2KGGA

Solution structure of jarid1a c-terminal phd finger
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
52
structure length
52
Chain Sequence
b'SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone demethylase JARID1A
publication title Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 6
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kggA00
3U5PA 3LQJA 4S3OC 4YBSA 3O37A 2D8SA 5B77A 2ECIA 2YHNA 4QF2A 2KU3A 2YYRA 2EA6A 3KQIA 2ECVA 2QIZA 2MA5A 5KH9A 3EB5A 4LKAA 2KWKA 3MHSA 5B8DA 2KE1A 1WEEA 3SHBA 3IHPA 2FSAA 2XB1A 3HCUA 5FB0A 1WEUA 2Y1MA 3L1ZB 3ZPV1 2LXHC 2K16A 2M6MA 2F6NA 2M85A 3RTRB 3RPGC 4FK5A 3O33A 5AIUA 2LDRA 5G05B 4AVXA 4L7XA 2G45A 3T6RA 4BBQA 4AUQB 1WE9A 2JRJA 3ASLA 3C6WA 4GNGA 2KYUA 3VK6A 2VPBA 2VJEA 2CT2A 2KGIA 2CSZA 3V43A 1WEQA 1JM7A 2LGKA 4ZUXU 2C2LA 5KH3A 2YQMA 2L0BA 5TDRA 3HCSA 4N4FA 5B76A 4FIPA 4WZ2A 1WEOA 1F62A 2G43A 4S3OB 5KH7A 4V3KC 4MSXA 2H0DB 2PUYA 5TDWA 5LKTA 4CCGX 2YREA 4LLBA 2JMJA 1WFKA 3KV6A 3SOWA 2AN6A 4IC3A 2KIZA 4Q6FA 3GV4A 2NAAA 2YSJA 1MM3A 1VD4A 3L11A 1Z60A 1K2FA 3ZVZB 1WEPA 1JOCA 1HYIA 5LCWB 3RPGB 2L43A 1MM2A 2XEUA 2HDPA 5H1TA 2YW8A 4V3LC 3FL2A 5C11A 1IYMA 3N9MA 2VPGA 2KWJA 4PPEA 5LKZA 2VJEB 2Y1NA 1FP0A 1JM7B 2JMIA 2KR4A 4I7CA 4A4BA 4R8PK 3NG2A 2K17A 1WESA 4YBMA 4WZ3B 2LN0A 3KV5A 1LDKC 5G04B 1CHCA 2YT5A 3N9LA 5FERA 1FBVA 3N9QA 4GNFA 4YBTA 1T1HA 4ZQLA 5DKAA 3O36A 1WEMA 2M3HA 3PURA 5LKXA 3LQIA 3N9NA 2FUIA 3M62A 5LKUA 2VP7A 3ZPVE 5B75A 3O7AA 5D1LB 1WEWA 2PNXA 5B78A 2LGGA 2UZGA 4YATA 2ECWA 1E4UA 2KREA 2YSMA 4N3WA 4FJCA 3KNVA 3SOXA 4YAXA 5H9MA 3ZNIA 2MNZA 1DVPA 4AP4A 4YC9A 1WEVA 2MT5A 2HYED 3N9PA 4NN2A 2E6SA 2YU4A 5DINA 4YADA 2Y43A 2K4DA 2LQ6A 2I50A 2DX8A 4AYCA 4PTBA 2FUUA 4MVTA 4LADB 1BORA 1VFYA 5TABA 2ECNA 3O70A 2MD8C 3U5OA 2MIQA 3U5NA 2CKLA 2ECJA 4GNEA 1Z6UA 2JMDA 5B79A 1HYJA 4I7DA 4GB0A 2LGLA 4YABA 3SOUA 4L58A 3L1XA 3ZTGA 1U6GB 5FEYA 3PUQA 3MHHA 3LRQA 3LQHA 2KGGA 4GNDA 3HTKC 1WILA 3QZVA 3DQVR 4FO9A 5J3XA 4WA6A 5D1KB 4LK9A 2RSDA 2EGPA 5TRBA 3ZYQA 2F42A 2H0DA 5H1VA 5G0FA 4R7EA 2ECGA 3GL6A 4B7YC 2LXPC 1XWHA 4QF3A 1X4JA 4UP0A 3T7LA 4AYCB 4F52B 1V87A 4O64A 5I3LA 2VPDA 2LGVA 5JG6A 2YUCA 5D1MB 4XI1A 2ECTA 2YHOA 1Z2QA 2LV9A 2EODA 4TKPB 4W4UA 3M63A 2YURA 2QJ0A 4A0CD 2CKLB 2G6QA 3N9OA 2MD7B 2VJFA 4IC2A 2RI7A 2KFTA 3DPLR 5EYAF 3C5KA 1VYXA 2QICA 2LRIC 5TBNA 2MNYA 4X3GA 5C13A 1WGMA 2ZETC 3O34A 3ZVYA 2BAYA 5H1UA 2OXQC 2E6RA 1G25A 4UI9B 2KWNA 2C2VS 5FB1A 1X4IA 1WIMA 2M1RA 2L80A 2L75A 2VPEA 3EB6A 4WZ0A 4UP5A 2VNFA 2IDAA 4A4CA 3I2DA 2CSYA 4LJNA 4BHWA 4P5OB 4C9ZA 3M99A 3O35A 1RMDA 2KWOA 2K1JA 1X4UA 2MA6A 4CA1A 2YQLA 4A49A 1WENA 3PHDA 1N87A 2F6JA 2L5UA 4I7BA 2MUMA 5AITA 1ZBDB 3U5MA 3HCTA 4R2YA 4B86C 4ZDTA 1LDJB 2VJFB
