2KGGA

Solution structure of jarid1a c-terminal phd finger
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
52
structure length
52
Chain Sequence
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Histone demethylase JARID1A
total genus 6
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kggA00
1WEVA 3KV5A 1VYXA 4X3GA 4LJNA 2L0BA 3HCTA 2YQLA 1CHCA 2KGIA 2G43A 2JMDA 1BORA 2FUIA 4AUQB 2KIZA 3N9OA 2M3HA 3KNVA 2LXHC 3MHHA 5G04B 1WEWA 4NN2A 5G05B 1JOCA 5KH7A 3I2DA 2VJEA 3ZYQA 5LKUA 2EGPA 3PHDA 1FP0A 4YBSA 1RMDA 2M1RA 3LRQA 2ECWA 3ZVYA 4GNDA 4YBTA 4PPEA 1WEOA 2MNZA 2KREA 2LN0A 2VPGA 4P5OB 4S3OB 2K16A 1T1HA 1ZBDB 4FJCA 4C9ZA 5TABA 2KYUA 4AYCB 2BAYA 2KE1A 5LKTA 5H9MA 5TDWA 4YADA 3N9MA 2PUYA 5B75A 3ASLA 3N9NA 2MIQA 3O36A 5DINA 3RPGB 2Y1NA 2YHOA 3T6RA 2JRJA 1X4JA 4BHWA 4UP0A 1VD4A 1JM7A 2ECTA 4GB0A 2K1JA 3SOUA 2LGVA 4MSXA 4N3WA 2ECGA 4XI1A 3DQVR 3N9LA 2NAAA 2CSYA 2F6NA 2MUMA 4LKAA 5D1LB 5EYAF 2L80A 4I7BA 4I7CA 2C2LA 3O34A 2YYRA 2L75A 5LCWB 5H1UA 3LQJA 3IHPA 2KWOA 1WGMA 2QJ0A 1F62A 3HCSA 5JG6A 2MD7B 5LKXA 1WFKA 4A4BA 5B78A 1MM3A 1LDJB 3SOWA 4CA1A 3U5NA 1WEQA 2JMIA 4ZDTA 2CT2A 3LQHA 1MM2A 3RTRB 1HYJA 1V87A 2C2VS 1WE9A 2OXQC 1FBVA 4GNEA 3ZPV1 4A49A 3C5KA 4FK5A 4GNFA 3SOXA 2YQMA 2LXPC 3KV6A 1WEEA 1IYMA 2VNFA 4TKPB 4L58A 2I50A 3KQIA 4F52B 1WEMA 4LLBA 3GL6A 2ZETC 3U5MA 5FEYA 3PURA 4ZQLA 1U6GB 2MA6A 2EA6A 1X4IA 1X4UA 4YC9A 5B79A 3ZPVE 3V43A 2RI7A 3MHSA 4IC3A 2HDPA 4Q6FA 3T7LA 2D8SA 1WEPA 2DX8A 3RPGC 2LQ6A 4YAXA 2E6RA 4YATA 3L1ZB 2YW8A 5TBNA 4AVXA 2VP7A 2RSDA 5LKZA 2XEUA 4UI9B 5G0FA 2YT5A 3N9QA 1VFYA 1Z60A 2KWKA 2YURA 5I3LA 2G6QA 4GNGA 3M62A 4BBQA 2CSZA 4FIPA 3L11A 2LDRA 1JM7B 2MA5A 2YU4A 5C11A 2LGLA 4R2YA 4LADB 4AYCA 2VJEB 1Z6UA 2VPDA 2M6MA 4YABA 4WZ0A 3DPLR 3ZNIA 3EB6A 2HYED 3ZTGA 5D1KB 3O7AA 2L43A 2KGGA 3LQIA 5H1VA 2H0DB 3U5OA 1WILA 3VK6A 2F6JA 4QF3A 2ECIA 2UZGA 2LV9A 4MVTA 1LDKC 2ECNA 4ZUXU 3SHBA 2H0DA 2LRIC 4A4CA 2FUUA 3N9PA 5J3XA 2Y43A 2KR4A 2YREA 4UP5A 2LGKA 4V3LC 2VPBA 4A0CD 3PUQA 3C6WA 4YBMA 2KWNA 4I7DA 5FB0A 5B77A 5DKAA 4WZ3B 2KU3A 4WA6A 2LGGA 2EODA 2XB1A 4LK9A 3O33A 4L7XA 1WEUA 2JMJA 4WZ2A 4V3KC 2QIZA 2CKLB 4B7YC 4IC2A 1K2FA 2K17A 4AP4A 4CCGX 1N87A 2KFTA 4QF2A 5B76A 2VJFB 3HCUA 3ZVZB 4W4UA 5FERA 1HYIA 1WENA 4R7EA 3M99A 3EB5A 2YSMA 5B8DA 5KH3A 2IDAA 5AIUA 2G45A 2M85A 2MT5A 3M63A 5FB1A 3HTKC 3GV4A 3O37A 2K4DA 4B86C 3O70A 2MD8C 2YHNA 2E6SA 5TRBA 5D1MB 5C13A 2YUCA 1E4UA 1WESA 4O64A 5KH9A 2QICA 2YSJA 2AN6A 2FSAA 5H1TA 2Y1MA 4FO9A 5AITA 3QZVA 2ECJA 4S3OC 1WIMA 3O35A 3FL2A 3U5PA 1XWHA 2VPEA 2PNXA 2CKLA 2L5UA 3L1XA 4N4FA 2KWJA 2F42A 2VJFA 3NG2A 1DVPA 5TDRA 4R8PK 2MNYA 4PTBA 2ECVA 1Z2QA 1G25A
