2KGGA

Solution structure of jarid1a c-terminal phd finger
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
52
structure length
52
Chain Sequence
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Histone demethylase JARID1A
publication title Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kggA00
3M63A 1WESA 2EA6A 3N9QA 2KGGA 4LADB 5TDWA 3QZVA 5DINA 2YQLA 2MNZA 1LDJB 3O33A 4WZ2A 3T6RA 4B86C 4AYCA 2MIQA 3V43A 1WIMA 1WEUA 3PURA 2K1JA 2F42A 2C2LA 4QF3A 2EGPA 2QICA 2LGVA 5I3LA 2VPDA 5H1VA 2H0DB 1WEOA 4R2YA 3SOXA 5G05B 3SOUA 4AUQB 1RMDA 3M62A 4A49A 1JM7B 2LRIC 2LQ6A 5C11A 3HCTA 3I2DA 3ASLA 1BORA 1MM3A 2ECVA 5G04B 1K2FA 5B77A 1E4UA 2MD7B 1U6GB 3O36A 4V3KC 2OXQC 4ZUXU 5C13A 4A0CD 1Z2QA 5LKXA 1WEMA 2KWJA 3L1ZB 3O37A 2L5UA 2CKLA 5FERA 4AYCB 5H1UA 2ECIA 2LGGA 4X3GA 4AP4A 2FUIA 5J3XA 4CA1A 3U5PA 5TABA 3U5OA 1HYJA 4R8PK 2QJ0A 1V87A 2KFTA 4YC9A 3DQVR 5AITA 3VK6A 4LJNA 2VPBA 4FJCA 2E6SA 4MVTA 5FB0A 2VJEA 5D1MB 2VJFB 2BAYA 2G45A 5TDRA 2YU4A 3FL2A 4GNEA 2KYUA 5TRBA 5B78A 5TBNA 2ECNA 3O35A 4N4FA 3EB5A 2VPGA 3O34A 2RI7A 2JMDA 3LQJA 1Z60A 4WZ0A 4QF2A 4L7XA 1CHCA 1G25A 2YT5A 1IYMA 2KWNA 4P5OB 4LLBA 2ECWA 2G43A 2YYRA 3M99A 2JMIA 2EODA 2K4DA 2VP7A 3ZYQA 2LDRA 1WGMA 3ZTGA 2FUUA 2JRJA 1VYXA 2PNXA 1XWHA 4MSXA 3NG2A 5D1KB 2FSAA 5B75A 4WZ3B 2YHOA 4YADA 1WEVA 2KREA 4XI1A 4YATA 3ZPV1 3T7LA 2LGKA 3N9MA 2F6JA 3L1XA 2LXHC 2MD8C 2ECJA 2XB1A 4C9ZA 1MM2A 2NAAA 4F52B 3C6WA 4UP5A 4UI9B 2YURA 2XEUA 2Y1MA 2HDPA 2UZGA 3IHPA 5LKZA 2CSYA 3GL6A 2KR4A 2F6NA 2LV9A 4TKPB 4V3LC 4GNGA 4LK9A 3RPGC 4YAXA 5H1TA 1X4IA 3HCUA 4BBQA 2MA5A 4N3WA 4NN2A 2L43A 5FEYA 4ZQLA 5FB1A 2M85A 1X4JA 2DX8A 2H0DA 5D1LB 4YBSA 4S3OB 4IC2A 5G0FA 2L0BA 5KH9A 3KQIA 2KE1A 3HTKC 5B76A 2YHNA 2LXPC 3N9OA 3SHBA 3L11A 2VNFA 2KU3A 1LDKC 2YREA 2KWKA 2ECTA 1VD4A 4WA6A 4GNFA 1X4UA 1N87A 1WENA 5JG6A 2YSJA 1HYIA 4FIPA 1FP0A 1T1HA 2M3HA 1WFKA 3ZVYA 1F62A 4UP0A 4GNDA 3LQHA 2Y1NA 2CKLB 2E6RA 2K17A 3U5NA 1WEWA 2JMJA 2L80A 5LCWB 2YSMA 5H9MA 5KH3A 1FBVA 5AIUA 2MNYA 3RTRB 3RPGB 4BHWA 3PHDA 4L58A 5EYAF 4R7EA 3O70A 2M1RA 2D8SA 2YUCA 5LKUA 3N9PA 4YBTA 4PTBA 2VJEB 4AVXA 2K16A 2I50A 4S3OC 2QIZA 2MT5A 2VJFA 2KIZA 3U5MA 4LKAA 3MHSA 3HCSA 3DPLR 1WILA 5LKTA 4I7BA 2HYED 2LGLA 2YQMA 2L75A 3ZNIA 2RSDA 3C5KA 3ZVZB 4ZDTA 5B79A 2KWOA 4B7YC 2KGIA 1WEPA 3N9LA 4YABA 1JOCA 4CCGX 3PUQA 1Z6UA 1WEEA 2ECGA 4PPEA 2MUMA 3KNVA 2Y43A 4A4BA 2YW8A 5B8DA 3O7AA 2LN0A 4A4CA 2AN6A 3EB6A 4I7CA 3KV5A 1ZBDB 3LQIA 1WEQA 4YBMA 4FO9A 1WE9A 4GB0A 3GV4A 3MHHA 2M6MA 3LRQA 3SOWA 1JM7A 2CSZA 4I7DA 4O64A 5DKAA 1DVPA 2CT2A 3KV6A 5KH7A 2MA6A 4FK5A 2ZETC 4IC3A 2VPEA 4W4UA 3ZPVE 2IDAA 4Q6FA 2C2VS 2G6QA 1VFYA 2PUYA 3N9NA