chains in the Genus database with same CATH superfamily
3U5PA 3LQJA 4S3OC 4YBSA 3O37A 2D8SA 3M7KA 5B77A 2ECIA 2YHNA 4QF2A 2KU3A 2YYRA 2EA6A 3KQIA 2ECVA 2QIZA 2MA5A 5KH9A 3EB5A 4LKAA 2KWKA 3MHSA 3FAOA 5B8DA 2KE1A 1WEEA 3SHBA 3IHPA 2FSAA 2XB1A 3HCUA 2XOZA 5FB0A 1WEUA 2Y1MA 3L1ZB 3ZPV1 2LXHC 2K16A 2M6MA 2F6NA 2M85A 3RTRB 2XOYA 3RPGC 4QQ4A 4FK5A 3O33A 2D8UA 5AIUA 2LDRA 5G05B 4AVXA 4L7XA 2G45A 3T6RA 4BBQA 4AUQB 1WE9A 2JRJA 3LVRE 3ASLA 3C6WA 4GNGA 2KYUA 3VK6A 2VPBA 2VJEA 2CT2A 2KGIA 2CSZA 3V43A 1WEQA 1JM7A 2LGKA 4ZUXU 2C2LA 5KH3A 2YQMA 2L0BA 5TDRA 3HCSA 4N4FA 5B76A 4FIPA 2M13A 4WZ2A 2RR4A 4Z0RA 1WEOA 1F62A 2G43A 4S3OB 5KH7A 4V3KC 4MSXA 2H0DB 2PUYA 5TDWA 5LKTA 4CCGX 3KDEC 4ZDTA 2YREA 4LLBA 2JMJA 1WFKA 3KV6A 3SOWA 2AN6A 4IC3A 2KIZA 5SVIA 2FD4A 4Q6FA 3GV4A 2NAAA 2YSJA 1MM3A 1VD4A 3L11A 1Z60A 5K3QA 1K2FA 3ZVZB 1WEPA 1JOCA 1HYIA 4O62A 5LCWB 3RPGB 2YVRA 2L43A 1MM2A 2XEUA 2HDPA 5H1TA 2MKEA 2YW8A 4V3LC 3FL2A 5C11A 1IYMA 3N9MA 2VPGA 2KWJA 4PPEA 5LKZA 2VJEB 2Y1NA 2EGMA 1FP0A 1JM7B 2JMIA 5SVYA 2KR4A 4I7CA 4A4BA 4R8PK 3NG2A 2K17A 1WESA 4YBMA 4WZ3B 2LN0A 3KV5A 1LDKC 3LDYA 5G04B 1CHCA 2YT5A 3N9LA 2OWAA 5FERA 1FBVA 3N9QA 5SVIB 4GNFA 4YBTA 1T1HA 2LAUA 5DKAA 4ZQLA 3O36A 1WEMA 3LVQE 3JUEA 2M3HA 2KKXA 3PURA 5LKXA 2XP0A 3LQIA 3N9NA 2FUIA 3M62A 5LKUA 2VP7A 3ZPVE 3DDTA 3O7AA 5B75A 3DWDA 5D1LB 1WEWA 2CRRA 4F1PA 2PNXA 5B78A 2LGGA 2UZGA 4YATA 2ECWA 1E4UA 2KREA 2YSMA 4N3WA 4FJCA 4H9DA 3KNVA 3SOXA 4YAXA 5H9MA 3ZNIA 2MNZA 1DVPA 4AP4A 4YC9A 1WEVA 2MT5A 2HYED 3N9PA 4NN2A 2E6SA 2YU4A 5DINA 4YADA 3T9KA 2DSMA 2Y43A 2K4DA 2LQ6A 3FANA 2I50A 2DX8A 4AYCA 4PTBA 2FUUA 4MVTA 3PLWA 4LADB 2IQJA 1BORA 1VFYA 2CONA 2B0OE 5TABA 2ECNA 3O70A 2MD8C 3U5OA 2MIQA 3U5NA 2CKLA 2ECJA 4GNEA 1Z6UA 2JMDA 2FFWA 5B79A 1HYJA 4I7DA 2XOCA 4GB0A 2LGLA 4YABA 3SOUA 4L58A 3L1XA 1DCQA 3ZTGA 2CSVA 1U6GB 5FEYA 3PUQA 3FJUB 3MHHA 3LRQA 3LQHA 3FM8C 2KGGA 4GNDA 3HTKC 1WILA 3QZVA 3DQVR 4FO9A 5J3XA 4WA6A 5D1KB 4LK9A 2RSDA 2EGPA 5TRBA 3ZYQA 2F42A 2H0DA 5H1VA 5G0FA 4R7EA 2ECGA 4OGEA 3GL6A 4B7YC 2LXPC 1XWHA 4QF3A 1X4JA 4UP0A 3T7LA 4AYCB 4F52B 3E2DA 4OGCA 