chains in the Genus database with same CATH superfamily
1WEVA 3KV5A 1VYXA 2B0OE 4X3GA 4LJNA 2L0BA 3HCTA 2YQLA 1CHCA 2KGIA 2G43A 2FUIA 1BORA 2JMDA 4AUQB 2KIZA 3N9OA 2M3HA 3KNVA 5SVIB 2LXHC 3MHHA 5SVXA 5G04B 1WEWA 4NN2A 2M13A 5G05B 1JOCA 5KH7A 3I2DA 4Z0RA 2VJEA 3ZYQA 5LKUA 2EGPA 3PHDA 1FP0A 4YBSA 1RMDA 2M1RA 3LRQA 2ECWA 3ZVYA 4GNDA 4YBTA 4OGCA 4PPEA 1WEOA 2MNZA 2KREA 2LN0A 2VPGA 4P5OB 4S3OB 2K16A 1T1HA 1ZBDB 4FJCA 4C9ZA 5TABA 3LJUX 2KYUA 4AYCB 4O62A 2BAYA 2KE1A 5LKTA 5H9MA 5TDWA 4YADA 3N9MA 2PUYA 5B75A 3ASLA 3N9NA 2MIQA 3O36A 5DINA 3RPGB 2FD4A 5K3QA 2Y1NA 2YHOA 3T6RA 2JRJA 1X4JA 2EXUA 4BHWA 4UP0A 1VD4A 2CSVA 1JM7A 2ECTA 4GB0A 2K1JA 3SOUA 2LGVA 2E61A 4MSXA 4N3WA 4XI1A 2ECGA 3DQVR 3N9LA 2NAAA 2CSYA 2DJAA 2F6NA 2MUMA 4LKAA 5D1LB 5EYAF 2L80A 4I7BA 4I7CA 2C2LA 3O34A 2YYRA 2L75A 3PLWA 5LCWB 3KDEC 5H1UA 3LQJA 3IHPA 2KWOA 1WGMA 2QJ0A 1F62A 2XOCA 3HCSA 2MD7B 3SUBA 5JG6A 3E2DA 5LKXA 1WFKA 4A4BA 5B78A 1MM3A 1LDJB 3SOWA 4CA1A 3U5NA 1WEQA 2JMIA 4ZDTA 2CT2A 3DDTA 1MM2A 3LQHA 3RTRB 1HYJA 1V87A 2CRRA 2C2VS 1WE9A 4OGEA 2OXQC 1FBVA 2XOZA 3FJUB 2DSMA 4GNEA 3ZPV1 4A49A 3C5KA 4FK5A 2CRWA 4GNFA 3SOXA 2YQMA 2LXPC 3KV6A 1WEEA 1IYMA 2VNFA 5SVIA 4TKPB 2IQJA 4L58A 2I50A 3KQIA 4F52B 3FM8C 3O47A 1WEMA 4LLBA 3GL6A 2ZETC 3U5MA 5FEYA 3PURA 4ZQLA 1U6GB 2MA6A 2EA6A 3Q1DA 1X4IA 1X4UA 4YC9A 2KKYA 5B79A 3ZPVE 3V43A 2RI7A 3MHSA 4IC3A 2HDPA 4Q6FA 3T7LA 2MKEA 2D8SA 1WEPA 2DX8A 3RPGC 2LQ6A 4YAXA 3FAOA 2E6RA 4YATA 3L1ZB 2YW8A 3FEHA 3H7HA 5TBNA 4AVXA 2VP7A 4F1PA 2RSDA 5LKZA 1MBMA 2XEUA 4UI9B 5G0FA 2YT5A 3N9QA 1VFYA 1Z60A 2KWKA 2YURA 5I3LA 2G6QA 4GNGA 3M62A 2CONA 2CSZA 4BBQA 4FIPA 3L11A 1DCQA 2LDRA 1JM7B 2MA5A 2YU4A 5C11A 2LGLA 4R2YA 4LADB 4AYCA 3DWDA 3MDBC 2VJEB 1Z6UA 2VPDA 2M6MA 4YABA 4WZ0A 3DPLR 3ZNIA 3EB6A 2HYED 2OWAA 3ZTGA 5D1KB 3O7AA 2L43A 2KGGA 3LQIA 5H1VA 2H0DB 3U5OA 1WILA 3VK6A 2F6JA 4QF3A 2ECIA 2UZGA 2LV9A 2FFWA 4MVTA 1LDKC 2ECNA 4ZUXU 3SHBA 2H0DA 2LRIC 4A4CA 2RR4A 2FUUA 3LVRE 3N9PA 5J3XA 3M7KA 2Y43A 2KR4A 2YREA 4UP5A 2YVRA 2XP0A 2XOYA 2LGKA 4V3LC 2VPBA 4A0CD 3PUQA 3C6WA 4YBMA 2KWNA 4I7DA 5FB0A 2JM3A 5DKAA 5B77A 4WZ3B 2KU3A 4WA6A 2LGGA 2LAUA 2EODA 