chains in the Genus database with same CATH superfamily
3M63A 1WESA 2EA6A 3N9QA 2KGGA 3DWDA 4LADB 5TDWA 2CONA 3QZVA 5DINA 2YQLA 2MNZA 1LDJB 3O33A 4WZ2A 3T6RA 4B86C 4AYCA 3FANA 2P57A 2MIQA 3V43A 1WIMA 1WEUA 3PURA 2K1JA 2F42A 2C2LA 1MBMA 4QF3A 2EGPA 2XOYA 2QICA 2FD4A 2LGVA 5I3LA 2VPDA 5H1VA 2H0DB 1WEOA 4R2YA 3SOXA 5G05B 3SOUA 4AUQB 4Z0RA 1RMDA 3M62A 3FJUB 4OGCA 4A49A 1JM7B 2LRIC 2LQ6A 5C11A 3HCTA 3I2DA 4OGEA 2XOCA 3ASLA 1BORA 1MM3A 2ECVA 5G04B 1K2FA 5B77A 1E4UA 2MD7B 1U6GB 3O36A 4V3KC 2OXQC 4ZUXU 5C13A 4A0CD 2KKYA 1Z2QA 5LKXA 2DSMA 1WEMA 3H7HA 2KWJA 3L1ZB 3O37A 2L5UA 2CKLA 5FERA 5K3QA 4AYCB 5H1UA 2ECIA 2LGGA 4X3GA 4AP4A 2FUIA 5J3XA 4CA1A 3U5PA 5TABA 3U5OA 1HYJA 4O62A 4R8PK 2QJ0A 1V87A 2KFTA 4YC9A 2FFWA 3DQVR 5AITA 3VK6A 4LJNA 2VPBA 4FJCA 2E6SA 4MVTA 5FB0A 2VJEA 5D1MB 2VJFB 2BAYA 2G45A 5TDRA 2YU4A 3FL2A 4GNEA 2KYUA 5TRBA 3M7KA 5B78A 5TBNA 2ECNA 3O35A 4N4FA 3EB5A 3LVQE 2VPGA 3O34A 2YVRA 2RI7A 2CSVA 2JMDA 3LQJA 1Z60A 4WZ0A 4QF2A 4L7XA 1CHCA 1G25A 2YT5A 1IYMA 2KWNA 4P5OB 4LLBA 2ECWA 2G43A 2YYRA 3M99A 2JMIA 2E61A 2EODA 2K4DA 2VP7A 2MKEA 3ZYQA 2LDRA 1WGMA 3ZTGA 2FUUA 3SUBA 2JRJA 1VYXA 2PNXA 1XWHA 4H9DA 4MSXA 4QQ4A 3NG2A 5D1KB 2RR4A 3Q1DA 2FSAA 5B75A 4WZ3B 2YHOA 4YADA 1WEVA 2KREA 4XI1A 4YATA 3ZPV1 3T7LA 2LGKA 3N9MA 2M13A 2F6JA 3L1XA 5SVIA 2LXHC 2MD8C 2ECJA 2XB1A 4C9ZA 1MM2A 2NAAA 4F52B 3C6WA 4UP5A 4UI9B 2YURA 2XEUA 2Y1MA 3JUEA 2HDPA 2UZGA 3IHPA 5LKZA 2CSYA 3GL6A 2KR4A 2F6NA 2LV9A 4TKPB 4V3LC 4F1PA 4GNGA 4LK9A 3RPGC 2KKXA 4YAXA 5H1TA 1X4IA 3HCUA 2IQJA 4BBQA 2MA5A 4N3WA 2XP0A 4NN2A 2L43A 5FEYA 4ZQLA 5FB1A 2M85A 1X4JA 2DX8A 2H0DA 5D1LB 3E2DA 4YBSA 4S3OB 4IC2A 5G0FA 2L0BA 5KH9A 3KQIA 2KE1A 3HTKC 5B76A 2YHNA 2LXPC 3LVRE 3N9OA 3SHBA 3L11A 2VNFA 2OWAA 2KU3A 1LDKC 2YREA 2KWKA 2ECTA 1VD4A 4WA6A 4GNFA 5SVIB 1X4UA 2XOZA 1DCQA 1N87A 1WENA 5JG6A 2YSJA 1HYIA 4FIPA 1FP0A 1T1HA 2M3HA 1WFKA 3ZVYA 1F62A 4UP0A 2L7PA 4GNDA 3LQHA 2Y1NA 3KDEC 2CKLB 2E6RA 2K17A 3U5NA 3T9KA 1WEWA 2JMJA 3MDBC 2L80A 2YSMA 5LCWB 5H9MA 5KH3A 1FBVA 2LAUA 5AIUA 2MNYA 3RTRB 3RPGB 4BHWA 3PHDA 2JUNA 4L58A 5EYAF 4R7EA 3O70A 2M1RA 2D8SA 2EXUA 3O47A 2YUCA 5LKUA 3N9PA 4YBTA 