2KGGA

Solution structure of jarid1a c-terminal phd finger
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
52
structure length
52
Chain Sequence
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone demethylase JARID1A
publication title Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 6
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kggA00
1WE9A 2M6MA 2C2VS 3L11A 3V43A 3GV4A 2C2LA 5B75A 1HYIA 2PUYA 2HYED 2G43A 5B77A 3O70A 5AITA 5D1LB 3O37A 2ECVA 3MHSA 3DPLR 2XEUA 3HCUA 3KQIA 2OXQC 4I7CA 1JOCA 1FP0A 2YSMA 4V3KC 2H0DA 4AYCB 2L75A 5LKXA 4V3LC 3ASLA 3PUQA 3IHPA 1T1HA 2QIZA 3U5PA 1XWHA 5FB0A 1WENA 4S3OB 3O36A 3O35A 4QF3A 4QF2A 4GNDA 4UP5A 3M99A 1WILA 2XB1A 4L58A 2CT2A 4A4CA 5LKZA 4FIPA 2M3HA 1WEUA 5LKTA 1WEOA 2L5UA 1DVPA 3N9QA 4GNGA 4FJCA 2LRIC 2EODA 2KR4A 4GNFA 2H0DB 2LV9A 2VJFA 2F6JA 1WESA 3U5MA 5D1MB 1Z6UA 2VPEA 4S3OC 2YURA 2MD8C 3EB6A 2LGVA 5B78A 4WA6A 2M1RA 4X3GA 1WEEA 2PNXA 1RMDA 5H1UA 3SHBA 4LKAA 2LGKA 2D8SA 2M85A 1WEMA 4YBTA 4CCGX 3LQIA 2CSYA 2YU4A 1F62A 4GNEA 5AIUA 4YAXA 4F52B 2ECJA 2EA6A 2LXPC 4L7XA 4UP0A 4I7DA 2KWOA 4NN2A 3HCTA 2VJEA 2VJFB 3N9LA 3I2DA 2AN6A 2KIZA 3EB5A 4LADB 1V87A 4BBQA 2QJ0A 2CSZA 1E4UA 4TKPB 2UZGA 5TBNA 2KGIA 5FB1A 4YC9A 1WFKA 1X4JA 1FBVA 4A0CD 4PPEA 2VP7A 5TRBA 5DINA 3PHDA 1ZBDB 3L1XA 5B8DA 4I7BA 5DKAA 1LDKC 2ECNA 2KWJA 2LXHC 5H1TA 3T7LA 3U5OA 5B79A 1HYJA 2KE1A 3O7AA 2VJEB 4YABA 5C13A 4GB0A 3SOXA 3LQHA 2VPBA 2VNFA 3GL6A 2YW8A 4YADA 3C6WA 3HCSA 1BORA 3ZNIA 2KFTA 3FL2A 3LRQA 3KV5A 4C9ZA 3O34A 5LCWB 1K2FA 5FERA 2YYRA 3ZVZB 1U6GB 3DQVR 2YSJA 4Q6FA 4IC2A 5H1VA 3T6RA 2LDRA 2K17A 2YUCA 2NAAA 2FSAA 5KH7A 2MNZA 4WZ0A 5B76A 2FUIA 4WZ2A 4CA1A 2G45A 1IYMA 3KNVA 2MA5A 2HDPA 4B86C 4AP4A 2ECGA 2I50A 4YBSA 4BHWA 5D1KB 4FK5A 1G25A 2IDAA 2K16A 3N9OA 2MD7B 2KWNA 5G0FA 3N9PA 5KH3A 1WEPA 5TDRA 5C11A 3C5KA 5KH9A 4IC3A 5JG6A 2LN0A 2FUUA 1WEVA 4XI1A 2MIQA 4R2YA 4A4BA 2LGGA 3LQJA 5TABA 3PURA 2MA6A 1LDJB 4AVXA 2VPDA 4B7YC 3ZPV1 3SOUA 2F42A 4UI9B 2KYUA 5H9MA 3NG2A 1X4UA 1VYXA 1WEWA 3ZVYA 1Z60A 2F6NA 2K4DA 3QZVA 5I3LA 2K1JA 4ZDTA 2G6QA 4YATA 4R7EA 2KREA 2ECTA 5G04B 2YT5A 2Y43A 1VFYA 4LJNA 3ZYQA 3O33A 4N4FA 2KGGA 1Z2QA 3SOWA 4A49A 2CKLA 3RPGB 1MM3A 1WIMA 2Y1NA 2YREA 4O64A 5EYAF 2ECWA 2BAYA 3M62A 3VK6A 4WZ3B 2YQLA 2EGPA 2L80A 2YHNA 5TDWA 4AUQB 1N87A 3ZPVE 3RTRB 2L0BA 2YHOA 4LLBA 3M63A 1JM7A 3ZTGA 2RSDA 4MSXA 2JMDA 2Y1MA 2JRJA 3KV6A 1CHCA 1X4IA 4R8PK 4LK9A 2KU3A 2MT5A 1MM2A 2L43A 4MVTA 5G05B 3RPGC 4PTBA 4N3WA 3MHHA 1WEQA 4ZQLA 1VD4A 5FEYA 4ZUXU 5LKUA 2CKLB 2LGLA 4YBMA 5J3XA 4AYCA 2ZETC 4P5OB 4FO9A 2ECIA 2MUMA 2YQMA 2JMJA 3U5NA 3L1ZB 2RI7A 2LQ6A 3HTKC 4W4UA 1WGMA 3N9MA 2DX8A 2QICA 2E6SA 2JMIA 2KWKA 2VPGA 2MNYA 2E6RA 1JM7B 3N9NA