1V87A 4O64A 5I3LA 2VPDA 2LGVA 2DJAA 5JG6A 2YUCA 5D1MB 4XI1A 2ECTA 2YHOA 1Z2QA 2LV9A 2EODA 4TKPB 4W4UA 2KKYA 2E61A 3M63A 2YURA 2QJ0A 4A0CD 2CKLB 3LJUX 3H7HA 2G6QA 3N9OA 2MD7B 2VJFA 3Q1DA 4IC2A 2RI7A 2KFTA 3DPLR 5EYAF 3C5KA 1VYXA 2QICA 2LRIC 5TBNA 2MNYA 4X3GA 5SVXA 3FEHA 5C13A 2EXUA 1WGMA 2ZETC 3O34A 3MDBC 3ZVYA 2BAYA 5H1UA 2OXQC 2E6RA 2L7PA 1G25A 4UI9B 2KWNA 2C2VS 5FB1A 1X4IA 1WIMA 4Z0OA 1MBMA 2M1RA 2L80A 2L75A 2VPEA 3EB6A 4WZ0A 4UP5A 2VNFA 2IDAA 4A4CA 3I2DA 2CSYA 4LJNA 4BHWA 2CRWA 4P5OB 4C9ZA 3M99A 3O35A 1RMDA 2KWOA 2K1JA 3SUBA 1X4UA 2MA6A 4CA1A 2YQLA 4A49A 1WENA 3O47A 3PHDA 2JM3A 1N87A 2F6JA 2L5UA 4I7BA 2MUMA 5AITA 1ZBDB 3U5MA 2P57A 2JUNA 4R2YA 4B86C 3HCTA 1LDJB 2VJFB
chains in the Genus database with same CATH topology
3U5PA 3LQJA 4S3OC 4YBSA 3O37A 2D8SA 5B77A 2ECIA 2YHNA 4QF2A 2KU3A 2YYRA 2EA6A 3KQIA 2ECVA 2QIZA 2MA5A 5KH9A 3EB5A 4LKAA 2KWKA 3MHSA 5B8DA 2KE1A 1WEEA 3SHBA 3IHPA 2FSAA 2XB1A 3HCUA 5FB0A 1WEUA 2Y1MA 3L1ZB 3ZPV1 2LXHC 2K16A 2M6MA 2F6NA 2M85A 3RTRB 3RPGC 4FK5A 3O33A 5AIUA 2LDRA 5G05B 4AVXA 4L7XA 2G45A 3T6RA 4BBQA 4AUQB 1WE9A 2JRJA 3ASLA 3C6WA 4GNGA 2KYUA 3VK6A 2VPBA 2VJEA 2CT2A 2KGIA 2CSZA 3V43A 1WEQA 1JM7A 2LGKA 4ZUXU 2C2LA 5KH3A 2YQMA 2L0BA 5TDRA 3HCSA 4N4FA 5B76A 4FIPA 4WZ2A 1WEOA 1F62A 2G43A 4S3OB 5KH7A 4V3KC 4MSXA 2H0DB 2PUYA 5TDWA 5LKTA 4CCGX 2YREA 4LLBA 2JMJA 1WFKA 3KV6A 3SOWA 2AN6A 4IC3A 2KIZA 4Q6FA 3GV4A 2NAAA 2YSJA 1MM3A 1VD4A 3L11A 1Z60A 1K2FA 3ZVZB 1WEPA 1JOCA 1HYIA 5LCWB 3RPGB 2L43A 1MM2A 2XEUA 2HDPA 5H1TA 2YW8A 4V3LC 3FL2A 5C11A 1IYMA 3N9MA 2VPGA 2KWJA 4PPEA 5LKZA 2VJEB 2Y1NA 1FP0A 1JM7B 2JMIA 2KR4A 4I7CA 4A4BA 4R8PK 3NG2A 2K17A 1WESA 4YBMA 4WZ3B 2LN0A 3KV5A 1LDKC 5G04B 1CHCA 2YT5A 3N9LA 5FERA 1FBVA 3N9QA 4GNFA 4YBTA 1T1HA 4ZQLA 5DKAA 3O36A 1WEMA 2M3HA 3PURA 5LKXA 3LQIA 3N9NA 2FUIA 3M62A 5LKUA 2VP7A 3ZPVE 5B75A 3O7AA 5D1LB 1WEWA 2PNXA 5B78A 2LGGA 2UZGA 4YATA 2ECWA 1E4UA 2KREA 2YSMA 4N3WA 4FJCA 3KNVA 3SOXA 4YAXA 5H9MA 3ZNIA 2MNZA 1DVPA 4AP4A 4YC9A 1WEVA 2MT5A 2HYED 3N9PA 4NN2A 2E6SA 2YU4A 5DINA 4YADA 2Y43A 2K4DA 2LQ6A 2I50A 2DX8A 4AYCA 4PTBA 2FUUA 4MVTA 4LADB 1BORA 1VFYA 5TABA 2ECNA 3O70A 2MD8C 3U5OA 2MIQA 3U5NA 2CKLA 2ECJA 4GNEA 1Z6UA 2JMDA 5B79A 1HYJA 4I7DA 4GB0A 2LGLA 4YABA 3SOUA 4L58A 3L1XA 3ZTGA 1U6GB 5FEYA 3PUQA 3MHHA 3LRQA 3LQHA 2KGGA 4GNDA 3HTKC 1WILA 3QZVA 3DQVR 4FO9A 5J3XA 4WA6A 5D1KB 4LK9A 2RSDA 2EGPA 5TRBA 3ZYQA 2F42A 