4PTBA 2VJEB 4AVXA 2K16A 2I50A 4S3OC 2QIZA 2MT5A 2VJFA 2KIZA 3U5MA 4LKAA 2JM3A 3MHSA 3HCSA 3DPLR 1WILA 5LKTA 4I7BA 2HYED 2LGLA 3LDYA 2YQMA 5SVXA 2L75A 3ZNIA 2RSDA 3C5KA 3ZVZB 4ZDTA 5B79A 2KWOA 2CRRA 2B0OE 3FAOA 4B7YC 2KGIA 1WEPA 3N9LA 4YABA 2DJAA 1JOCA 3FEHA 4CCGX 3PUQA 1Z6UA 1WEEA 2ECGA 4PPEA 2MUMA 3KNVA 2Y43A 4A4BA 4Z0OA 2YW8A 5B8DA 3O7AA 2LN0A 4A4CA 3PLWA 2CRWA 5SVYA 2AN6A 3EB6A 4I7CA 3KV5A 1ZBDB 3LQIA 2EGMA 1WEQA 3FM8C 4YBMA 4FO9A 1WE9A 4GB0A 3GV4A 3MHHA 2D8UA 2M6MA 3LRQA 3SOWA 1JM7A 2CSZA 4I7DA 4O64A 5DKAA 1DVPA 2CT2A 3KV6A 5KH7A 2MA6A 4FK5A 2ZETC 4IC3A 2VPEA 4W4UA 3ZPVE 2IDAA 4Q6FA 2C2VS 2G6QA 3LJUX 1VFYA 2PUYA 3N9NA 3DDTA
chains in the Genus database with same CATH topology
3M63A 1WESA 2EA6A 3N9QA 2KGGA 4LADB 5TDWA 3QZVA 5DINA 2YQLA 2MNZA 1LDJB 3O33A 4WZ2A 3T6RA 4B86C 4AYCA 2MIQA 3V43A 1WIMA 1WEUA 3PURA 2K1JA 2F42A 2C2LA 4QF3A 2EGPA 2QICA 2LGVA 5I3LA 2VPDA 5H1VA 2H0DB 1WEOA 4R2YA 3SOXA 5G05B 3SOUA 4AUQB 1RMDA 3M62A 4A49A 1JM7B 2LRIC 2LQ6A 5C11A 3HCTA 3I2DA 3ASLA 1BORA 1MM3A 2ECVA 5G04B 1K2FA 5B77A 1E4UA 2MD7B 1U6GB 3O36A 4V3KC 2OXQC 4ZUXU 5C13A 4A0CD 1Z2QA 5LKXA 1WEMA 2KWJA 3L1ZB 3O37A 2L5UA 2CKLA 5FERA 4AYCB 5H1UA 2ECIA 2LGGA 4X3GA 4AP4A 2FUIA 5J3XA 4CA1A 3U5PA 5TABA 3U5OA 1HYJA 4R8PK 2QJ0A 1V87A 2KFTA 4YC9A 3DQVR 5AITA 3VK6A 4LJNA 2VPBA 4FJCA 2E6SA 4MVTA 5FB0A 2VJEA 5D1MB 2VJFB 2BAYA 2G45A 5TDRA 2YU4A 3FL2A 4GNEA 2KYUA 5TRBA 5B78A 5TBNA 2ECNA 3O35A 4N4FA 3EB5A 2VPGA 3O34A 2RI7A 2JMDA 3LQJA 1Z60A 4WZ0A 4QF2A 4L7XA 1CHCA 1G25A 2YT5A 1IYMA 2KWNA 4P5OB 4LLBA 2ECWA 2G43A 2YYRA 3M99A 2JMIA 2EODA 2K4DA 2VP7A 3ZYQA 2LDRA 1WGMA 3ZTGA 2FUUA 2JRJA 1VYXA 2PNXA 1XWHA 4MSXA 3NG2A 5D1KB 2FSAA 5B75A 4WZ3B 2YHOA 4YADA 1WEVA 2KREA 4XI1A 4YATA 3ZPV1 3T7LA 2LGKA 3N9MA 2F6JA 3L1XA 2LXHC 2MD8C 2ECJA 2XB1A 4C9ZA 1MM2A 2NAAA 4F52B 3C6WA 4UP5A 4UI9B 2YURA 2XEUA 2Y1MA 2HDPA 2UZGA 3IHPA 5LKZA 2CSYA 3GL6A 2KR4A 2F6NA 2LV9A 4TKPB 4V3LC 4GNGA 4LK9A 3RPGC 4YAXA 5H1TA 1X4IA 3HCUA 4BBQA 2MA5A 4N3WA 4NN2A 2L43A 5FEYA 4ZQLA 5FB1A 2M85A 1X4JA 2DX8A 2H0DA 5D1LB 4YBSA 4S3OB 4IC2A 5G0FA 2L0BA 5KH9A 3KQIA 2KE1A 3HTKC 5B76A 2YHNA 2LXPC 3N9OA 3SHBA 3L11A 2VNFA 2KU3A 1LDKC 2YREA 2KWKA 2ECTA 1VD4A 4WA6A 4GNFA 1X4UA 1N87A 1WENA 5JG6A 2YSJA 1HYIA 4FIPA 1FP0A 1T1HA 2M3HA 1WFKA 3ZVYA 1F62A 4UP0A 4GNDA 3LQHA 2Y1NA 2CKLB 2E6RA 2K17A 3U5NA 1WEWA 2JMJA 2L80A 5LCWB 2YSMA 5H9MA 5KH3A 1FBVA 5AIUA 