2XB1A 4LK9A 2D8UA 3O33A 4L7XA 1WEUA 2JMJA 4WZ2A 4V3KC 2QIZA 2CKLB 4B7YC 4IC2A 1K2FA 2K17A 4AP4A 4CCGX 1N87A 2KFTA 4QF2A 5B76A 2VJFB 3HCUA 3ZVZB 4W4UA 5FERA 1HYIA 2JUNA 4H9DA 1WENA 4R7EA 3M99A 3EB5A 2YSMA 5B8DA 5KH3A 2IDAA 5AIUA 3LDYA 2G45A 2M85A 2MT5A 3M63A 5FB1A 3HTKC 3GV4A 3O37A 2K4DA 4B86C 3O70A 2MD8C 2YHNA 2E6SA 5TRBA 5D1MB 5C13A 2YUCA 1E4UA 3JUEA 1WESA 4O64A 5KH9A 2QICA 2YSJA 2FSAA 2AN6A 5H1TA 2Y1MA 4FO9A 3FANA 5AITA 3QZVA 2ECJA 4S3OC 1WIMA 3O35A 5SVYA 3FL2A 3LVQE 3U5PA 2L7PA 1XWHA 2VPEA 2PNXA 2KKXA 2CKLA 4QQ4A 2L5UA 3L1XA 4N4FA 2EGMA 2KWJA 2F42A 3T9KA 2VJFA 3NG2A 1DVPA 5TDRA 4R8PK 2MNYA 4PTBA 2ECVA 1Z2QA 2P57A 4Z0OA 1G25A
chains in the Genus database with same CATH topology
1WEVA 3KV5A 1VYXA 4X3GA 4LJNA 2L0BA 3HCTA 2YQLA 1CHCA 2KGIA 2G43A 2JMDA 1BORA 2FUIA 4AUQB 2KIZA 3N9OA 2M3HA 3KNVA 2LXHC 3MHHA 5G04B 1WEWA 4NN2A 5G05B 1JOCA 5KH7A 3I2DA 2VJEA 3ZYQA 5LKUA 2EGPA 3PHDA 1FP0A 4YBSA 1RMDA 2M1RA 3LRQA 2ECWA 3ZVYA 4GNDA 4YBTA 4PPEA 1WEOA 2MNZA 2KREA 2LN0A 2VPGA 4P5OB 4S3OB 2K16A 1T1HA 1ZBDB 4FJCA 4C9ZA 5TABA 2KYUA 4AYCB 2BAYA 2KE1A 5LKTA 5H9MA 5TDWA 4YADA 3N9MA 2PUYA 5B75A 3ASLA 3N9NA 2MIQA 3O36A 5DINA 3RPGB 2Y1NA 2YHOA 3T6RA 2JRJA 1X4JA 4BHWA 4UP0A 1VD4A 1JM7A 2ECTA 4GB0A 2K1JA 3SOUA 2LGVA 4MSXA 4N3WA 2ECGA 4XI1A 3DQVR 3N9LA 2NAAA 2CSYA 2F6NA 2MUMA 4LKAA 5D1LB 5EYAF 2L80A 4I7BA 4I7CA 2C2LA 3O34A 2YYRA 2L75A 5LCWB 5H1UA 3LQJA 3IHPA 2KWOA 1WGMA 2QJ0A 1F62A 3HCSA 5JG6A 2MD7B 5LKXA 1WFKA 4A4BA 5B78A 1MM3A 1LDJB 3SOWA 4CA1A 3U5NA 1WEQA 2JMIA 4ZDTA 2CT2A 3LQHA 1MM2A 3RTRB 1HYJA 1V87A 2C2VS 1WE9A 2OXQC 1FBVA 4GNEA 3ZPV1 4A49A 3C5KA 4FK5A 4GNFA 3SOXA 2YQMA 2LXPC 3KV6A 1WEEA 1IYMA 2VNFA 4TKPB 4L58A 2I50A 3KQIA 4F52B 1WEMA 4LLBA 3GL6A 2ZETC 3U5MA 5FEYA 3PURA 4ZQLA 1U6GB 2MA6A 2EA6A 1X4IA 1X4UA 4YC9A 5B79A 3ZPVE 3V43A 2RI7A 3MHSA 4IC3A 2HDPA 4Q6FA 3T7LA 2D8SA 1WEPA 2DX8A 3RPGC 2LQ6A 4YAXA 2E6RA 4YATA 3L1ZB 2YW8A 5TBNA 4AVXA 2VP7A 2RSDA 5LKZA 2XEUA 4UI9B 5G0FA 2YT5A 3N9QA 1VFYA 1Z60A 2KWKA 2YURA 5I3LA 2G6QA 4GNGA 3M62A 4BBQA 2CSZA 4FIPA 3L11A 2LDRA 1JM7B 2MA5A 2YU4A 5C11A 2LGLA 4R2YA 4LADB 4AYCA 2VJEB 1Z6UA 2VPDA 2M6MA 4YABA 4WZ0A 3DPLR 3ZNIA 3EB6A 2HYED 3ZTGA 5D1KB 3O7AA 2L43A 2KGGA 3LQIA 5H1VA 2H0DB 3U5OA 1WILA 3VK6A 2F6JA 4QF3A 2ECIA 2UZGA 2LV9A 4MVTA 1LDKC 2ECNA 4ZUXU 3SHBA 2H0DA 2LRIC 4A4CA 2FUUA 3N9PA 5J3XA 2Y43A 2KR4A 2YREA 4UP5A 2LGKA 4V3LC 2VPBA 4A0CD 