2H0DA 5H1VA 5G0FA 4R7EA 2ECGA 3GL6A 4B7YC 2LXPC 1XWHA 4QF3A 1X4JA 4UP0A 3T7LA 4AYCB 4F52B 1V87A 4O64A 5I3LA 2VPDA 2LGVA 5JG6A 2YUCA 5D1MB 4XI1A 2ECTA 2YHOA 1Z2QA 2LV9A 2EODA 4TKPB 4W4UA 3M63A 2YURA 2QJ0A 4A0CD 2CKLB 2G6QA 3N9OA 2MD7B 2VJFA 4IC2A 2RI7A 2KFTA 3DPLR 5EYAF 3C5KA 1VYXA 2QICA 2LRIC 5TBNA 2MNYA 4X3GA 5C13A 1WGMA 2ZETC 3O34A 3ZVYA 2BAYA 5H1UA 2OXQC 2E6RA 1G25A 4UI9B 2KWNA 2C2VS 5FB1A 1X4IA 1WIMA 2M1RA 2L80A 2L75A 2VPEA 3EB6A 4WZ0A 4UP5A 2VNFA 2IDAA 4A4CA 3I2DA 2CSYA 4LJNA 4BHWA 4P5OB 4C9ZA 3M99A 3O35A 1RMDA 2KWOA 2K1JA 1X4UA 2MA6A 4CA1A 2YQLA 4A49A 1WENA 3PHDA 1N87A 2F6JA 2L5UA 4I7BA 2MUMA 5AITA 1ZBDB 3U5MA 3HCTA 4R2YA 4B86C 4ZDTA 1LDJB 2VJFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5P A;  3LQJ A;  4S3O C;  4YBS A;  3O37 A;  2D8S A;  5B77 A;  2ECI A;  2YHN A;  4QF2 A;  2KU3 A;  2YYR A;  2EA6 A;  3KQI A;  2ECV A;  2QIZ A;  2MA5 A;  5KH9 A;  3EB5 A;  4LKA A;  2KWK A;  3MHS A;  5B8D A;  2KE1 A;  1WEE A;  3SHB A;  3IHP A;  2FSA A;  2XB1 A;  3HCU A;  5FB0 A;  1WEU A;  2Y1M A;  3L1Z B;  3ZPV 1;  2LXH C;  2K16 A;  2M6M A;  2F6N A;  2M85 A;  3RTR B;  3RPG C;  4FK5 A;  3O33 A;  5AIU A;  2LDR A;  5G05 B;  4AVX A;  4L7X A;  2G45 A;  3T6R A;  4BBQ A;  4AUQ B;  1WE9 A;  2JRJ A;  3ASL A;  3C6W A;  4GNG A;  2KYU A;  3VK6 A;  2VPB A;  2VJE A;  2CT2 A;  2KGI A;  2CSZ A;  3V43 A;  1WEQ A;  1JM7 A;  2LGK A;  4ZUX U;  2C2L A;  5KH3 A;  2YQM A;  2L0B A;  5TDR A;  3HCS A;  4N4F A;  5B76 A;  4FIP A;  4WZ2 A;  1WEO A;  1F62 A;  2G43 A;  4S3O B;  5KH7 A;  4V3K C;  4MSX A;  2H0D B;  2PUY A;  5TDW A;  5LKT A;  4CCG X;  2YRE A;  4LLB A;  2JMJ A;  1WFK A;  3KV6 A;  3SOW A;  2AN6 A;  4IC3 A;  2KIZ A;  4Q6F A;  3GV4 A;  2NAA A;  2YSJ A;  1MM3 A;  1VD4 A;  3L11 A;  1Z60 A;  1K2F A;  3ZVZ B;  1WEP A;  1JOC A;  1HYI A;  5LCW B;  3RPG B;  2L43 A;  1MM2 A;  2XEU A;  2HDP A;  5H1T A;  2YW8 A;  4V3L C;  3FL2 A;  5C11 A;  1IYM A;  3N9M A;  2VPG A;  2KWJ A;  4PPE A;  5LKZ A;  2VJE B;  2Y1N A;  1FP0 A;  1JM7 B;  2JMI A;  2KR4 A;  4I7C A;  4A4B A;  4R8P K;  3NG2 A;  2K17 A;  1WES A;  4YBM A;  4WZ3 B;  2LN0 A;  3KV5 A;  1LDK C;  5G04 B;  1CHC A;  2YT5 A;  3N9L A;  5FER A;  1FBV A;  3N9Q A;  4GNF A;  4YBT A;  1T1H A;  4ZQL A;  5DKA A;  3O36 A;  1WEM A;  2M3H A;  3PUR A;  5LKX A;  3LQI A;  3N9N A;  2FUI A;  3M62 A;  5LKU A;  2VP7 A;  3ZPV E;  5B75 A;  3O7A A;  5D1L B;  1WEW A;  2PNX