1MM2A

Solution structure of the 2nd phd domain from mi2b
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
61
structure length
61
Chain Sequence
GPLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Mi2-beta
publication title Engineering a Protein Scaffold from a PHD Finger
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 61
sequence length 61
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1mm2A00
4GNEA 2L43A 2D8SA 2CT2A 2RI7A 2VPEA 1WENA 4YADA 3ZVYA 5LKXA 2G43A 4ZQLA 4I7CA 2LQ6A 4AVXA 3C6WA 5TBNA 2LRIC 2M1RA 2H0DB 2F6NA 3N9OA 4XI1A 4YAXA 2EODA 2NAAA 3M62A 5D1LB 2QIZA 3EB6A 2PNXA 3O35A 2F42A 2VJFB 4O64A 2ECGA 2YUCA 5C11A 3ZTGA 5LKZA 2YT5A 1HYIA 3O37A 3C5KA 1X4JA 2LXHC 4A0CD 4B86C 1MM2A 3T6RA 1FP0A 3PUQA 5TDWA 3U5MA 3DQVR 5H1TA 4B7YC 2LGLA 3L11A 4F52B 2KU3A 4CA1A 4LADB 4WZ3B 4YATA 2MNYA 3KNVA 3ZYQA 4LKAA 5H1VA 4L7XA 3KV6A 4V3LC 5FEYA 3QZVA 1HYJA 5TABA 4I7BA 4YBTA 3ZPV1 4IC2A 4NN2A 1Z60A 5KH3A 3LQIA 2LV9A 3M99A 3SHBA 1T1HA 1RMDA 2ECVA 1CHCA 5J3XA 2G6QA 1V87A 2EA6A 5AIUA 2AN6A 2FUUA 3IHPA 1X4IA 2YSJA 2JRJA 2JMIA 2YREA 1WE9A 2KGIA 2LGGA 4AP4A 3SOUA 1WEOA 3ZVZB 1JM7A 2MD8C 2LN0A 3RPGC 2YU4A 3U5NA 2CSYA 3LQJA 2XEUA 2YURA 1VFYA 2MD7B 2VNFA 4Q6FA 4R8PK 4AUQB 2YHOA 2VP7A 2KGGA 4WZ0A 3L1ZB 5FERA 3N9PA 4BBQA 2E6SA 4L58A 2KR4A 1BORA 2CSZA 2FSAA 2KWJA 4C9ZA 5H1UA 5G05B 5JG6A 2KREA 2M85A 1E4UA 2LXPC 2MA5A 2VPGA 4GNFA 2G45A 5AITA 2ECWA 2K17A 3ZPVE 3LQHA 2ECJA 2L0BA 2VJEA 4WZ2A 5D1MB 2K16A 2K4DA 3DPLR 4QF3A 1JM7B 4BHWA 4TKPB 5B76A 3GL6A 1VD4A 5FB0A 2LGVA 2C2LA 3V43A 1WFKA 5LCWB 2ECNA 2KE1A 1K2FA 4GNDA 2F6JA 2K1JA 1WEVA 2IDAA 4A4BA 1ZBDB 1JOCA 2OXQC 3O33A 4YC9A 4CCGX 2Y43A 2HYED 5LKUA 5D1KB 1WIMA 2MNZA 4N4FA 5I3LA 4ZUXU 3NG2A 3HCTA 5DKAA 1U6GB 5B77A 2RSDA 1N87A 4PPEA 2VPDA 3I2DA 2I50A 4YBSA 2KWOA 3MHHA 2HDPA 2DX8A 4FO9A 2BAYA 4R2YA 3ASLA 1Z6UA 1FBVA 2VJEB 2M6MA 4WA6A 4ZDTA 2L5UA 3KQIA 2FUIA 2CKLA 5G04B 4S3OB 