chains in the Genus database with same CATH superfamily
1WE9A 2M6MA 2C2VS 3L11A 3V43A 3GV4A 5SVYA 2C2LA 1MBMA 5B75A 3MDBC 1HYIA 2PUYA 2HYED 2G43A 5B77A 3O70A 5AITA 3FM8C 5D1LB 3O37A 2ECVA 3MHSA 3DPLR 2XEUA 3HCUA 3KQIA 2OXQC 4I7CA 1JOCA 1FP0A 2P57A 2YSMA 4V3KC 2H0DA 4AYCB 4Z0RA 2L75A 5LKXA 4V3LC 3ASLA 3LVQE 3PUQA 3IHPA 1T1HA 2QIZA 3U5PA 1XWHA 5FB0A 1WENA 4S3OB 5SVIA 3O36A 3O35A 2LAUA 4QF3A 4QF2A 4GNDA 4UP5A 3M99A 1WILA 2XB1A 4L58A 2CT2A 4A4CA 5LKZA 4FIPA 2M3HA 1WEUA 5LKTA 3O47A 1WEOA 2L5UA 1DVPA 3N9QA 4GNGA 2M13A 4FJCA 2LRIC 2EODA 2KR4A 4GNFA 2H0DB 2LV9A 2VJFA 2F6JA 1WESA 3U5MA 5D1MB 1Z6UA 2VPEA 4S3OC 2YURA 2JM3A 2MD8C 3EB6A 2LGVA 5B78A 4WA6A 2M1RA 4X3GA 1WEEA 2PNXA 1RMDA 5H1UA 3SHBA 4LKAA 5SVIB 2LGKA 2D8SA 2M85A 1WEMA 4OGEA 4YBTA 4CCGX 3LQIA 2CSYA 3DDTA 2YU4A 1F62A 4GNEA 5AIUA 4YAXA 4F52B 2ECJA 2EA6A 2DSMA 2LXPC 3SUBA 1DCQA 2CONA 4L7XA 4UP0A 4I7DA 2KKXA 2KWOA 4NN2A 3HCTA 2VJEA 2VJFB 3N9LA 3I2DA 2AN6A 2KIZA 3EB5A 4LADB 1V87A 4BBQA 2RR4A 2QJ0A 2XOZA 2CSZA 1E4UA 4TKPB 2UZGA 5TBNA 2KGIA 3PLWA 3KDEC 5FB1A 3LVRE 4YC9A 1WFKA 1X4JA 2JUNA 1FBVA 4A0CD 4PPEA 2VP7A 5TRBA 5DINA 3PHDA 1ZBDB 3L1XA 3FJUB 2CRWA 5B8DA 4I7BA 5DKAA 1LDKC 2ECNA 2KWJA 2LXHC 5H1TA 3T7LA 2YVRA 2EGMA 3U5OA 5B79A 1HYJA 2KKYA 2KE1A 4OGCA 3O7AA 2VJEB 4YABA 5C13A 4GB0A 3SOXA 3LJUX 3LQHA 2VPBA 2VNFA 3GL6A 2YW8A 4YADA 3C6WA 3HCSA 1BORA 2FFWA 3ZNIA 2KFTA 3FL2A 3LRQA 3KV5A 4C9ZA 2XP0A 3O34A 2OWAA 5LCWB 1K2FA 5FERA 2YYRA 3ZVZB 1U6GB 3DQVR 2YSJA 4Q6FA 4IC2A 2MKEA 5H1VA 3T6RA 2LDRA 2K17A 2YUCA 2NAAA 2FSAA 5KH7A 2MNZA 4WZ0A 5B76A 2FUIA 4WZ2A 4CA1A 2G45A 1IYMA 3Q1DA 3KNVA 2MA5A 2HDPA 4B86C 4AP4A 2ECGA 2I50A 4YBSA 4BHWA 5D1KB 4FK5A 1G25A 2DJAA 2IDAA 2K16A 3N9OA 2MD7B 2KWNA 5G0FA 3N9PA 5KH3A 1WEPA 2E61A 5TDRA 5C11A 3C5KA 5KH9A 4IC3A 5JG6A 3M7KA 2LN0A 4Z0OA 2FUUA 1WEVA 2B0OE 4XI1A 2MIQA 4R2YA 4A4BA 2LGGA 2CRRA 3LQJA 5TABA 3PURA 2MA6A 1LDJB 4AVXA 2VPDA 4B7YC 3ZPV1 3SOUA 2EXUA 2F42A 4UI9B 2KYUA 5SVXA 5H9MA 3NG2A 5K3QA 1X4UA 1VYXA 3DWDA 1WEWA 3ZVYA 1Z60A 2XOCA 2F6NA 2K4DA 3QZVA 5I3LA 2K1JA 2D8UA 4ZDTA 2G6QA 4YATA 4R7EA 2KREA 2ECTA 