A;  5B78 A;  2LGG A;  2UZG A;  4YAT A;  2ECW A;  1E4U A;  2KRE A;  2YSM A;  4N3W A;  4FJC A;  3KNV A;  3SOX A;  4YAX A;  5H9M A;  3ZNI A;  2MNZ A;  1DVP A;  4AP4 A;  4YC9 A;  1WEV A;  2MT5 A;  2HYE D;  3N9P A;  4NN2 A;  2E6S A;  2YU4 A;  5DIN A;  4YAD A;  2Y43 A;  2K4D A;  2LQ6 A;  2I50 A;  2DX8 A;  4AYC A;  4PTB A;  2FUU A;  4MVT A;  4LAD B;  1BOR A;  1VFY A;  5TAB A;  2ECN A;  3O70 A;  2MD8 C;  3U5O A;  2MIQ A;  3U5N A;  2CKL A;  2ECJ A;  4GNE A;  1Z6U A;  2JMD A;  5B79 A;  1HYJ A;  4I7D A;  4GB0 A;  2LGL A;  4YAB A;  3SOU A;  4L58 A;  3L1X A;  3ZTG A;  1U6G B;  5FEY A;  3PUQ A;  3MHH A;  3LRQ A;  3LQH A;  2KGG A;  4GND A;  3HTK C;  1WIL A;  3QZV A;  3DQV R;  4FO9 A;  5J3X A;  4WA6 A;  5D1K B;  4LK9 A;  2RSD A;  2EGP A;  5TRB A;  3ZYQ A;  2F42 A;  2H0D A;  5H1V A;  5G0F A;  4R7E A;  2ECG A;  3GL6 A;  4B7Y C;  2LXP C;  1XWH A;  4QF3 A;  1X4J A;  4UP0 A;  3T7L A;  4AYC B;  4F52 B;  1V87 A;  4O64 A;  5I3L A;  2VPD A;  2LGV A;  5JG6 A;  2YUC A;  5D1M B;  4XI1 A;  2ECT A;  2YHO A;  1Z2Q A;  2LV9 A;  2EOD A;  4TKP B;  4W4U A;  3M63 A;  2YUR A;  2QJ0 A;  4A0C D;  2CKL B;  2G6Q A;  3N9O A;  2MD7 B;  2VJF A;  4IC2 A;  2RI7 A;  2KFT A;  3DPL R;  5EYA F;  3C5K A;  1VYX A;  2QIC A;  2LRI C;  5TBN A;  2MNY A;  4X3G A;  5C13 A;  1WGM A;  2ZET C;  3O34 A;  3ZVY A;  2BAY A;  5H1U A;  2OXQ C;  2E6R A;  1G25 A;  4UI9 B;  2KWN A;  2C2V S;  5FB1 A;  1X4I A;  1WIM A;  2M1R A;  2L80 A;  2L75 A;  2VPE A;  3EB6 A;  4WZ0 A;  4UP5 A;  2VNF A;  2IDA A;  4A4C A;  3I2D A;  2CSY A;  4LJN A;  4BHW A;  4P5O B;  4C9Z A;  3M99 A;  3O35 A;  1RMD A;  2KWO A;  2K1J A;  1X4U A;  2MA6 A;  4CA1 A;  2YQL A;  4A49 A;  1WEN A;  3PHD A;  1N87 A;  2F6J A;  2L5U A;  4I7B A;  2MUM A;  5AIT A;  1ZBD B;  3U5M A;  3HCT A;  4R2Y A;  4B86 C;  4ZDT A;  1LDJ B;  2VJF B; 
#chains in the Genus database with same CATH topology
 3U5P A;  3LQJ A;  4S3O C;  4YBS A;  3O37 A;  2D8S A;  3M7K A;  5B77 A;  2ECI A;  2YHN A;  4QF2 A;  2KU3 A;  2YYR A;  2EA6 A;  3KQI A;  2ECV A;  2QIZ A;  2MA5 A;  5KH9 A;  3EB5 A;  4LKA A;  2KWK A;  3MHS A;  3FAO A;  5B8D A;  2KE1 A;  1WEE A;  3SHB A;  3IHP A;  2FSA A;  2XB1 A;  3HCU A;  2XOZ A;  5FB0 A;  1WEU A;  2Y1M A;  3L1Z B;  3ZPV 1;  2LXH C;  2K16 A;  2M6M A;  2F6N A;  2M85 A;  3RTR B;  2XOY A;  3RPG C;  4QQ4 A;  4FK5 A;  3O33 A;  2D8U A;  5AIU A;  2LDR A;  5G05 B;  4AVX A;  4L7X A;  