2MNYA 3RTRB 3RPGB 4BHWA 3PHDA 4L58A 5EYAF 4R7EA 3O70A 2M1RA 2D8SA 2YUCA 5LKUA 3N9PA 4YBTA 4PTBA 2VJEB 4AVXA 2K16A 2I50A 4S3OC 2QIZA 2MT5A 2VJFA 2KIZA 3U5MA 4LKAA 3MHSA 3HCSA 3DPLR 1WILA 5LKTA 4I7BA 2HYED 2LGLA 2YQMA 2L75A 3ZNIA 2RSDA 3C5KA 3ZVZB 4ZDTA 5B79A 2KWOA 4B7YC 2KGIA 1WEPA 3N9LA 4YABA 1JOCA 4CCGX 3PUQA 1Z6UA 1WEEA 2ECGA 4PPEA 2MUMA 3KNVA 2Y43A 4A4BA 2YW8A 5B8DA 3O7AA 2LN0A 4A4CA 2AN6A 3EB6A 4I7CA 3KV5A 1ZBDB 3LQIA 1WEQA 4YBMA 4FO9A 1WE9A 4GB0A 3GV4A 3MHHA 2M6MA 3LRQA 3SOWA 1JM7A 2CSZA 4I7DA 4O64A 5DKAA 1DVPA 2CT2A 3KV6A 5KH7A 2MA6A 4FK5A 2ZETC 4IC3A 2VPEA 4W4UA 3ZPVE 2IDAA 4Q6FA 2C2VS 2G6QA 1VFYA 2PUYA 3N9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 A;  1WES A;  2EA6 A;  3N9Q A;  2KGG A;  4LAD B;  5TDW A;  3QZV A;  5DIN A;  2YQL A;  2MNZ A;  1LDJ B;  3O33 A;  4WZ2 A;  3T6R A;  4B86 C;  4AYC A;  2MIQ A;  3V43 A;  1WIM A;  1WEU A;  3PUR A;  2K1J A;  2F42 A;  2C2L A;  4QF3 A;  2EGP A;  2QIC A;  2LGV A;  5I3L A;  2VPD A;  5H1V A;  2H0D B;  1WEO A;  4R2Y A;  3SOX A;  5G05 B;  3SOU A;  4AUQ B;  1RMD A;  3M62 A;  4A49 A;  1JM7 B;  2LRI C;  2LQ6 A;  5C11 A;  3HCT A;  3I2D A;  3ASL A;  1BOR A;  1MM3 A;  2ECV A;  5G04 B;  1K2F A;  5B77 A;  1E4U A;  2MD7 B;  1U6G B;  3O36 A;  4V3K C;  2OXQ C;  4ZUX U;  5C13 A;  4A0C D;  1Z2Q A;  5LKX A;  1WEM A;  2KWJ A;  3L1Z B;  3O37 A;  2L5U A;  2CKL A;  5FER A;  4AYC B;  5H1U A;  2ECI A;  2LGG A;  4X3G A;  4AP4 A;  2FUI A;  5J3X A;  4CA1 A;  3U5P A;  5TAB A;  3U5O A;  1HYJ A;  4R8P K;  2QJ0 A;  1V87 A;  2KFT A;  4YC9 A;  3DQV R;  5AIT A;  3VK6 A;  4LJN A;  2VPB A;  4FJC A;  2E6S A;  4MVT A;  5FB0 A;  2VJE A;  5D1M B;  2VJF B;  2BAY A;  2G45 A;  5TDR A;  2YU4 A;  3FL2 A;  4GNE A;  2KYU A;  5TRB A;  5B78 A;  5TBN A;  2ECN A;  3O35 A;  4N4F A;  3EB5 A;  2VPG A;  3O34 A;  2RI7 A;  2JMD A;  3LQJ A;  1Z60 A;  4WZ0 A;  4QF2 A;  4L7X A;  1CHC A;  1G25 A;  2YT5 A;  1IYM A;  2KWN A;  4P5O B;  4LLB A;  2ECW A;  2G43 A;  2YYR A;  3M99 A;  2JMI A;  2EOD A;  2K4D A;  2VP7 A;  3ZYQ A;  2LDR A;  1WGM A;  3ZTG A;  2FUU A;  2JRJ A;  1VYX A;  2PNX A;  1XWH A;  4MSX A;  3NG2 A;  5D1K B;  2FSA A;  5B75 A;  4WZ3 B;  2YHO A;  4YAD A;  1WEV A;  2KRE A;  4XI1 A;  4YAT A;  3ZPV 1;  3T7L A;  2LGK A;  3N9M A;  2F6J A;  3L1X A;  2LXH C;  2MD8 C;  2ECJ A;  2XB1 A;  4C9Z A;  1MM2 A;  2NAA A;  4F52 B;  3C6W A;  4UP5 A;  4UI9 B;  2YUR