5G04B 2YT5A 2Y43A 1VFYA 2IQJA 4LJNA 3ZYQA 3O33A 4N4FA 2KGGA 1Z2QA 3SOWA 4A49A 2CKLA 3RPGB 1MM3A 1WIMA 2Y1NA 2YREA 4O64A 3E2DA 3FAOA 5EYAF 2L7PA 3T9KA 2ECWA 2BAYA 3M62A 3FEHA 3VK6A 4WZ3B 2YQLA 2EGPA 2L80A 2YHNA 5TDWA 4AUQB 1N87A 3ZPVE 3RTRB 2L0BA 2YHOA 4LLBA 3M63A 4F1PA 1JM7A 3ZTGA 2RSDA 4MSXA 2JMDA 2Y1MA 2JRJA 3KV6A 3H7HA 1CHCA 1X4IA 4R8PK 4LK9A 2KU3A 2MT5A 1MM2A 2L43A 4MVTA 5G05B 3RPGC 4PTBA 4N3WA 3MHHA 4QQ4A 1WEQA 4ZQLA 1VD4A 4O62A 5FEYA 2XOYA 4ZUXU 5LKUA 2CKLB 2LGLA 4YBMA 5J3XA 4AYCA 2ZETC 4P5OB 2CSVA 2ECIA 2MUMA 4FO9A 3FANA 2YQMA 2JMJA 3U5NA 3L1ZB 2RI7A 2LQ6A 3HTKC 4W4UA 1WGMA 2FD4A 3N9MA 2DX8A 2QICA 2E6SA 3JUEA 2JMIA 2KWKA 2VPGA 2MNYA 2E6RA 1JM7B 4H9DA 3LDYA 3N9NA
chains in the Genus database with same CATH topology
1WE9A 2M6MA 2C2VS 3L11A 3V43A 3GV4A 2C2LA 5B75A 1HYIA 2PUYA 2HYED 2G43A 5B77A 3O70A 5AITA 5D1LB 3O37A 2ECVA 3MHSA 3DPLR 2XEUA 3HCUA 3KQIA 2OXQC 4I7CA 1JOCA 1FP0A 2YSMA 4V3KC 2H0DA 4AYCB 2L75A 5LKXA 4V3LC 3ASLA 3PUQA 3IHPA 1T1HA 2QIZA 3U5PA 1XWHA 5FB0A 1WENA 4S3OB 3O36A 3O35A 4QF3A 4QF2A 4GNDA 4UP5A 3M99A 1WILA 2XB1A 4L58A 2CT2A 4A4CA 5LKZA 4FIPA 2M3HA 1WEUA 5LKTA 1WEOA 2L5UA 1DVPA 3N9QA 4GNGA 4FJCA 2LRIC 2EODA 2KR4A 4GNFA 2H0DB 2LV9A 2VJFA 2F6JA 1WESA 3U5MA 5D1MB 1Z6UA 2VPEA 4S3OC 2YURA 2MD8C 3EB6A 2LGVA 5B78A 4WA6A 2M1RA 4X3GA 1WEEA 2PNXA 1RMDA 5H1UA 3SHBA 4LKAA 2LGKA 2D8SA 2M85A 1WEMA 4YBTA 4CCGX 3LQIA 2CSYA 2YU4A 1F62A 4GNEA 5AIUA 4YAXA 4F52B 2ECJA 2EA6A 2LXPC 4L7XA 4UP0A 4I7DA 2KWOA 4NN2A 3HCTA 2VJEA 2VJFB 3N9LA 3I2DA 2AN6A 2KIZA 3EB5A 4LADB 1V87A 4BBQA 2QJ0A 2CSZA 1E4UA 4TKPB 2UZGA 5TBNA 2KGIA 5FB1A 4YC9A 1WFKA 1X4JA 1FBVA 4A0CD 4PPEA 2VP7A 5TRBA 5DINA 3PHDA 1ZBDB 3L1XA 5B8DA 4I7BA 5DKAA 1LDKC 2ECNA 2KWJA 2LXHC 5H1TA 3T7LA 3U5OA 5B79A 1HYJA 2KE1A 3O7AA 2VJEB 4YABA 5C13A 4GB0A 3SOXA 3LQHA 2VPBA 2VNFA 3GL6A 2YW8A 4YADA 3C6WA 3HCSA 1BORA 3ZNIA 2KFTA 3FL2A 3LRQA 3KV5A 4C9ZA 3O34A 5LCWB 1K2FA 5FERA 2YYRA 3ZVZB 1U6GB 3DQVR 2YSJA 4Q6FA 4IC2A 5H1VA 3T6RA 2LDRA 2K17A 2YUCA 2NAAA 2FSAA 5KH7A 2MNZA 4WZ0A 5B76A 2FUIA 4WZ2A 4CA1A 2G45A 1IYMA 3KNVA 2MA5A 2HDPA 4B86C 4AP4A 2ECGA 2I50A 4YBSA 4BHWA 5D1KB 4FK5A 1G25A 2IDAA 2K16A 3N9OA 2MD7B 2KWNA 5G0FA 3N9PA 5KH3A 1WEPA 5TDRA 5C11A 3C5KA 5KH9A 4IC3A 5JG6A 2LN0A 2FUUA 1WEVA 4XI1A 2MIQA 4R2YA 4A4BA 2LGGA 3LQJA 5TABA 3PURA 2MA6A 1LDJB 4AVXA 2VPDA 4B7YC 3ZPV1 3SOUA 2F42A 4UI9B 2KYUA 5H9MA 3NG2A 1X4UA 1VYXA 