2G45 A;  3T6R A;  4BBQ A;  4AUQ B;  1WE9 A;  2JRJ A;  3LVR E;  3ASL A;  3C6W A;  4GNG A;  2KYU A;  3VK6 A;  2VPB A;  2VJE A;  2CT2 A;  2KGI A;  2CSZ A;  3V43 A;  1WEQ A;  1JM7 A;  2LGK A;  4ZUX U;  2C2L A;  5KH3 A;  2YQM A;  2L0B A;  5TDR A;  3HCS A;  4N4F A;  5B76 A;  4FIP A;  2M13 A;  4WZ2 A;  2RR4 A;  4Z0R A;  1WEO A;  1F62 A;  2G43 A;  4S3O B;  5KH7 A;  4V3K C;  4MSX A;  2H0D B;  2PUY A;  5TDW A;  5LKT A;  4CCG X;  3KDE C;  4ZDT A;  2YRE A;  4LLB A;  2JMJ A;  1WFK A;  3KV6 A;  3SOW A;  2AN6 A;  4IC3 A;  2KIZ A;  5SVI A;  2FD4 A;  4Q6F A;  3GV4 A;  2NAA A;  2YSJ A;  1MM3 A;  1VD4 A;  3L11 A;  1Z60 A;  5K3Q A;  1K2F A;  3ZVZ B;  1WEP A;  1JOC A;  1HYI A;  4O62 A;  5LCW B;  3RPG B;  2YVR A;  2L43 A;  1MM2 A;  2XEU A;  2HDP A;  5H1T A;  2MKE A;  2YW8 A;  4V3L C;  3FL2 A;  5C11 A;  1IYM A;  3N9M A;  2VPG A;  2KWJ A;  4PPE A;  5LKZ A;  2VJE B;  2Y1N A;  2EGM A;  1FP0 A;  1JM7 B;  2JMI A;  5SVY A;  2KR4 A;  4I7C A;  4A4B A;  4R8P K;  3NG2 A;  2K17 A;  1WES A;  4YBM A;  4WZ3 B;  2LN0 A;  3KV5 A;  1LDK C;  3LDY A;  5G04 B;  1CHC A;  2YT5 A;  3N9L A;  2OWA A;  5FER A;  1FBV A;  3N9Q A;  5SVI B;  4GNF A;  4YBT A;  1T1H A;  2LAU A;  5DKA A;  4ZQL A;  3O36 A;  1WEM A;  3LVQ E;  3JUE A;  2M3H A;  2KKX A;  3PUR A;  5LKX A;  2XP0 A;  3LQI A;  3N9N A;  2FUI A;  3M62 A;  5LKU A;  2VP7 A;  3ZPV E;  3DDT A;  3O7A A;  5B75 A;  3DWD A;  5D1L B;  1WEW A;  2CRR A;  4F1P A;  2PNX A;  5B78 A;  2LGG A;  2UZG A;  4YAT A;  2ECW A;  1E4U A;  2KRE A;  2YSM A;  4N3W A;  4FJC A;  4H9D A;  3KNV A;  3SOX A;  4YAX A;  5H9M A;  3ZNI A;  2MNZ A;  1DVP A;  4AP4 A;  4YC9 A;  1WEV A;  2MT5 A;  2HYE D;  3N9P A;  4NN2 A;  2E6S A;  2YU4 A;  5DIN A;  4YAD A;  3T9K A;  2DSM A;  2Y43 A;  2K4D A;  2LQ6 A;  3FAN A;  2I50 A;  2DX8 A;  4AYC A;  4PTB A;  2FUU A;  4MVT A;  3PLW A;  4LAD B;  2IQJ A;  1BOR A;  1VFY A;  2CON A;  2B0O E;  5TAB A;  2ECN A;  3O70 A;  2MD8 C;  3U5O A;  2MIQ A;  3U5N A;  2CKL A;  2ECJ A;  4GNE A;  1Z6U A;  2JMD A;  2FFW A;  5B79 A;  1HYJ A;  4I7D A;  2XOC A;  4GB0 A;  2LGL A;  4YAB A;  3SOU A;  4L58 A;  3L1X A;  1DCQ A;  3ZTG A;  2CSV A;  1U6G B;  5FEY A;  3PUQ A;  3FJU B;  3MHH A;  3LRQ A;  3LQH A;  3FM8 C;  2KGG A;  4GND A;  3HTK C;  1WIL A;  3QZV A;  3DQV R;  4FO9 A;  5J3X A;  4WA6 A;  5D1K B;  4LK9 A;  2RSD A;  2EGP A;  5TRB A;  3ZYQ A;  2F42 A;  2H0D A;  5H1V A;  5G0F A;  