A;  2XEU A;  2Y1M A;  2HDP A;  2UZG A;  3IHP A;  5LKZ A;  2CSY A;  3GL6 A;  2KR4 A;  2F6N A;  2LV9 A;  4TKP B;  4V3L C;  4GNG A;  4LK9 A;  3RPG C;  4YAX A;  5H1T A;  1X4I A;  3HCU A;  4BBQ A;  2MA5 A;  4N3W A;  4NN2 A;  2L43 A;  5FEY A;  4ZQL A;  5FB1 A;  2M85 A;  1X4J A;  2DX8 A;  2H0D A;  5D1L B;  4YBS A;  4S3O B;  4IC2 A;  5G0F A;  2L0B A;  5KH9 A;  3KQI A;  2KE1 A;  3HTK C;  5B76 A;  2YHN A;  2LXP C;  3N9O A;  3SHB A;  3L11 A;  2VNF A;  2KU3 A;  1LDK C;  2YRE A;  2KWK A;  2ECT A;  1VD4 A;  4WA6 A;  4GNF A;  1X4U A;  1N87 A;  1WEN A;  5JG6 A;  2YSJ A;  1HYI A;  4FIP A;  1FP0 A;  1T1H A;  2M3H A;  1WFK A;  3ZVY A;  1F62 A;  4UP0 A;  4GND A;  3LQH A;  2Y1N A;  2CKL B;  2E6R A;  2K17 A;  3U5N A;  1WEW A;  2JMJ A;  2L80 A;  5LCW B;  2YSM A;  5H9M A;  5KH3 A;  1FBV A;  5AIU A;  2MNY A;  3RTR B;  3RPG B;  4BHW A;  3PHD A;  4L58 A;  5EYA F;  4R7E A;  3O70 A;  2M1R A;  2D8S A;  2YUC A;  5LKU A;  3N9P A;  4YBT A;  4PTB A;  2VJE B;  4AVX A;  2K16 A;  2I50 A;  4S3O C;  2QIZ A;  2MT5 A;  2VJF A;  2KIZ A;  3U5M A;  4LKA A;  3MHS A;  3HCS A;  3DPL R;  1WIL A;  5LKT A;  4I7B A;  2HYE D;  2LGL A;  2YQM A;  2L75 A;  3ZNI A;  2RSD A;  3C5K A;  3ZVZ B;  4ZDT A;  5B79 A;  2KWO A;  4B7Y C;  2KGI A;  1WEP A;  3N9L A;  4YAB A;  1JOC A;  4CCG X;  3PUQ A;  1Z6U A;  1WEE A;  2ECG A;  4PPE A;  2MUM A;  3KNV A;  2Y43 A;  4A4B A;  2YW8 A;  5B8D A;  3O7A A;  2LN0 A;  4A4C A;  2AN6 A;  3EB6 A;  4I7C A;  3KV5 A;  1ZBD B;  3LQI A;  1WEQ A;  4YBM A;  4FO9 A;  1WE9 A;  4GB0 A;  3GV4 A;  3MHH A;  2M6M A;  3LRQ A;  3SOW A;  1JM7 A;  2CSZ A;  4I7D A;  4O64 A;  5DKA A;  1DVP A;  2CT2 A;  3KV6 A;  5KH7 A;  2MA6 A;  4FK5 A;  2ZET C;  4IC3 A;  2VPE A;  4W4U A;  3ZPV E;  2IDA A;  4Q6F A;  2C2V S;  2G6Q A;  1VFY A;  2PUY A;  3N9N A; 
#chains in the Genus database with same CATH topology
 3M63 A;  1WES A;  2EA6 A;  3N9Q A;  2KGG A;  3DWD A;  4LAD B;  5TDW A;  2CON A;  3QZV A;  5DIN A;  2YQL A;  2MNZ A;  1LDJ B;  3O33 A;  4WZ2 A;  3T6R A;  4B86 C;  4AYC A;  3FAN A;  2P57 A;  2MIQ A;  3V43 A;  1WIM A;  1WEU A;  3PUR A;  2K1J A;  2F42 A;  2C2L A;  1MBM A;  4QF3 A;  2EGP A;  2XOY A;  2QIC A;  2FD4 A;  2LGV A;  5I3L A;  2VPD A;  5H1V A;  2H0D B;  1WEO A;  4R2Y A;  3SOX A;  5G05 B;  3SOU A;  4AUQ B;  4Z0R A;  1RMD A;  3M62 A;  3FJU B;  4OGC A;  4A49 A;  1JM7 B;  2LRI C;  2LQ6 A;  5C11 A;  3HCT A;  