1WEWA 3ZVYA 1Z60A 2F6NA 2K4DA 3QZVA 5I3LA 2K1JA 4ZDTA 2G6QA 4YATA 4R7EA 2KREA 2ECTA 5G04B 2YT5A 2Y43A 1VFYA 4LJNA 3ZYQA 3O33A 4N4FA 2KGGA 1Z2QA 3SOWA 4A49A 2CKLA 3RPGB 1MM3A 1WIMA 2Y1NA 2YREA 4O64A 5EYAF 2ECWA 2BAYA 3M62A 3VK6A 4WZ3B 2YQLA 2EGPA 2L80A 2YHNA 5TDWA 4AUQB 1N87A 3ZPVE 3RTRB 2L0BA 2YHOA 4LLBA 3M63A 1JM7A 3ZTGA 2RSDA 4MSXA 2JMDA 2Y1MA 2JRJA 3KV6A 1CHCA 1X4IA 4R8PK 4LK9A 2KU3A 2MT5A 1MM2A 2L43A 4MVTA 5G05B 3RPGC 4PTBA 4N3WA 3MHHA 1WEQA 4ZQLA 1VD4A 5FEYA 4ZUXU 5LKUA 2CKLB 2LGLA 4YBMA 5J3XA 4AYCA 2ZETC 4P5OB 4FO9A 2ECIA 2MUMA 2YQMA 2JMJA 3U5NA 3L1ZB 2RI7A 2LQ6A 3HTKC 4W4UA 1WGMA 3N9MA 2DX8A 2QICA 2E6SA 2JMIA 2KWKA 2VPGA 2MNYA 2E6RA 1JM7B 3N9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE9 A;  2M6M A;  2C2V S;  3L11 A;  3V43 A;  3GV4 A;  2C2L A;  5B75 A;  1HYI A;  2PUY A;  2HYE D;  2G43 A;  5B77 A;  3O70 A;  5AIT A;  5D1L B;  3O37 A;  2ECV A;  3MHS A;  3DPL R;  2XEU A;  3HCU A;  3KQI A;  2OXQ C;  4I7C A;  1JOC A;  1FP0 A;  2YSM A;  4V3K C;  2H0D A;  4AYC B;  2L75 A;  5LKX A;  4V3L C;  3ASL A;  3PUQ A;  3IHP A;  1T1H A;  2QIZ A;  3U5P A;  1XWH A;  5FB0 A;  1WEN A;  4S3O B;  3O36 A;  3O35 A;  4QF3 A;  4QF2 A;  4GND A;  4UP5 A;  3M99 A;  1WIL A;  2XB1 A;  4L58 A;  2CT2 A;  4A4C A;  5LKZ A;  4FIP A;  2M3H A;  1WEU A;  5LKT A;  1WEO A;  2L5U A;  1DVP A;  3N9Q A;  4GNG A;  4FJC A;  2LRI C;  2EOD A;  2KR4 A;  4GNF A;  2H0D B;  2LV9 A;  2VJF A;  2F6J A;  1WES A;  3U5M A;  5D1M B;  1Z6U A;  2VPE A;  4S3O C;  2YUR A;  2MD8 C;  3EB6 A;  2LGV A;  5B78 A;  4WA6 A;  2M1R A;  4X3G A;  1WEE A;  2PNX A;  1RMD A;  5H1U A;  3SHB A;  4LKA A;  2LGK A;  2D8S A;  2M85 A;  1WEM A;  4YBT A;  4CCG X;  3LQI A;  2CSY A;  2YU4 A;  1F62 A;  4GNE A;  5AIU A;  4YAX A;  4F52 B;  2ECJ A;  2EA6 A;  2LXP C;  4L7X A;  4UP0 A;  4I7D A;  2KWO A;  4NN2 A;  3HCT A;  2VJE A;  2VJF B;  3N9L A;  3I2D A;  2AN6 A;  2KIZ A;  3EB5 A;  4LAD B;  1V87 A;  4BBQ A;  2QJ0 A;  2CSZ A;  1E4U A;  4TKP B;  2UZG A;  5TBN A;  2KGI A;  5FB1 A;  4YC9 A;  1WFK A;  1X4J A;  1FBV A;  4A0C D;  4PPE A;  2VP7 A;  5TRB A;  5DIN A;  3PHD A;  1ZBD B;  3L1X A;  5B8D A;  4I7B A;  5DKA A;  1LDK C;  2ECN A;  2KWJ A;  2LXH C;  5H1T A;  3T7L A;  3U5O A;  5B79 A;  1HYJ A;  2KE1 A;  3O7A A;  2VJE B;  4YAB A;  5C13 A;  4GB0 A;  3SOX A;  3LQH A;  2VPB A;  2VNF A;  3GL6 A;  2YW8 A;  4YAD A;  3C6W A;  3HCS A;  1BOR A;  3ZNI