  1WGM A;  2VPD A;  5G05 B;  4B86 C;  2KIZ A;  5TAB A;  4LLB A;  4LAD B;  2VJF B;  4YAD A;  1IYM A;  2XB1 A;  2JRJ A;  2YRE A;  4I7D A;  2LGV A;  5D1K B;  3NG2 A;  4W4U A;  3EB5 A;  2Y1M A;  2LN0 A;  1U6G B;  4GND A;  3O33 A;  3L1Z B;  4F52 B;  1ZBD B;  5TDW A;  5FEY A;  1WEM A;  2MUM A;  5FB0 A;  2ECT A;  3M99 A;  3KNV A;  3O7A A;  2YU4 A;  2BAY A;  2F42 A;  2I50 A;  4LJN A;  2VPG A;  2VP7 A;  1VYX A;  2LXP C;  5D1L B;  2YSM A;  4UP5 A;  4A49 A;  2MA5 A;  2JMI A;  3SHB A;  2C2V S;  4S3O B;  4ZQL A;  2KFT A;  1LDJ B;  2D8S A;  3IHP A;  1X4I A;  4NN2 A;  5B8D A;  3U5O A;  2HDP A;  3C6W A;  3PUR A;  3LRQ A;  4YAB A;  3LQJ A;  2ECN A;  3N9O A;  2MD8 C;  3O70 A;  3KV5 A;  2CSZ A;  1E4U A;  4A4B A;  1JM7 A;  4QF2 A;  2L75 A;  1JM7 B;  4FIP A;  5KH3 A;  3HCU A;  1VFY A;  4UI9 B;  2UZG A;  3C5K A;  4R7E A;  4I7B A;  4V3K C;  3V43 A;  2M85 A;  5B75 A;  2IDA A;  3T7L A;  1WEV A;  5H1V A;  5H1U A;  2FUI A;  2CSY A;  5KH7 A;  4YC9 A;  2F6J A;  1WEE A;  5JG6 A;  2KU3 A;  4C9Z A;  5D1M B;  2RSD A;  2YYR A;  3KQI A;  3GV4 A;  3O34 A;  2PUY A;  2NAA A;  3EB6 A;  2VJE A;  2VJE B;  3N9P A;  3O36 A;  2M1R A;  3LQI A;  5EYA F;  4LK9 A;  1JOC A;  2LGL A;  4XI1 A;  3MHS A;  2EOD A;  3U5M A;  5AIT A;  1K2F A;  1Z2Q A;  2YUC A;  3N9Q A;  4PPE A;  4AYC A;  2G43 A;  2YUR A;  1HYI A;  4WA6 A;  4CCG X;  2K17 A;  3GL6 A;  4YBM A;  3O35 A;  3M62 A;  3ZYQ A;  2YHO A;  5LKU A;  1X4U A;  2LGG A;  4WZ2 A;  1MM3 A;  2MT5 A;  3L11 A;  2JMD A;  5FER A;  2G6Q A;  2HYE D;  4YAX A;  3U5N A;  4I7C A;  2QIC A;  2YSJ A;  4R8P K;  1WE9 A;  2LQ6 A;  2PNX A;  4IC2 A;  2LXH C;  2L80 A;  4P5O B;  1HYJ A;  2Y43 A;  3M63 A;  3RPG B;  4TKP B;  2QIZ A;  2LDR A;  2M3H A;  1F62 A;  2KGI A;  3ZVZ B;  2F6N A;  4A0C D;  2YHN A;  2LGK A;  5LKX A;  2C2L A;  4MSX A;  1VD4 A;  4A4C A;  1WEO A;  5C13 A;  2RI7 A;  5TDR A;  4S3O C;  1V87 A;  2Y1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...