3PUQA 3C6WA 4YBMA 2KWNA 4I7DA 5FB0A 5B77A 5DKAA 4WZ3B 2KU3A 4WA6A 2LGGA 2EODA 2XB1A 4LK9A 3O33A 4L7XA 1WEUA 2JMJA 4WZ2A 4V3KC 2QIZA 2CKLB 4B7YC 4IC2A 1K2FA 2K17A 4AP4A 4CCGX 1N87A 2KFTA 4QF2A 5B76A 2VJFB 3HCUA 3ZVZB 4W4UA 5FERA 1HYIA 1WENA 4R7EA 3M99A 3EB5A 2YSMA 5B8DA 5KH3A 2IDAA 5AIUA 2G45A 2M85A 2MT5A 3M63A 5FB1A 3HTKC 3GV4A 3O37A 2K4DA 4B86C 3O70A 2MD8C 2YHNA 2E6SA 5TRBA 5D1MB 5C13A 2YUCA 1E4UA 1WESA 4O64A 5KH9A 2QICA 2YSJA 2AN6A 2FSAA 5H1TA 2Y1MA 4FO9A 5AITA 3QZVA 2ECJA 4S3OC 1WIMA 3O35A 3FL2A 3U5PA 1XWHA 2VPEA 2PNXA 2CKLA 2L5UA 3L1XA 4N4FA 2KWJA 2F42A 2VJFA 3NG2A 1DVPA 5TDRA 4R8PK 2MNYA 4PTBA 2ECVA 1Z2QA 1G25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEV A;  3KV5 A;  1VYX A;  4X3G A;  4LJN A;  2L0B A;  3HCT A;  2YQL A;  1CHC A;  2KGI A;  2G43 A;  2JMD A;  1BOR A;  2FUI A;  4AUQ B;  2KIZ A;  3N9O A;  2M3H A;  3KNV A;  2LXH C;  3MHH A;  5G04 B;  1WEW A;  4NN2 A;  5G05 B;  1JOC A;  5KH7 A;  3I2D A;  2VJE A;  3ZYQ A;  5LKU A;  2EGP A;  3PHD A;  1FP0 A;  4YBS A;  1RMD A;  2M1R A;  3LRQ A;  2ECW A;  3ZVY A;  4GND A;  4YBT A;  4PPE A;  1WEO A;  2MNZ A;  2KRE A;  2LN0 A;  2VPG A;  4P5O B;  4S3O B;  2K16 A;  1T1H A;  1ZBD B;  4FJC A;  4C9Z A;  5TAB A;  2KYU A;  4AYC B;  2BAY A;  2KE1 A;  5LKT A;  5H9M A;  5TDW A;  4YAD A;  3N9M A;  2PUY A;  5B75 A;  3ASL A;  3N9N A;  2MIQ A;  3O36 A;  5DIN A;  3RPG B;  2Y1N A;  2YHO A;  3T6R A;  2JRJ A;  1X4J A;  4BHW A;  4UP0 A;  1VD4 A;  1JM7 A;  2ECT A;  4GB0 A;  2K1J A;  3SOU A;  2LGV A;  4MSX A;  4N3W A;  2ECG A;  4XI1 A;  3DQV R;  3N9L A;  2NAA A;  2CSY A;  2F6N A;  2MUM A;  4LKA A;  5D1L B;  5EYA F;  2L80 A;  4I7B A;  4I7C A;  2C2L A;  3O34 A;  2YYR A;  2L75 A;  5LCW B;  5H1U A;  3LQJ A;  3IHP A;  2KWO A;  1WGM A;  2QJ0 A;  1F62 A;  3HCS A;  5JG6 A;  2MD7 B;  5LKX A;  1WFK A;  4A4B A;  5B78 A;  1MM3 A;  1LDJ B;  3SOW A;  4CA1 A;  3U5N A;  1WEQ A;  2JMI A;  4ZDT A;  2CT2 A;  3LQH A;  1MM2 A;  3RTR B;  1HYJ A;  1V87 A;  2C2V S;  1WE9 A;  2OXQ C;  1FBV A;  4GNE A;  3ZPV 1;  4A49 A;  3C5K A;  4FK5 A;  4GNF A;  3SOX A;  2YQM A;  2LXP C;  3KV6 A;  1WEE A;  1IYM A;  2VNF A;  4TKP B;  4L58 A;  2I50 A;  3KQI A;  4F52 B;  1WEM A;  4LLB A;  3GL6 A;  2ZET C;  3U5M A;  5FEY A;  3PUR A;  4ZQL A;  1U6G B;  2MA6 A;  2EA6 A;  1X4I A;  1X4U A;  4YC9 A;  5B79 A;  3ZPV E;  3V43 A;  2RI7 A;  3MHS A;  4IC3 A;  2HDP A;  4Q6F A;  