A;  2KFT A;  3FL2 A;  3LRQ A;  3KV5 A;  4C9Z A;  3O34 A;  5LCW B;  1K2F A;  5FER A;  2YYR A;  3ZVZ B;  1U6G B;  3DQV R;  2YSJ A;  4Q6F A;  4IC2 A;  5H1V A;  3T6R A;  2LDR A;  2K17 A;  2YUC A;  2NAA A;  2FSA A;  5KH7 A;  2MNZ A;  4WZ0 A;  5B76 A;  2FUI A;  4WZ2 A;  4CA1 A;  2G45 A;  1IYM A;  3KNV A;  2MA5 A;  2HDP A;  4B86 C;  4AP4 A;  2ECG A;  2I50 A;  4YBS A;  4BHW A;  5D1K B;  4FK5 A;  1G25 A;  2IDA A;  2K16 A;  3N9O A;  2MD7 B;  2KWN A;  5G0F A;  3N9P A;  5KH3 A;  1WEP A;  5TDR A;  5C11 A;  3C5K A;  5KH9 A;  4IC3 A;  5JG6 A;  2LN0 A;  2FUU A;  1WEV A;  4XI1 A;  2MIQ A;  4R2Y A;  4A4B A;  2LGG A;  3LQJ A;  5TAB A;  3PUR A;  2MA6 A;  1LDJ B;  4AVX A;  2VPD A;  4B7Y C;  3ZPV 1;  3SOU A;  2F42 A;  4UI9 B;  2KYU A;  5H9M A;  3NG2 A;  1X4U A;  1VYX A;  1WEW A;  3ZVY A;  1Z60 A;  2F6N A;  2K4D A;  3QZV A;  5I3L A;  2K1J A;  4ZDT A;  2G6Q A;  4YAT A;  4R7E A;  2KRE A;  2ECT A;  5G04 B;  2YT5 A;  2Y43 A;  1VFY A;  4LJN A;  3ZYQ A;  3O33 A;  4N4F A;  2KGG A;  1Z2Q A;  3SOW A;  4A49 A;  2CKL A;  3RPG B;  1MM3 A;  1WIM A;  2Y1N A;  2YRE A;  4O64 A;  5EYA F;  2ECW A;  2BAY A;  3M62 A;  3VK6 A;  4WZ3 B;  2YQL A;  2EGP A;  2L80 A;  2YHN A;  5TDW A;  4AUQ B;  1N87 A;  3ZPV E;  3RTR B;  2L0B A;  2YHO A;  4LLB A;  3M63 A;  1JM7 A;  3ZTG A;  2RSD A;  4MSX A;  2JMD A;  2Y1M A;  2JRJ A;  3KV6 A;  1CHC A;  1X4I A;  4R8P K;  4LK9 A;  2KU3 A;  2MT5 A;  1MM2 A;  2L43 A;  4MVT A;  5G05 B;  3RPG C;  4PTB A;  4N3W A;  3MHH A;  1WEQ A;  4ZQL A;  1VD4 A;  5FEY A;  4ZUX U;  5LKU A;  2CKL B;  2LGL A;  4YBM A;  5J3X A;  4AYC A;  2ZET C;  4P5O B;  4FO9 A;  2ECI A;  2MUM A;  2YQM A;  2JMJ A;  3U5N A;  3L1Z B;  2RI7 A;  2LQ6 A;  3HTK C;  4W4U A;  1WGM A;  3N9M A;  2DX8 A;  2QIC A;  2E6S A;  2JMI A;  2KWK A;  2VPG A;  2MNY A;  2E6R A;  1JM7 B;  3N9N A; 
#chains in the Genus database with same CATH topology
 1WE9 A;  2M6M A;  2C2V S;  3L11 A;  3V43 A;  3GV4 A;  5SVY A;  2C2L A;  1MBM A;  5B75 A;  3MDB C;  1HYI A;  2PUY A;  2HYE D;  2G43 A;  5B77 A;  3O70 A;  5AIT A;  3FM8 C;  5D1L B;  3O37 A;  2ECV A;  3MHS A;  3DPL R;  2XEU A;  3HCU A;  3KQI A;  2OXQ C;  4I7C A;  1JOC A;  1FP0 A;  2P57 A;  2YSM A;  4V3K C;  2H0D A;  4AYC B;  4Z0R A;  2L75 A;  5LKX A;  4V3L C;  3ASL A;  3LVQ E;  3PUQ A;  3IHP A;  1T1H A;  2QIZ A;  3U5P A;  1XWH A;  5FB0 A;  1WEN A;  4S3O B;  5SVI A;  3O36 A;  3O35 A;  2LAU A;  