4FJCA 5KH9A 1WILA 1VYXA 2JMDA 3N9MA 4YABA 3GV4A 3N9LA 3RTRB 2YYRA 1Z2QA 4MVTA 1IYMA 4AYCA 2KYUA 1WEEA 2MUMA 3O7AA 3SOWA 4A4CA 5TDRA 2LDRA 2E6RA 2YW8A 4I7DA 3PURA 4IC3A 4GB0A 3M63A 2ECTA 2MT5A 2XB1A 2ZETC 3HCSA 2PUYA 2VPBA 4UI9B 3PHDA 5FB1A 2LGKA 1LDJB 3EB5A 3ZNIA 4GNGA 1WESA 2C2VS 2KWKA 5EYAF 2KFTA 3L1XA 2KWNA 3O36A 1WEQA 4W4UA 4PTBA 3U5PA 3HTKC 1WEPA 2CKLB 5TRBA 1WEWA 2YHNA 3O34A 1WEMA 4YBMA 3N9NA 2KIZA 4FIPA 3VK6A 4AYCB 1WEUA 5B79A 4FK5A 3FL2A 5KH7A 4UP0A 5H9MA 4P5OB 2Y1MA 5B78A 1LDKC 2L75A 4A49A 4LJNA 2QJ0A 2JMJA 4R7EA 4V3KC 3LRQA 1XWHA 1DVPA 4UP5A 4LK9A 2QICA 1F62A 4QF2A 2H0DA 3N9QA 4LLBA 4MSXA 5B8DA 2MIQA 2ECIA 3SOXA 3KV5A 2VJFA 3T7LA 5B75A 2EGPA 2Y1NA 1X4UA 3RPGB 2MA6A 5G0FA 1G25A 3HCUA 2L80A 3MHSA 2UZGA 1WGMA 4S3OC 5LKTA 4X3GA 5C13A 3U5OA 2M3HA 2YSMA 1MM3A 2YQMA 3O70A 5DINA 4N3WA 2YQLA
chains in the Genus database with same CATH superfamily
4GNEA 2L43A 2D8SA 2CT2A 2RI7A 2VPEA 1WENA 4YADA 3ZVYA 5LKXA 2FD4A 2G43A 2YVRA 4ZQLA 4I7CA 2DJAA 2P57A 2LQ6A 4AVXA 3C6WA 5TBNA 2MKEA 3M7KA 2LRIC 2E61A 2M1RA 2H0DB 2F6NA 3N9OA 4XI1A 4YAXA 2EODA 2NAAA 3M62A 5D1LB 2QIZA 3EB6A 2PNXA 3O35A 2F42A 2VJFB 4O64A 2ECGA 2YUCA 5C11A 3ZTGA 5LKZA 2OWAA 2YT5A 1HYIA 4F1PA 3O37A 3C5KA 1X4JA 2LXHC 4A0CD 4B86C 1MM2A 3T6RA 1FP0A 3PUQA 5TDWA 3U5MA 3DQVR 5H1TA 4B7YC 2LGLA 3L11A 4F52B 2KU3A 4CA1A 4LADB 5SVXA 5SVIB 4Z0RA 4WZ3B 4YATA 2MNYA 3KNVA 3ZYQA 4LKAA 5H1VA 4L7XA 3O47A 3KV6A 4V3LC 5FEYA 3QZVA 2KKYA 3E2DA 5TABA 1HYJA 4I7BA 4YBTA 3ZPV1 4IC2A 4NN2A 1Z60A 5KH3A 3LQIA 3T9KA 2LV9A 3M99A 3SHBA 1T1HA 1RMDA 2L7PA 2ECVA 3FAOA 1CHCA 5J3XA 5SVYA 2G6QA 2DSMA 1V87A 2EA6A 5AIUA 2AN6A 2FUUA 3IHPA 1X4IA 2YSJA 2JM3A 2JRJA 2JMIA 2YREA 1WE9A 2KGIA 2LGGA 4AP4A 3SOUA 1WEOA 3ZVZB 1JM7A 2MD8C 4OGCA 3PLWA 2LN0A 3RPGC 2YU4A 3U5NA 2CSYA 3LQJA 2XEUA 3LVRE 3KDEC 2YURA 1VFYA 5K3QA 2MD7B 2VNFA 3H7HA 4Q6FA 4R8PK 4AUQB 2YHOA 2VP7A 2KGGA 4WZ0A 3L1ZB 2CRRA 5FERA 1DCQA 2XOZA 