3T7L A;  2D8S A;  1WEP A;  2DX8 A;  3RPG C;  2LQ6 A;  4YAX A;  2E6R A;  4YAT A;  3L1Z B;  2YW8 A;  5TBN A;  4AVX A;  2VP7 A;  2RSD A;  5LKZ A;  2XEU A;  4UI9 B;  5G0F A;  2YT5 A;  3N9Q A;  1VFY A;  1Z60 A;  2KWK A;  2YUR A;  5I3L A;  2G6Q A;  4GNG A;  3M62 A;  4BBQ A;  2CSZ A;  4FIP A;  3L11 A;  2LDR A;  1JM7 B;  2MA5 A;  2YU4 A;  5C11 A;  2LGL A;  4R2Y A;  4LAD B;  4AYC A;  2VJE B;  1Z6U A;  2VPD A;  2M6M A;  4YAB A;  4WZ0 A;  3DPL R;  3ZNI A;  3EB6 A;  2HYE D;  3ZTG A;  5D1K B;  3O7A A;  2L43 A;  2KGG A;  3LQI A;  5H1V A;  2H0D B;  3U5O A;  1WIL A;  3VK6 A;  2F6J A;  4QF3 A;  2ECI A;  2UZG A;  2LV9 A;  4MVT A;  1LDK C;  2ECN A;  4ZUX U;  3SHB A;  2H0D A;  2LRI C;  4A4C A;  2FUU A;  3N9P A;  5J3X A;  2Y43 A;  2KR4 A;  2YRE A;  4UP5 A;  2LGK A;  4V3L C;  2VPB A;  4A0C D;  3PUQ A;  3C6W A;  4YBM A;  2KWN A;  4I7D A;  5FB0 A;  5B77 A;  5DKA A;  4WZ3 B;  2KU3 A;  4WA6 A;  2LGG A;  2EOD A;  2XB1 A;  4LK9 A;  3O33 A;  4L7X A;  1WEU A;  2JMJ A;  4WZ2 A;  4V3K C;  2QIZ A;  2CKL B;  4B7Y C;  4IC2 A;  1K2F A;  2K17 A;  4AP4 A;  4CCG X;  1N87 A;  2KFT A;  4QF2 A;  5B76 A;  2VJF B;  3HCU A;  3ZVZ B;  4W4U A;  5FER A;  1HYI A;  1WEN A;  4R7E A;  3M99 A;  3EB5 A;  2YSM A;  5B8D A;  5KH3 A;  2IDA A;  5AIU A;  2G45 A;  2M85 A;  2MT5 A;  3M63 A;  5FB1 A;  3HTK C;  3GV4 A;  3O37 A;  2K4D A;  4B86 C;  3O70 A;  2MD8 C;  2YHN A;  2E6S A;  5TRB A;  5D1M B;  5C13 A;  2YUC A;  1E4U A;  1WES A;  4O64 A;  5KH9 A;  2QIC A;  2YSJ A;  2AN6 A;  2FSA A;  5H1T A;  2Y1M A;  4FO9 A;  5AIT A;  3QZV A;  2ECJ A;  4S3O C;  1WIM A;  3O35 A;  3FL2 A;  3U5P A;  1XWH A;  2VPE A;  2PNX A;  2CKL A;  2L5U A;  3L1X A;  4N4F A;  2KWJ A;  2F42 A;  2VJF A;  3NG2 A;  1DVP A;  5TDR A;  4R8P K;  2MNY A;  4PTB A;  2ECV A;  1Z2Q A;  1G25 A; 
#chains in the Genus database with same CATH topology
 1WEV A;  3KV5 A;  1VYX A;  2B0O E;  4X3G A;  4LJN A;  2L0B A;  3HCT A;  2YQL A;  1CHC A;  2KGI A;  2G43 A;  2FUI A;  1BOR A;  2JMD A;  4AUQ B;  2KIZ A;  3N9O A;  2M3H A;  3KNV A;  5SVI B;  2LXH C;  3MHH A;  5SVX A;  5G04 B;  1WEW A;  4NN2 A;  2M13 A;  5G05 B;  1JOC A;  5KH7 A;  3I2D A;  4Z0R A;  2VJE A;  3ZYQ A;  5LKU A;  2EGP A;  3PHD A;  1FP0 A;  4YBS A;  1RMD A;  2M1R A;  3LRQ A;  2ECW A;  3ZVY A;  4GND A;  4YBT A;  4OGC A;  4PPE A;  1WEO A;  2MNZ A;  2KRE A;  2LN0 A;  2VPG A;  4P5O B;  4S3O B;  2K16 A;  