4QF3 A;  4QF2 A;  4GND A;  4UP5 A;  3M99 A;  1WIL A;  2XB1 A;  4L58 A;  2CT2 A;  4A4C A;  5LKZ A;  4FIP A;  2M3H A;  1WEU A;  5LKT A;  3O47 A;  1WEO A;  2L5U A;  1DVP A;  3N9Q A;  4GNG A;  2M13 A;  4FJC A;  2LRI C;  2EOD A;  2KR4 A;  4GNF A;  2H0D B;  2LV9 A;  2VJF A;  2F6J A;  1WES A;  3U5M A;  5D1M B;  1Z6U A;  2VPE A;  4S3O C;  2YUR A;  2JM3 A;  2MD8 C;  3EB6 A;  2LGV A;  5B78 A;  4WA6 A;  2M1R A;  4X3G A;  1WEE A;  2PNX A;  1RMD A;  5H1U A;  3SHB A;  4LKA A;  5SVI B;  2LGK A;  2D8S A;  2M85 A;  1WEM A;  4OGE A;  4YBT A;  4CCG X;  3LQI A;  2CSY A;  3DDT A;  2YU4 A;  1F62 A;  4GNE A;  5AIU A;  4YAX A;  4F52 B;  2ECJ A;  2EA6 A;  2DSM A;  2LXP C;  3SUB A;  1DCQ A;  2CON A;  4L7X A;  4UP0 A;  4I7D A;  2KKX A;  2KWO A;  4NN2 A;  3HCT A;  2VJE A;  2VJF B;  3N9L A;  3I2D A;  2AN6 A;  2KIZ A;  3EB5 A;  4LAD B;  1V87 A;  4BBQ A;  2RR4 A;  2QJ0 A;  2XOZ A;  2CSZ A;  1E4U A;  4TKP B;  2UZG A;  5TBN A;  2KGI A;  3PLW A;  3KDE C;  5FB1 A;  3LVR E;  4YC9 A;  1WFK A;  1X4J A;  2JUN A;  1FBV A;  4A0C D;  4PPE A;  2VP7 A;  5TRB A;  5DIN A;  3PHD A;  1ZBD B;  3L1X A;  3FJU B;  2CRW A;  5B8D A;  4I7B A;  5DKA A;  1LDK C;  2ECN A;  2KWJ A;  2LXH C;  5H1T A;  3T7L A;  2YVR A;  2EGM A;  3U5O A;  5B79 A;  1HYJ A;  2KKY A;  2KE1 A;  4OGC A;  3O7A A;  2VJE B;  4YAB A;  5C13 A;  4GB0 A;  3SOX A;  3LJU X;  3LQH A;  2VPB A;  2VNF A;  3GL6 A;  2YW8 A;  4YAD A;  3C6W A;  3HCS A;  1BOR A;  2FFW A;  3ZNI A;  2KFT A;  3FL2 A;  3LRQ A;  3KV5 A;  4C9Z A;  2XP0 A;  3O34 A;  2OWA A;  5LCW B;  1K2F A;  5FER A;  2YYR A;  3ZVZ B;  1U6G B;  3DQV R;  2YSJ A;  4Q6F A;  4IC2 A;  2MKE A;  5H1V A;  3T6R A;  2LDR A;  2K17 A;  2YUC A;  2NAA A;  2FSA A;  5KH7 A;  2MNZ A;  4WZ0 A;  5B76 A;  2FUI A;  4WZ2 A;  4CA1 A;  2G45 A;  1IYM A;  3Q1D A;  3KNV A;  2MA5 A;  2HDP A;  4B86 C;  4AP4 A;  2ECG A;  2I50 A;  4YBS A;  4BHW A;  5D1K B;  4FK5 A;  1G25 A;  2DJA A;  2IDA A;  2K16 A;  3N9O A;  2MD7 B;  2KWN A;  5G0F A;  3N9P A;  5KH3 A;  1WEP A;  2E61 A;  5TDR A;  5C11 A;  3C5K A;  5KH9 A;  4IC3 A;  5JG6 A;  3M7K A;  2LN0 A;  4Z0O A;  2FUU A;  1WEV A;  2B0O E;  4XI1 A;  2MIQ A;  4R2Y A;  4A4B A;  2LGG A;  2CRR A;  3LQJ A;  5TAB A;  3PUR A;  2MA6 A;  1LDJ B;  4AVX A;  2VPD A;  4B7Y C;  3ZPV 1;  3SOU A;  2EXU A;  2F42 A;  4UI9 B;  2KYU A;  5SVX A;  5H9M A;  3NG2 A;  5K3Q A;  1X4U A;  1VYX A;  3DWD A;  1WEW A;  