3N9PA 4BBQA 2E6SA 2LAUA 4L58A 2CSVA 2KR4A 1BORA 2CSZA 2FSAA 2KWJA 4C9ZA 5H1UA 5G05B 5JG6A 2KREA 2M85A 1E4UA 3MDBC 2LXPC 2MA5A 2VPGA 4GNFA 2G45A 5AITA 2ECWA 4H9DA 2K17A 3ZPVE 3LQHA 2ECJA 2L0BA 2VJEA 4WZ2A 5D1MB 2K16A 2K4DA 3DPLR 4QF3A 1JM7B 4BHWA 4TKPB 5B76A 3FEHA 3GL6A 1VD4A 5FB0A 2LGVA 2C2LA 3V43A 1WFKA 5LCWB 2ECNA 2KE1A 2FFWA 1K2FA 4GNDA 2F6JA 2K1JA 1WEVA 2IDAA 4A4BA 1ZBDB 1JOCA 2OXQC 1MBMA 3O33A 4YC9A 4CCGX 2Y43A 2HYED 5LKUA 5D1KB 1WIMA 2MNZA 4N4FA 5I3LA 4ZUXU 3NG2A 3HCTA 5DKAA 1U6GB 2XP0A 5B77A 2RSDA 1N87A 4PPEA 2VPDA 3I2DA 2RR4A 2B0OE 2I50A 4YBSA 2KWOA 3MHHA 2HDPA 2EGMA 2DX8A 4FO9A 2BAYA 4R2YA 3ASLA 1Z6UA 1FBVA 2VJEB 2M6MA 4WA6A 4ZDTA 2L5UA 3FANA 2EXUA 3KQIA 2FUIA 2CKLA 5G04B 4S3OB 4FJCA 5KH9A 2XOCA 3DDTA 1WILA 1VYXA 2JMDA 3DWDA 3N9MA 4YABA 3GV4A 3N9LA 3RTRB 2YYRA 3FM8C 1Z2QA 4MVTA 1IYMA 4AYCA 2KYUA 1WEEA 3LDYA 2MUMA 3O7AA 3SOWA 4A4CA 2JUNA 4O62A 5TDRA 3LJUX 2LDRA 2E6RA 2YW8A 4I7DA 3PURA 4IC3A 4GB0A 3M63A 2ECTA 2MT5A 2XB1A 2ZETC 3JUEA 3HCSA 2PUYA 2VPBA 4UI9B 3PHDA 5FB1A 2LGKA 1LDJB 2XOYA 3EB5A 3ZNIA 4GNGA 1WESA 2C2VS 2KWKA 5EYAF 2KFTA 3L1XA 2KWNA 3O36A 1WEQA 4W4UA 4PTBA 3U5PA 3HTKC 1WEPA 2CKLB 4QQ4A 5TRBA 1WEWA 2YHNA 3O34A 1WEMA 4YBMA 3N9NA 2KIZA 4FIPA 4OGEA 2M13A 3VK6A 4AYCB 1WEUA 5B79A 4FK5A 3FL2A 5KH7A 4UP0A 5H9MA 4P5OB 3LVQE 2Y1MA 5B78A 1LDKC 2L75A 4A49A 4Z0OA 4LJNA 2QJ0A 2JMJA 3Q1DA 4R7EA 2D8UA 3SUBA 4V3KC 3LRQA 1XWHA 1DVPA 4UP5A 4LK9A 2QICA 2CONA 1F62A 4QF2A 2H0DA 3N9QA 4LLBA 4MSXA 5B8DA 2KKXA 2MIQA 2ECIA 3SOXA 3KV5A 2VJFA 3FJUB 3T7LA 5B75A 2EGPA 2Y1NA 1X4UA 3RPGB 2IQJA 2MA6A 5G0FA 1G25A 3HCUA 2L80A 3MHSA 2UZGA 1WGMA 4S3OC 5LKTA 4X3GA 5C13A 3U5OA 2M3HA 2YSMA 1MM3A 2YQMA 5SVIA 3O70A 5DINA 4N3WA 2YQLA 2CRWA
chains in the Genus database with same CATH topology