1T1H A;  1ZBD B;  4FJC A;  4C9Z A;  5TAB A;  3LJU X;  2KYU A;  4AYC B;  4O62 A;  2BAY A;  2KE1 A;  5LKT A;  5H9M A;  5TDW A;  4YAD A;  3N9M A;  2PUY A;  5B75 A;  3ASL A;  3N9N A;  2MIQ A;  3O36 A;  5DIN A;  3RPG B;  2FD4 A;  5K3Q A;  2Y1N A;  2YHO A;  3T6R A;  2JRJ A;  1X4J A;  2EXU A;  4BHW A;  4UP0 A;  1VD4 A;  2CSV A;  1JM7 A;  2ECT A;  4GB0 A;  2K1J A;  3SOU A;  2LGV A;  2E61 A;  4MSX A;  4N3W A;  4XI1 A;  2ECG A;  3DQV R;  3N9L A;  2NAA A;  2CSY A;  2DJA A;  2F6N A;  2MUM A;  4LKA A;  5D1L B;  5EYA F;  2L80 A;  4I7B A;  4I7C A;  2C2L A;  3O34 A;  2YYR A;  2L75 A;  3PLW A;  5LCW B;  3KDE C;  5H1U A;  3LQJ A;  3IHP A;  2KWO A;  1WGM A;  2QJ0 A;  1F62 A;  2XOC A;  3HCS A;  2MD7 B;  3SUB A;  5JG6 A;  3E2D A;  5LKX A;  1WFK A;  4A4B A;  5B78 A;  1MM3 A;  1LDJ B;  3SOW A;  4CA1 A;  3U5N A;  1WEQ A;  2JMI A;  4ZDT A;  2CT2 A;  3DDT A;  1MM2 A;  3LQH A;  3RTR B;  1HYJ A;  1V87 A;  2CRR A;  2C2V S;  1WE9 A;  4OGE A;  2OXQ C;  1FBV A;  2XOZ A;  3FJU B;  2DSM A;  4GNE A;  3ZPV 1;  4A49 A;  3C5K A;  4FK5 A;  2CRW A;  4GNF A;  3SOX A;  2YQM A;  2LXP C;  3KV6 A;  1WEE A;  1IYM A;  2VNF A;  5SVI A;  4TKP B;  2IQJ A;  4L58 A;  2I50 A;  3KQI A;  4F52 B;  3FM8 C;  3O47 A;  1WEM A;  4LLB A;  3GL6 A;  2ZET C;  3U5M A;  5FEY A;  3PUR A;  4ZQL A;  1U6G B;  2MA6 A;  2EA6 A;  3Q1D A;  1X4I A;  1X4U A;  4YC9 A;  2KKY A;  5B79 A;  3ZPV E;  3V43 A;  2RI7 A;  3MHS A;  4IC3 A;  2HDP A;  4Q6F A;  3T7L A;  2MKE A;  2D8S A;  1WEP A;  2DX8 A;  3RPG C;  2LQ6 A;  4YAX A;  3FAO A;  2E6R A;  4YAT A;  3L1Z B;  2YW8 A;  3FEH A;  3H7H A;  5TBN A;  4AVX A;  2VP7 A;  4F1P A;  2RSD A;  5LKZ A;  1MBM A;  2XEU A;  4UI9 B;  5G0F A;  2YT5 A;  3N9Q A;  1VFY A;  1Z60 A;  2KWK A;  2YUR A;  5I3L A;  2G6Q A;  4GNG A;  3M62 A;  2CON A;  2CSZ A;  4BBQ A;  4FIP A;  3L11 A;  1DCQ A;  2LDR A;  1JM7 B;  2MA5 A;  2YU4 A;  5C11 A;  2LGL A;  4R2Y A;  4LAD B;  4AYC A;  3DWD A;  3MDB C;  2VJE B;  1Z6U A;  2VPD A;  2M6M A;  4YAB A;  4WZ0 A;  3DPL R;  3ZNI A;  3EB6 A;  2HYE D;  2OWA A;  3ZTG A;  5D1K B;  3O7A A;  2L43 A;  2KGG A;  3LQI A;  5H1V A;  2H0D B;  3U5O A;  1WIL A;  3VK6 A;  2F6J A;  4QF3 A;  2ECI A;  2UZG A;  2LV9 A;  2FFW A;  4MVT A;  1LDK C;  2ECN A;  4ZUX U;  3SHB A;  2H0D A;  2LRI C;  4A4C A;  2RR4 A;  2FUU A;  3LVR E;  3N9P A;  5J3X A;  3M7K A;  2Y43 A;  2KR4 A;  2YRE A;  4UP5 A;  2YVR A;  2XP0 