3ZVY A;  1Z60 A;  2XOC A;  2F6N A;  2K4D A;  3QZV A;  5I3L A;  2K1J A;  2D8U A;  4ZDT A;  2G6Q A;  4YAT A;  4R7E A;  2KRE A;  2ECT A;  5G04 B;  2YT5 A;  2Y43 A;  1VFY A;  2IQJ A;  4LJN A;  3ZYQ A;  3O33 A;  4N4F A;  2KGG A;  1Z2Q A;  3SOW A;  4A49 A;  2CKL A;  3RPG B;  1MM3 A;  1WIM A;  2Y1N A;  2YRE A;  4O64 A;  3E2D A;  3FAO A;  5EYA F;  2L7P A;  3T9K A;  2ECW A;  2BAY A;  3M62 A;  3FEH A;  3VK6 A;  4WZ3 B;  2YQL A;  2EGP A;  2L80 A;  2YHN A;  5TDW A;  4AUQ B;  1N87 A;  3ZPV E;  3RTR B;  2L0B A;  2YHO A;  4LLB A;  3M63 A;  4F1P A;  1JM7 A;  3ZTG A;  2RSD A;  4MSX A;  2JMD A;  2Y1M A;  2JRJ A;  3KV6 A;  3H7H A;  1CHC A;  1X4I A;  4R8P K;  4LK9 A;  2KU3 A;  2MT5 A;  1MM2 A;  2L43 A;  4MVT A;  5G05 B;  3RPG C;  4PTB A;  4N3W A;  3MHH A;  4QQ4 A;  1WEQ A;  4ZQL A;  1VD4 A;  4O62 A;  5FEY A;  2XOY A;  4ZUX U;  5LKU A;  2CKL B;  2LGL A;  4YBM A;  5J3X A;  4AYC A;  2ZET C;  4P5O B;  2CSV A;  2ECI A;  2MUM A;  4FO9 A;  3FAN A;  2YQM A;  2JMJ A;  3U5N A;  3L1Z B;  2RI7 A;  2LQ6 A;  3HTK C;  4W4U A;  1WGM A;  2FD4 A;  3N9M A;  2DX8 A;  2QIC A;  2E6S A;  3JUE A;  2JMI A;  2KWK A;  2VPG A;  2MNY A;  2E6R A;  1JM7 B;  4H9D A;  3LDY A;  3N9N A; 
#chains in the Genus database with same CATH homology
 1WE9 A;  2M6M A;  2C2V S;  3L11 A;  3V43 A;  3GV4 A;  2C2L A;  5B75 A;  1HYI A;  2PUY A;  2HYE D;  2G43 A;  5B77 A;  3O70 A;  5AIT A;  5D1L B;  3O37 A;  2ECV A;  3MHS A;  3DPL R;  2XEU A;  3HCU A;  3KQI A;  2OXQ C;  4I7C A;  1JOC A;  1FP0 A;  2YSM A;  4V3K C;  2H0D A;  4AYC B;  2L75 A;  5LKX A;  4V3L C;  3ASL A;  3PUQ A;  3IHP A;  1T1H A;  2QIZ A;  3U5P A;  1XWH A;  5FB0 A;  1WEN A;  4S3O B;  3O36 A;  3O35 A;  4QF3 A;  4QF2 A;  4GND A;  4UP5 A;  3M99 A;  1WIL A;  2XB1 A;  4L58 A;  2CT2 A;  4A4C A;  5LKZ A;  4FIP A;  2M3H A;  1WEU A;  5LKT A;  1WEO A;  2L5U A;  1DVP A;  3N9Q A;  4GNG A;  4FJC A;  2LRI C;  2EOD A;  2KR4 A;  4GNF A;  2H0D B;  2LV9 A;  2VJF A;  2F6J A;  1WES A;  3U5M A;  5D1M B;  1Z6U A;  2VPE A;  4S3O C;  2YUR A;  2MD8 C;  3EB6 A;  2LGV A;  5B78 A;  4WA6 A;  2M1R A;  4X3G A;  1WEE A;  2PNX A;  1RMD A;  5H1U A;  3SHB A;  4LKA A;  2LGK A;  2D8S A;  2M85 A;  1WEM A;  4YBT A;  4CCG X;  3LQI A;  2CSY A;  2YU4 A;  1F62 A;  4GNE A;  5AIU A;  4YAX A;  4F52 B;  2ECJ A;  2EA6 A;  2LXP C;  4L7X A;  4UP0 A;  4I7D A;  2KWO A;  4NN2 A;  3HCT A;  2VJE A;  2VJF B;  3N9L A;  3I2D