4GNEA 2L43A 2D8SA 2CT2A 2RI7A 2VPEA 1WENA 4YADA 3ZVYA 5LKXA 2G43A 4ZQLA 4I7CA 2LQ6A 4AVXA 3C6WA 5TBNA 2LRIC 2M1RA 2H0DB 2F6NA 3N9OA 4XI1A 4YAXA 2EODA 2NAAA 3M62A 5D1LB 2QIZA 3EB6A 2PNXA 3O35A 2F42A 2VJFB 4O64A 2ECGA 2YUCA 5C11A 3ZTGA 5LKZA 2YT5A 1HYIA 3O37A 3C5KA 1X4JA 2LXHC 4A0CD 4B86C 1MM2A 3T6RA 1FP0A 3PUQA 5TDWA 3U5MA 3DQVR 5H1TA 4B7YC 2LGLA 3L11A 4F52B 2KU3A 4CA1A 4LADB 4WZ3B 4YATA 2MNYA 3KNVA 3ZYQA 4LKAA 5H1VA 4L7XA 3KV6A 4V3LC 5FEYA 3QZVA 1HYJA 5TABA 4I7BA 4YBTA 3ZPV1 4IC2A 4NN2A 1Z60A 5KH3A 3LQIA 2LV9A 3M99A 3SHBA 1T1HA 1RMDA 2ECVA 1CHCA 5J3XA 2G6QA 1V87A 2EA6A 5AIUA 2AN6A 2FUUA 3IHPA 1X4IA 2YSJA 2JRJA 2JMIA 2YREA 1WE9A 2KGIA 2LGGA 4AP4A 3SOUA 1WEOA 3ZVZB 1JM7A 2MD8C 2LN0A 3RPGC 2YU4A 3U5NA 2CSYA 3LQJA 2XEUA 2YURA 1VFYA 2MD7B 2VNFA 4Q6FA 4R8PK 4AUQB 2YHOA 2VP7A 2KGGA 4WZ0A 3L1ZB 5FERA 3N9PA 4BBQA 2E6SA 4L58A 2KR4A 1BORA 2CSZA 2FSAA 2KWJA 4C9ZA 5H1UA 5G05B 5JG6A 2KREA 2M85A 1E4UA 2LXPC 2MA5A 2VPGA 4GNFA 2G45A 5AITA 2ECWA 2K17A 3ZPVE 3LQHA 2ECJA 2L0BA 2VJEA 4WZ2A 5D1MB 2K16A 2K4DA 3DPLR 4QF3A 1JM7B 4BHWA 4TKPB 5B76A 3GL6A 1VD4A 5FB0A 2LGVA 2C2LA 3V43A 1WFKA 5LCWB 2ECNA 2KE1A 1K2FA 4GNDA 2F6JA 2K1JA 1WEVA 2IDAA 4A4BA 1ZBDB 1JOCA 2OXQC 3O33A 4YC9A 4CCGX 2Y43A 2HYED 5LKUA 5D1KB 1WIMA 2MNZA 4N4FA 5I3LA 4ZUXU 3NG2A 3HCTA 5DKAA 1U6GB 5B77A 2RSDA 1N87A 4PPEA 2VPDA 3I2DA 2I50A 4YBSA 2KWOA 3MHHA 2HDPA 2DX8A 4FO9A 2BAYA 4R2YA 3ASLA 1Z6UA 1FBVA 2VJEB 2M6MA 4WA6A 4ZDTA 2L5UA 3KQIA 2FUIA 2CKLA 5G04B 4S3OB 4FJCA 5KH9A 1WILA 1VYXA 2JMDA 3N9MA 4YABA 3GV4A 3N9LA 3RTRB 2YYRA 1Z2QA 4MVTA 1IYMA 4AYCA 2KYUA 1WEEA 2MUMA 3O7AA 3SOWA 4A4CA 5TDRA 2LDRA 2E6RA 2YW8A 4I7DA 3PURA 4IC3A 4GB0A 3M63A 2ECTA 2MT5A 2XB1A 2ZETC 3HCSA 2PUYA 2VPBA 4UI9B 3PHDA 5FB1A 2LGKA 1LDJB 3EB5A 3ZNIA 4GNGA 1WESA 2C2VS 2KWKA 5EYAF 2KFTA 3L1XA 2KWNA 3O36A 1WEQA 4W4UA 4PTBA 3U5PA 3HTKC 1WEPA 2CKLB 5TRBA 1WEWA 2YHNA 3O34A 1WEMA 4YBMA 3N9NA 2KIZA 4FIPA 3VK6A 4AYCB 1WEUA 5B79A 4FK5A 3FL2A 5KH7A 4UP0A 5H9MA 4P5OB 2Y1MA 5B78A 1LDKC 2L75A 4A49A 4LJNA 2QJ0A 2JMJA 4R7EA 4V3KC 3LRQA 1XWHA 1DVPA 4UP5A 4LK9A 2QICA 