3I2D A;  4OGE A;  2XOC A;  3ASL A;  1BOR A;  1MM3 A;  2ECV A;  5G04 B;  1K2F A;  5B77 A;  1E4U A;  2MD7 B;  1U6G B;  3O36 A;  4V3K C;  2OXQ C;  4ZUX U;  5C13 A;  4A0C D;  2KKY A;  1Z2Q A;  5LKX A;  2DSM A;  1WEM A;  3H7H A;  2KWJ A;  3L1Z B;  3O37 A;  2L5U A;  2CKL A;  5FER A;  5K3Q A;  4AYC B;  5H1U A;  2ECI A;  2LGG A;  4X3G A;  4AP4 A;  2FUI A;  5J3X A;  4CA1 A;  3U5P A;  5TAB A;  3U5O A;  1HYJ A;  4O62 A;  4R8P K;  2QJ0 A;  1V87 A;  2KFT A;  4YC9 A;  2FFW A;  3DQV R;  5AIT A;  3VK6 A;  4LJN A;  2VPB A;  4FJC A;  2E6S A;  4MVT A;  5FB0 A;  2VJE A;  5D1M B;  2VJF B;  2BAY A;  2G45 A;  5TDR A;  2YU4 A;  3FL2 A;  4GNE A;  2KYU A;  5TRB A;  3M7K A;  5B78 A;  5TBN A;  2ECN A;  3O35 A;  4N4F A;  3EB5 A;  3LVQ E;  2VPG A;  3O34 A;  2YVR A;  2RI7 A;  2CSV A;  2JMD A;  3LQJ A;  1Z60 A;  4WZ0 A;  4QF2 A;  4L7X A;  1CHC A;  1G25 A;  2YT5 A;  1IYM A;  2KWN A;  4P5O B;  4LLB A;  2ECW A;  2G43 A;  2YYR A;  3M99 A;  2JMI A;  2E61 A;  2EOD A;  2K4D A;  2VP7 A;  2MKE A;  3ZYQ A;  2LDR A;  1WGM A;  3ZTG A;  2FUU A;  3SUB A;  2JRJ A;  1VYX A;  2PNX A;  1XWH A;  4H9D A;  4MSX A;  4QQ4 A;  3NG2 A;  5D1K B;  2RR4 A;  3Q1D A;  2FSA A;  5B75 A;  4WZ3 B;  2YHO A;  4YAD A;  1WEV A;  2KRE A;  4XI1 A;  4YAT A;  3ZPV 1;  3T7L A;  2LGK A;  3N9M A;  2M13 A;  2F6J A;  3L1X A;  5SVI A;  2LXH C;  2MD8 C;  2ECJ A;  2XB1 A;  4C9Z A;  1MM2 A;  2NAA A;  4F52 B;  3C6W A;  4UP5 A;  4UI9 B;  2YUR A;  2XEU A;  2Y1M A;  3JUE A;  2HDP A;  2UZG A;  3IHP A;  5LKZ A;  2CSY A;  3GL6 A;  2KR4 A;  2F6N A;  2LV9 A;  4TKP B;  4V3L C;  4F1P A;  4GNG A;  4LK9 A;  3RPG C;  2KKX A;  4YAX A;  5H1T A;  1X4I A;  3HCU A;  2IQJ A;  4BBQ A;  2MA5 A;  4N3W A;  2XP0 A;  4NN2 A;  2L43 A;  5FEY A;  4ZQL A;  5FB1 A;  2M85 A;  1X4J A;  2DX8 A;  2H0D A;  5D1L B;  3E2D A;  4YBS A;  4S3O B;  4IC2 A;  5G0F A;  2L0B A;  5KH9 A;  3KQI A;  2KE1 A;  3HTK C;  5B76 A;  2YHN A;  2LXP C;  3LVR E;  3N9O A;  3SHB A;  3L11 A;  2VNF A;  2OWA A;  2KU3 A;  1LDK C;  2YRE A;  2KWK A;  2ECT A;  1VD4 A;  4WA6 A;  4GNF A;  5SVI B;  1X4U A;  2XOZ A;  1DCQ A;  1N87 A;  1WEN A;  5JG6 A;  2YSJ A;  1HYI A;  4FIP A;  1FP0 A;  1T1H A;  2M3H A;  1WFK A;  3ZVY A;  1F62 A;  4UP0 A;  2L7P A;  4GND A;  3LQH A;  2Y1N A;  3KDE C;  2CKL B;  2E6R A;  2K17 A;  3U5N A;  3T9K A;  1WEW A;  2JMJ A;  3MDB C;  2L80 A;  2YSM A;  5LCW B;  5H9M A;  5KH3 A;  1FBV