A;  2AN6 A;  2KIZ A;  3EB5 A;  4LAD B;  1V87 A;  4BBQ A;  2QJ0 A;  2CSZ A;  1E4U A;  4TKP B;  2UZG A;  5TBN A;  2KGI A;  5FB1 A;  4YC9 A;  1WFK A;  1X4J A;  1FBV A;  4A0C D;  4PPE A;  2VP7 A;  5TRB A;  5DIN A;  3PHD A;  1ZBD B;  3L1X A;  5B8D A;  4I7B A;  5DKA A;  1LDK C;  2ECN A;  2KWJ A;  2LXH C;  5H1T A;  3T7L A;  3U5O A;  5B79 A;  1HYJ A;  2KE1 A;  3O7A A;  2VJE B;  4YAB A;  5C13 A;  4GB0 A;  3SOX A;  3LQH A;  2VPB A;  2VNF A;  3GL6 A;  2YW8 A;  4YAD A;  3C6W A;  3HCS A;  1BOR A;  3ZNI A;  2KFT A;  3FL2 A;  3LRQ A;  3KV5 A;  4C9Z A;  3O34 A;  5LCW B;  1K2F A;  5FER A;  2YYR A;  3ZVZ B;  1U6G B;  3DQV R;  2YSJ A;  4Q6F A;  4IC2 A;  5H1V A;  3T6R A;  2LDR A;  2K17 A;  2YUC A;  2NAA A;  2FSA A;  5KH7 A;  2MNZ A;  4WZ0 A;  5B76 A;  2FUI A;  4WZ2 A;  4CA1 A;  2G45 A;  1IYM A;  3KNV A;  2MA5 A;  2HDP A;  4B86 C;  4AP4 A;  2ECG A;  2I50 A;  4YBS A;  4BHW A;  5D1K B;  4FK5 A;  1G25 A;  2IDA A;  2K16 A;  3N9O A;  2MD7 B;  2KWN A;  5G0F A;  3N9P A;  5KH3 A;  1WEP A;  5TDR A;  5C11 A;  3C5K A;  5KH9 A;  4IC3 A;  5JG6 A;  2LN0 A;  2FUU A;  1WEV A;  4XI1 A;  2MIQ A;  4R2Y A;  4A4B A;  2LGG A;  3LQJ A;  5TAB A;  3PUR A;  2MA6 A;  1LDJ B;  4AVX A;  2VPD A;  4B7Y C;  3ZPV 1;  3SOU A;  2F42 A;  4UI9 B;  2KYU A;  5H9M A;  3NG2 A;  1X4U A;  1VYX A;  1WEW A;  3ZVY A;  1Z60 A;  2F6N A;  2K4D A;  3QZV A;  5I3L A;  2K1J A;  4ZDT A;  2G6Q A;  4YAT A;  4R7E A;  2KRE A;  2ECT A;  5G04 B;  2YT5 A;  2Y43 A;  1VFY A;  4LJN A;  3ZYQ A;  3O33 A;  4N4F A;  2KGG A;  1Z2Q A;  3SOW A;  4A49 A;  2CKL A;  3RPG B;  1MM3 A;  1WIM A;  2Y1N A;  2YRE A;  4O64 A;  5EYA F;  2ECW A;  2BAY A;  3M62 A;  3VK6 A;  4WZ3 B;  2YQL A;  2EGP A;  2L80 A;  2YHN A;  5TDW A;  4AUQ B;  1N87 A;  3ZPV E;  3RTR B;  2L0B A;  2YHO A;  4LLB A;  3M63 A;  1JM7 A;  3ZTG A;  2RSD A;  4MSX A;  2JMD A;  2Y1M A;  2JRJ A;  3KV6 A;  1CHC A;  1X4I A;  4R8P K;  4LK9 A;  2KU3 A;  2MT5 A;  1MM2 A;  2L43 A;  4MVT A;  5G05 B;  3RPG C;  4PTB A;  4N3W A;  3MHH A;  1WEQ A;  4ZQL A;  1VD4 A;  5FEY A;  4ZUX U;  5LKU A;  2CKL B;  2LGL A;  4YBM A;  5J3X A;  4AYC A;  2ZET C;  4P5O B;  4FO9 A;  2ECI A;  2MUM A;  2YQM A;  2JMJ A;  3U5N A;  3L1Z B;  2RI7 A;  2LQ6 A;  3HTK C;  4W4U A;  1WGM A;  3N9M A;  2DX8 A;  2QIC A;  2E6S A;  2JMI A;  2KWK A;  2VPG A;  2MNY A;  2E6R A;  1JM7 B;  3N9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...