4R7E A;  2ECG A;  4OGE A;  3GL6 A;  4B7Y C;  2LXP C;  1XWH A;  4QF3 A;  1X4J A;  4UP0 A;  3T7L A;  4AYC B;  4F52 B;  3E2D A;  4OGC A;  1V87 A;  4O64 A;  5I3L A;  2VPD A;  2LGV A;  2DJA A;  5JG6 A;  2YUC A;  5D1M B;  4XI1 A;  2ECT A;  2YHO A;  1Z2Q A;  2LV9 A;  2EOD A;  4TKP B;  4W4U A;  2KKY A;  2E61 A;  3M63 A;  2YUR A;  2QJ0 A;  4A0C D;  2CKL B;  3LJU X;  3H7H A;  2G6Q A;  3N9O A;  2MD7 B;  2VJF A;  3Q1D A;  4IC2 A;  2RI7 A;  2KFT A;  3DPL R;  5EYA F;  3C5K A;  1VYX A;  2QIC A;  2LRI C;  5TBN A;  2MNY A;  4X3G A;  5SVX A;  3FEH A;  5C13 A;  2EXU A;  1WGM A;  2ZET C;  3O34 A;  3MDB C;  3ZVY A;  2BAY A;  5H1U A;  2OXQ C;  2E6R A;  2L7P A;  1G25 A;  4UI9 B;  2KWN A;  2C2V S;  5FB1 A;  1X4I A;  1WIM A;  4Z0O A;  1MBM A;  2M1R A;  2L80 A;  2L75 A;  2VPE A;  3EB6 A;  4WZ0 A;  4UP5 A;  2VNF A;  2IDA A;  4A4C A;  3I2D A;  2CSY A;  4LJN A;  4BHW A;  2CRW A;  4P5O B;  4C9Z A;  3M99 A;  3O35 A;  1RMD A;  2KWO A;  2K1J A;  3SUB A;  1X4U A;  2MA6 A;  4CA1 A;  2YQL A;  4A49 A;  1WEN A;  3O47 A;  3PHD A;  2JM3 A;  1N87 A;  2F6J A;  2L5U A;  4I7B A;  2MUM A;  5AIT A;  1ZBD B;  3U5M A;  2P57 A;  2JUN A;  4R2Y A;  4B86 C;  3HCT A;  1LDJ B;  2VJF B; 
#chains in the Genus database with same CATH homology
 3U5P A;  3LQJ A;  4S3O C;  4YBS A;  3O37 A;  2D8S A;  5B77 A;  2ECI A;  2YHN A;  4QF2 A;  2KU3 A;  2YYR A;  2EA6 A;  3KQI A;  2ECV A;  2QIZ A;  2MA5 A;  5KH9 A;  3EB5 A;  4LKA A;  2KWK A;  3MHS A;  5B8D A;  2KE1 A;  1WEE A;  3SHB A;  3IHP A;  2FSA A;  2XB1 A;  3HCU A;  5FB0 A;  1WEU A;  2Y1M A;  3L1Z B;  3ZPV 1;  2LXH C;  2K16 A;  2M6M A;  2F6N A;  2M85 A;  3RTR B;  3RPG C;  4FK5 A;  3O33 A;  5AIU A;  2LDR A;  5G05 B;  4AVX A;  4L7X A;  2G45 A;  3T6R A;  4BBQ A;  4AUQ B;  1WE9 A;  2JRJ A;  3ASL A;  3C6W A;  4GNG A;  2KYU A;  3VK6 A;  2VPB A;  2VJE A;  2CT2 A;  2KGI A;  2CSZ A;  3V43 A;  1WEQ A;  1JM7 A;  2LGK A;  4ZUX U;  2C2L A;  5KH3 A;  2YQM A;  2L0B A;  5TDR A;  3HCS A;  4N4F A;  5B76 A;  4FIP A;  4WZ2 A;  1WEO A;  1F62 A;  2G43 A;  4S3O B;  5KH7 A;  4V3K C;  4MSX A;  2H0D B;  2PUY A;  5TDW A;  5LKT A;  4CCG X;  2YRE A;  4LLB A;  2JMJ A;  1WFK A;  3KV6 A;  3SOW A;  2AN6 A;  4IC3 A;  2KIZ A;  4Q6F A;  3GV4 A;  2NAA A;  2YSJ A;  1MM3 A;  1VD4 A;  3L11 A;  1Z60 A;  1K2F A;  3ZVZ B;  1WEP A;  1JOC A;  1HYI A;  5LCW B;  3RPG B;  2L43 A;  1MM2 A;  2XEU A;  2HDP A;  5H1T A;  2YW8 