A;  2XOY A;  2LGK A;  4V3L C;  2VPB A;  4A0C D;  3PUQ A;  3C6W A;  4YBM A;  2KWN A;  4I7D A;  5FB0 A;  2JM3 A;  5DKA A;  5B77 A;  4WZ3 B;  2KU3 A;  4WA6 A;  2LGG A;  2LAU A;  2EOD A;  2XB1 A;  4LK9 A;  2D8U A;  3O33 A;  4L7X A;  1WEU A;  2JMJ A;  4WZ2 A;  4V3K C;  2QIZ A;  2CKL B;  4B7Y C;  4IC2 A;  1K2F A;  2K17 A;  4AP4 A;  4CCG X;  1N87 A;  2KFT A;  4QF2 A;  5B76 A;  2VJF B;  3HCU A;  3ZVZ B;  4W4U A;  5FER A;  1HYI A;  2JUN A;  4H9D A;  1WEN A;  4R7E A;  3M99 A;  3EB5 A;  2YSM A;  5B8D A;  5KH3 A;  2IDA A;  5AIU A;  3LDY A;  2G45 A;  2M85 A;  2MT5 A;  3M63 A;  5FB1 A;  3HTK C;  3GV4 A;  3O37 A;  2K4D A;  4B86 C;  3O70 A;  2MD8 C;  2YHN A;  2E6S A;  5TRB A;  5D1M B;  5C13 A;  2YUC A;  1E4U A;  3JUE A;  1WES A;  4O64 A;  5KH9 A;  2QIC A;  2YSJ A;  2FSA A;  2AN6 A;  5H1T A;  2Y1M A;  4FO9 A;  3FAN A;  5AIT A;  3QZV A;  2ECJ A;  4S3O C;  1WIM A;  3O35 A;  5SVY A;  3FL2 A;  3LVQ E;  3U5P A;  2L7P A;  1XWH A;  2VPE A;  2PNX A;  2KKX A;  2CKL A;  4QQ4 A;  2L5U A;  3L1X A;  4N4F A;  2EGM A;  2KWJ A;  2F42 A;  3T9K A;  2VJF A;  3NG2 A;  1DVP A;  5TDR A;  4R8P K;  2MNY A;  4PTB A;  2ECV A;  1Z2Q A;  2P57 A;  4Z0O A;  1G25 A; 
#chains in the Genus database with same CATH homology
 1WEV A;  3KV5 A;  1VYX A;  4X3G A;  4LJN A;  2L0B A;  3HCT A;  2YQL A;  1CHC A;  2KGI A;  2G43 A;  2JMD A;  1BOR A;  2FUI A;  4AUQ B;  2KIZ A;  3N9O A;  2M3H A;  3KNV A;  2LXH C;  3MHH A;  5G04 B;  1WEW A;  4NN2 A;  5G05 B;  1JOC A;  5KH7 A;  3I2D A;  2VJE A;  3ZYQ A;  5LKU A;  2EGP A;  3PHD A;  1FP0 A;  4YBS A;  1RMD A;  2M1R A;  3LRQ A;  2ECW A;  3ZVY A;  4GND A;  4YBT A;  4PPE A;  1WEO A;  2MNZ A;  2KRE A;  2LN0 A;  2VPG A;  4P5O B;  4S3O B;  2K16 A;  1T1H A;  1ZBD B;  4FJC A;  4C9Z A;  5TAB A;  2KYU A;  4AYC B;  2BAY A;  2KE1 A;  5LKT A;  5H9M A;  5TDW A;  4YAD A;  3N9M A;  2PUY A;  5B75 A;  3ASL A;  3N9N A;  2MIQ A;  3O36 A;  5DIN A;  3RPG B;  2Y1N A;  2YHO A;  3T6R A;  2JRJ A;  1X4J A;  4BHW A;  4UP0 A;  1VD4 A;  1JM7 A;  2ECT A;  4GB0 A;  2K1J A;  3SOU A;  2LGV A;  4MSX A;  4N3W A;  2ECG A;  4XI1 A;  3DQV R;  3N9L A;  2NAA A;  2CSY A;  2F6N A;  2MUM A;  4LKA A;  5D1L B;  5EYA F;  2L80 A;  4I7B A;  4I7C A;  2C2L A;  3O34 A;  2YYR A;  2L75 A;  5LCW B;  5H1U A;  3LQJ A;  3IHP A;  2KWO A;  1WGM A;  2QJ0 A;  1F62 A;  3HCS A;  5JG6 A;  2MD7 B;  5LKX A;  1WFK A;  4A4B A;  5B78 A;  