A;  2LAU A;  5AIU A;  2MNY A;  3RTR B;  3RPG B;  4BHW A;  3PHD A;  2JUN A;  4L58 A;  5EYA F;  4R7E A;  3O70 A;  2M1R A;  2D8S A;  2EXU A;  3O47 A;  2YUC A;  5LKU A;  3N9P A;  4YBT A;  4PTB A;  2VJE B;  4AVX A;  2K16 A;  2I50 A;  4S3O C;  2QIZ A;  2MT5 A;  2VJF A;  2KIZ A;  3U5M A;  4LKA A;  2JM3 A;  3MHS A;  3HCS A;  3DPL R;  1WIL A;  5LKT A;  4I7B A;  2HYE D;  2LGL A;  3LDY A;  2YQM A;  5SVX A;  2L75 A;  3ZNI A;  2RSD A;  3C5K A;  3ZVZ B;  4ZDT A;  5B79 A;  2KWO A;  2CRR A;  2B0O E;  3FAO A;  4B7Y C;  2KGI A;  1WEP A;  3N9L A;  4YAB A;  2DJA A;  1JOC A;  3FEH A;  4CCG X;  3PUQ A;  1Z6U A;  1WEE A;  2ECG A;  4PPE A;  2MUM A;  3KNV A;  2Y43 A;  4A4B A;  4Z0O A;  2YW8 A;  5B8D A;  3O7A A;  2LN0 A;  4A4C A;  3PLW A;  2CRW A;  5SVY A;  2AN6 A;  3EB6 A;  4I7C A;  3KV5 A;  1ZBD B;  3LQI A;  2EGM A;  1WEQ A;  3FM8 C;  4YBM A;  4FO9 A;  1WE9 A;  4GB0 A;  3GV4 A;  3MHH A;  2D8U A;  2M6M A;  3LRQ A;  3SOW A;  1JM7 A;  2CSZ A;  4I7D A;  4O64 A;  5DKA A;  1DVP A;  2CT2 A;  3KV6 A;  5KH7 A;  2MA6 A;  4FK5 A;  2ZET C;  4IC3 A;  2VPE A;  4W4U A;  3ZPV E;  2IDA A;  4Q6F A;  2C2V S;  2G6Q A;  3LJU X;  1VFY A;  2PUY A;  3N9N A;  3DDT A; 
#chains in the Genus database with same CATH homology
 3M63 A;  1WES A;  2EA6 A;  3N9Q A;  2KGG A;  4LAD B;  5TDW A;  3QZV A;  5DIN A;  2YQL A;  2MNZ A;  1LDJ B;  3O33 A;  4WZ2 A;  3T6R A;  4B86 C;  4AYC A;  2MIQ A;  3V43 A;  1WIM A;  1WEU A;  3PUR A;  2K1J A;  2F42 A;  2C2L A;  4QF3 A;  2EGP A;  2QIC A;  2LGV A;  5I3L A;  2VPD A;  5H1V A;  2H0D B;  1WEO A;  4R2Y A;  3SOX A;  5G05 B;  3SOU A;  4AUQ B;  1RMD A;  3M62 A;  4A49 A;  1JM7 B;  2LRI C;  2LQ6 A;  5C11 A;  3HCT A;  3I2D A;  3ASL A;  1BOR A;  1MM3 A;  2ECV A;  5G04 B;  1K2F A;  5B77 A;  1E4U A;  2MD7 B;  1U6G B;  3O36 A;  4V3K C;  2OXQ C;  4ZUX U;  5C13 A;  4A0C D;  1Z2Q A;  5LKX A;  1WEM A;  2KWJ A;  3L1Z B;  3O37 A;  2L5U A;  2CKL A;  5FER A;  4AYC B;  5H1U A;  2ECI A;  2LGG A;  4X3G A;  4AP4 A;  2FUI A;  5J3X A;  4CA1 A;  3U5P A;  5TAB A;  3U5O A;  1HYJ A;  4R8P K;  2QJ0 A;  1V87 A;  2KFT A;  4YC9 A;  3DQV R;  5AIT A;  3VK6 A;  4LJN A;  2VPB A;  4FJC A;  2E6S A;  4MVT A;  5FB0 A;  2VJE A;  5D1M B;  2VJF B;  2BAY A;  2G45 A;  5TDR A;  2YU4 A;  3FL2 A;  4GNE A;  2KYU A;  5TRB A;  5B78 A;  5TBN A;  2ECN A;  3O35 A;  4N4F A;  3EB5 A;  2VPG A;  3O34 A;  2RI7 A;  2JMD A;  3LQJ A;  