A;  4V3L C;  3FL2 A;  5C11 A;  1IYM A;  3N9M A;  2VPG A;  2KWJ A;  4PPE A;  5LKZ A;  2VJE B;  2Y1N A;  1FP0 A;  1JM7 B;  2JMI A;  2KR4 A;  4I7C A;  4A4B A;  4R8P K;  3NG2 A;  2K17 A;  1WES A;  4YBM A;  4WZ3 B;  2LN0 A;  3KV5 A;  1LDK C;  5G04 B;  1CHC A;  2YT5 A;  3N9L A;  5FER A;  1FBV A;  3N9Q A;  4GNF A;  4YBT A;  1T1H A;  4ZQL A;  5DKA A;  3O36 A;  1WEM A;  2M3H A;  3PUR A;  5LKX A;  3LQI A;  3N9N A;  2FUI A;  3M62 A;  5LKU A;  2VP7 A;  3ZPV E;  5B75 A;  3O7A A;  5D1L B;  1WEW A;  2PNX A;  5B78 A;  2LGG A;  2UZG A;  4YAT A;  2ECW A;  1E4U A;  2KRE A;  2YSM A;  4N3W A;  4FJC A;  3KNV A;  3SOX A;  4YAX A;  5H9M A;  3ZNI A;  2MNZ A;  1DVP A;  4AP4 A;  4YC9 A;  1WEV A;  2MT5 A;  2HYE D;  3N9P A;  4NN2 A;  2E6S A;  2YU4 A;  5DIN A;  4YAD A;  2Y43 A;  2K4D A;  2LQ6 A;  2I50 A;  2DX8 A;  4AYC A;  4PTB A;  2FUU A;  4MVT A;  4LAD B;  1BOR A;  1VFY A;  5TAB A;  2ECN A;  3O70 A;  2MD8 C;  3U5O A;  2MIQ A;  3U5N A;  2CKL A;  2ECJ A;  4GNE A;  1Z6U A;  2JMD A;  5B79 A;  1HYJ A;  4I7D A;  4GB0 A;  2LGL A;  4YAB A;  3SOU A;  4L58 A;  3L1X A;  3ZTG A;  1U6G B;  5FEY A;  3PUQ A;  3MHH A;  3LRQ A;  3LQH A;  2KGG A;  4GND A;  3HTK C;  1WIL A;  3QZV A;  3DQV R;  4FO9 A;  5J3X A;  4WA6 A;  5D1K B;  4LK9 A;  2RSD A;  2EGP A;  5TRB A;  3ZYQ A;  2F42 A;  2H0D A;  5H1V A;  5G0F A;  4R7E A;  2ECG A;  3GL6 A;  4B7Y C;  2LXP C;  1XWH A;  4QF3 A;  1X4J A;  4UP0 A;  3T7L A;  4AYC B;  4F52 B;  1V87 A;  4O64 A;  5I3L A;  2VPD A;  2LGV A;  5JG6 A;  2YUC A;  5D1M B;  4XI1 A;  2ECT A;  2YHO A;  1Z2Q A;  2LV9 A;  2EOD A;  4TKP B;  4W4U A;  3M63 A;  2YUR A;  2QJ0 A;  4A0C D;  2CKL B;  2G6Q A;  3N9O A;  2MD7 B;  2VJF A;  4IC2 A;  2RI7 A;  2KFT A;  3DPL R;  5EYA F;  3C5K A;  1VYX A;  2QIC A;  2LRI C;  5TBN A;  2MNY A;  4X3G A;  5C13 A;  1WGM A;  2ZET C;  3O34 A;  3ZVY A;  2BAY A;  5H1U A;  2OXQ C;  2E6R A;  1G25 A;  4UI9 B;  2KWN A;  2C2V S;  5FB1 A;  1X4I A;  1WIM A;  2M1R A;  2L80 A;  2L75 A;  2VPE A;  3EB6 A;  4WZ0 A;  4UP5 A;  2VNF A;  2IDA A;  4A4C A;  3I2D A;  2CSY A;  4LJN A;  4BHW A;  4P5O B;  4C9Z A;  3M99 A;  3O35 A;  1RMD A;  2KWO A;  2K1J A;  1X4U A;  2MA6 A;  4CA1 A;  2YQL A;  4A49 A;  1WEN A;  3PHD A;  1N87 A;  2F6J A;  2L5U A;  4I7B A;  2MUM A;  5AIT A;  1ZBD B;  3U5M A;  3HCT A;  4R2Y A;  4B86 C;  4ZDT A;  1LDJ B;  2VJF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...