1MM3 A;  1LDJ B;  3SOW A;  4CA1 A;  3U5N A;  1WEQ A;  2JMI A;  4ZDT A;  2CT2 A;  3LQH A;  1MM2 A;  3RTR B;  1HYJ A;  1V87 A;  2C2V S;  1WE9 A;  2OXQ C;  1FBV A;  4GNE A;  3ZPV 1;  4A49 A;  3C5K A;  4FK5 A;  4GNF A;  3SOX A;  2YQM A;  2LXP C;  3KV6 A;  1WEE A;  1IYM A;  2VNF A;  4TKP B;  4L58 A;  2I50 A;  3KQI A;  4F52 B;  1WEM A;  4LLB A;  3GL6 A;  2ZET C;  3U5M A;  5FEY A;  3PUR A;  4ZQL A;  1U6G B;  2MA6 A;  2EA6 A;  1X4I A;  1X4U A;  4YC9 A;  5B79 A;  3ZPV E;  3V43 A;  2RI7 A;  3MHS A;  4IC3 A;  2HDP A;  4Q6F A;  3T7L A;  2D8S A;  1WEP A;  2DX8 A;  3RPG C;  2LQ6 A;  4YAX A;  2E6R A;  4YAT A;  3L1Z B;  2YW8 A;  5TBN A;  4AVX A;  2VP7 A;  2RSD A;  5LKZ A;  2XEU A;  4UI9 B;  5G0F A;  2YT5 A;  3N9Q A;  1VFY A;  1Z60 A;  2KWK A;  2YUR A;  5I3L A;  2G6Q A;  4GNG A;  3M62 A;  4BBQ A;  2CSZ A;  4FIP A;  3L11 A;  2LDR A;  1JM7 B;  2MA5 A;  2YU4 A;  5C11 A;  2LGL A;  4R2Y A;  4LAD B;  4AYC A;  2VJE B;  1Z6U A;  2VPD A;  2M6M A;  4YAB A;  4WZ0 A;  3DPL R;  3ZNI A;  3EB6 A;  2HYE D;  3ZTG A;  5D1K B;  3O7A A;  2L43 A;  2KGG A;  3LQI A;  5H1V A;  2H0D B;  3U5O A;  1WIL A;  3VK6 A;  2F6J A;  4QF3 A;  2ECI A;  2UZG A;  2LV9 A;  4MVT A;  1LDK C;  2ECN A;  4ZUX U;  3SHB A;  2H0D A;  2LRI C;  4A4C A;  2FUU A;  3N9P A;  5J3X A;  2Y43 A;  2KR4 A;  2YRE A;  4UP5 A;  2LGK A;  4V3L C;  2VPB A;  4A0C D;  3PUQ A;  3C6W A;  4YBM A;  2KWN A;  4I7D A;  5FB0 A;  5B77 A;  5DKA A;  4WZ3 B;  2KU3 A;  4WA6 A;  2LGG A;  2EOD A;  2XB1 A;  4LK9 A;  3O33 A;  4L7X A;  1WEU A;  2JMJ A;  4WZ2 A;  4V3K C;  2QIZ A;  2CKL B;  4B7Y C;  4IC2 A;  1K2F A;  2K17 A;  4AP4 A;  4CCG X;  1N87 A;  2KFT A;  4QF2 A;  5B76 A;  2VJF B;  3HCU A;  3ZVZ B;  4W4U A;  5FER A;  1HYI A;  1WEN A;  4R7E A;  3M99 A;  3EB5 A;  2YSM A;  5B8D A;  5KH3 A;  2IDA A;  5AIU A;  2G45 A;  2M85 A;  2MT5 A;  3M63 A;  5FB1 A;  3HTK C;  3GV4 A;  3O37 A;  2K4D A;  4B86 C;  3O70 A;  2MD8 C;  2YHN A;  2E6S A;  5TRB A;  5D1M B;  5C13 A;  2YUC A;  1E4U A;  1WES A;  4O64 A;  5KH9 A;  2QIC A;  2YSJ A;  2AN6 A;  2FSA A;  5H1T A;  2Y1M A;  4FO9 A;  5AIT A;  3QZV A;  2ECJ A;  4S3O C;  1WIM A;  3O35 A;  3FL2 A;  3U5P A;  1XWH A;  2VPE A;  2PNX A;  2CKL A;  2L5U A;  3L1X A;  4N4F A;  2KWJ A;  2F42 A;  2VJF A;  3NG2 A;  1DVP A;  5TDR A;  4R8P K;  2MNY A;  4PTB A;  2ECV A;  1Z2Q A;  1G25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...