1F62A 4QF2A 2H0DA 3N9QA 4LLBA 4MSXA 5B8DA 2MIQA 2ECIA 3SOXA 3KV5A 2VJFA 3T7LA 5B75A 2EGPA 2Y1NA 1X4UA 3RPGB 2MA6A 5G0FA 1G25A 3HCUA 2L80A 3MHSA 2UZGA 1WGMA 4S3OC 5LKTA 4X3GA 5C13A 3U5OA 2M3HA 2YSMA 1MM3A 2YQMA 3O70A 5DINA 4N3WA 2YQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNE A;  2L43 A;  2D8S A;  2CT2 A;  2RI7 A;  2VPE A;  1WEN A;  4YAD A;  3ZVY A;  5LKX A;  2G43 A;  4ZQL A;  4I7C A;  2LQ6 A;  4AVX A;  3C6W A;  5TBN A;  2LRI C;  2M1R A;  2H0D B;  2F6N A;  3N9O A;  4XI1 A;  4YAX A;  2EOD A;  2NAA A;  3M62 A;  5D1L B;  2QIZ A;  3EB6 A;  2PNX A;  3O35 A;  2F42 A;  2VJF B;  4O64 A;  2ECG A;  2YUC A;  5C11 A;  3ZTG A;  5LKZ A;  2YT5 A;  1HYI A;  3O37 A;  3C5K A;  1X4J A;  2LXH C;  4A0C D;  4B86 C;  1MM2 A;  3T6R A;  1FP0 A;  3PUQ A;  5TDW A;  3U5M A;  3DQV R;  5H1T A;  4B7Y C;  2LGL A;  3L11 A;  4F52 B;  2KU3 A;  4CA1 A;  4LAD B;  4WZ3 B;  4YAT A;  2MNY A;  3KNV A;  3ZYQ A;  4LKA A;  5H1V A;  4L7X A;  3KV6 A;  4V3L C;  5FEY A;  3QZV A;  1HYJ A;  5TAB A;  4I7B A;  4YBT A;  3ZPV 1;  4IC2 A;  4NN2 A;  1Z60 A;  5KH3 A;  3LQI A;  2LV9 A;  3M99 A;  3SHB A;  1T1H A;  1RMD A;  2ECV A;  1CHC A;  5J3X A;  2G6Q A;  1V87 A;  2EA6 A;  5AIU A;  2AN6 A;  2FUU A;  3IHP A;  1X4I A;  2YSJ A;  2JRJ A;  2JMI A;  2YRE A;  1WE9 A;  2KGI A;  2LGG A;  4AP4 A;  3SOU A;  1WEO A;  3ZVZ B;  1JM7 A;  2MD8 C;  2LN0 A;  3RPG C;  2YU4 A;  3U5N A;  2CSY A;  3LQJ A;  2XEU A;  2YUR A;  1VFY A;  2MD7 B;  2VNF A;  4Q6F A;  4R8P K;  4AUQ B;  2YHO A;  2VP7 A;  2KGG A;  4WZ0 A;  3L1Z B;  5FER A;  3N9P A;  4BBQ A;  2E6S A;  4L58 A;  2KR4 A;  1BOR A;  2CSZ A;  2FSA A;  2KWJ A;  4C9Z A;  5H1U A;  5G05 B;  5JG6 A;  2KRE A;  2M85 A;  1E4U A;  2LXP C;  2MA5 A;  2VPG A;  4GNF A;  2G45 A;  5AIT A;  2ECW A;  2K17 A;  3ZPV E;  3LQH A;  2ECJ A;  2L0B A;  2VJE A;  4WZ2 A;  5D1M B;  2K16 A;  2K4D A;  3DPL R;  4QF3 A;  1JM7 B;  4BHW A;  4TKP B;  5B76 A;  3GL6 