1Z60 A;  4WZ0 A;  4QF2 A;  4L7X A;  1CHC A;  1G25 A;  2YT5 A;  1IYM A;  2KWN A;  4P5O B;  4LLB A;  2ECW A;  2G43 A;  2YYR A;  3M99 A;  2JMI A;  2EOD A;  2K4D A;  2VP7 A;  3ZYQ A;  2LDR A;  1WGM A;  3ZTG A;  2FUU A;  2JRJ A;  1VYX A;  2PNX A;  1XWH A;  4MSX A;  3NG2 A;  5D1K B;  2FSA A;  5B75 A;  4WZ3 B;  2YHO A;  4YAD A;  1WEV A;  2KRE A;  4XI1 A;  4YAT A;  3ZPV 1;  3T7L A;  2LGK A;  3N9M A;  2F6J A;  3L1X A;  2LXH C;  2MD8 C;  2ECJ A;  2XB1 A;  4C9Z A;  1MM2 A;  2NAA A;  4F52 B;  3C6W A;  4UP5 A;  4UI9 B;  2YUR A;  2XEU A;  2Y1M A;  2HDP A;  2UZG A;  3IHP A;  5LKZ A;  2CSY A;  3GL6 A;  2KR4 A;  2F6N A;  2LV9 A;  4TKP B;  4V3L C;  4GNG A;  4LK9 A;  3RPG C;  4YAX A;  5H1T A;  1X4I A;  3HCU A;  4BBQ A;  2MA5 A;  4N3W A;  4NN2 A;  2L43 A;  5FEY A;  4ZQL A;  5FB1 A;  2M85 A;  1X4J A;  2DX8 A;  2H0D A;  5D1L B;  4YBS A;  4S3O B;  4IC2 A;  5G0F A;  2L0B A;  5KH9 A;  3KQI A;  2KE1 A;  3HTK C;  5B76 A;  2YHN A;  2LXP C;  3N9O A;  3SHB A;  3L11 A;  2VNF A;  2KU3 A;  1LDK C;  2YRE A;  2KWK A;  2ECT A;  1VD4 A;  4WA6 A;  4GNF A;  1X4U A;  1N87 A;  1WEN A;  5JG6 A;  2YSJ A;  1HYI A;  4FIP A;  1FP0 A;  1T1H A;  2M3H A;  1WFK A;  3ZVY A;  1F62 A;  4UP0 A;  4GND A;  3LQH A;  2Y1N A;  2CKL B;  2E6R A;  2K17 A;  3U5N A;  1WEW A;  2JMJ A;  2L80 A;  5LCW B;  2YSM A;  5H9M A;  5KH3 A;  1FBV A;  5AIU A;  2MNY A;  3RTR B;  3RPG B;  4BHW A;  3PHD A;  4L58 A;  5EYA F;  4R7E A;  3O70 A;  2M1R A;  2D8S A;  2YUC A;  5LKU A;  3N9P A;  4YBT A;  4PTB A;  2VJE B;  4AVX A;  2K16 A;  2I50 A;  4S3O C;  2QIZ A;  2MT5 A;  2VJF A;  2KIZ A;  3U5M A;  4LKA A;  3MHS A;  3HCS A;  3DPL R;  1WIL A;  5LKT A;  4I7B A;  2HYE D;  2LGL A;  2YQM A;  2L75 A;  3ZNI A;  2RSD A;  3C5K A;  3ZVZ B;  4ZDT A;  5B79 A;  2KWO A;  4B7Y C;  2KGI A;  1WEP A;  3N9L A;  4YAB A;  1JOC A;  4CCG X;  3PUQ A;  1Z6U A;  1WEE A;  2ECG A;  4PPE A;  2MUM A;  3KNV A;  2Y43 A;  4A4B A;  2YW8 A;  5B8D A;  3O7A A;  2LN0 A;  4A4C A;  2AN6 A;  3EB6 A;  4I7C A;  3KV5 A;  1ZBD B;  3LQI A;  1WEQ A;  4YBM A;  4FO9 A;  1WE9 A;  4GB0 A;  3GV4 A;  3MHH A;  2M6M A;  3LRQ A;  3SOW A;  1JM7 A;  2CSZ A;  4I7D A;  4O64 A;  5DKA A;  1DVP A;  2CT2 A;  3KV6 A;  5KH7 A;  2MA6 A;  4FK5 A;  2ZET C;  4IC3 A;  2VPE A;  4W4U A;  3ZPV E;  2IDA A;  4Q6F A;  2C2V S;  2G6Q A;  1VFY A;  2PUY A;  3N9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...