A;  1VD4 A;  5FB0 A;  2LGV A;  2C2L A;  3V43 A;  1WFK A;  5LCW B;  2ECN A;  2KE1 A;  1K2F A;  4GND A;  2F6J A;  2K1J A;  1WEV A;  2IDA A;  4A4B A;  1ZBD B;  1JOC A;  2OXQ C;  3O33 A;  4YC9 A;  4CCG X;  2Y43 A;  2HYE D;  5LKU A;  5D1K B;  1WIM A;  2MNZ A;  4N4F A;  5I3L A;  4ZUX U;  3NG2 A;  3HCT A;  5DKA A;  1U6G B;  5B77 A;  2RSD A;  1N87 A;  4PPE A;  2VPD A;  3I2D A;  2I50 A;  4YBS A;  2KWO A;  3MHH A;  2HDP A;  2DX8 A;  4FO9 A;  2BAY A;  4R2Y A;  3ASL A;  1Z6U A;  1FBV A;  2VJE B;  2M6M A;  4WA6 A;  4ZDT A;  2L5U A;  3KQI A;  2FUI A;  2CKL A;  5G04 B;  4S3O B;  4FJC A;  5KH9 A;  1WIL A;  1VYX A;  2JMD A;  3N9M A;  4YAB A;  3GV4 A;  3N9L A;  3RTR B;  2YYR A;  1Z2Q A;  4MVT A;  1IYM A;  4AYC A;  2KYU A;  1WEE A;  2MUM A;  3O7A A;  3SOW A;  4A4C A;  5TDR A;  2LDR A;  2E6R A;  2YW8 A;  4I7D A;  3PUR A;  4IC3 A;  4GB0 A;  3M63 A;  2ECT A;  2MT5 A;  2XB1 A;  2ZET C;  3HCS A;  2PUY A;  2VPB A;  4UI9 B;  3PHD A;  5FB1 A;  2LGK A;  1LDJ B;  3EB5 A;  3ZNI A;  4GNG A;  1WES A;  2C2V S;  2KWK A;  5EYA F;  2KFT A;  3L1X A;  2KWN A;  3O36 A;  1WEQ A;  4W4U A;  4PTB A;  3U5P A;  3HTK C;  1WEP A;  2CKL B;  5TRB A;  1WEW A;  2YHN A;  3O34 A;  1WEM A;  4YBM A;  3N9N A;  2KIZ A;  4FIP A;  3VK6 A;  4AYC B;  1WEU A;  5B79 A;  4FK5 A;  3FL2 A;  5KH7 A;  4UP0 A;  5H9M A;  4P5O B;  2Y1M A;  5B78 A;  1LDK C;  2L75 A;  4A49 A;  4LJN A;  2QJ0 A;  2JMJ A;  4R7E A;  4V3K C;  3LRQ A;  1XWH A;  1DVP A;  4UP5 A;  4LK9 A;  2QIC A;  1F62 A;  4QF2 A;  2H0D A;  3N9Q A;  4LLB A;  4MSX A;  5B8D A;  2MIQ A;  2ECI A;  3SOX A;  3KV5 A;  2VJF A;  3T7L A;  5B75 A;  2EGP A;  2Y1N A;  1X4U A;  3RPG B;  2MA6 A;  5G0F A;  1G25 A;  3HCU A;  2L80 A;  3MHS A;  2UZG A;  1WGM A;  4S3O C;  5LKT A;  4X3G A;  5C13 A;  3U5O A;  2M3H A;  2YSM A;  1MM3 A;  2YQM A;  3O70 A;  5DIN A;  4N3W A;  2YQL A; 
#chains in the Genus database with same CATH topology
 4GNE A;  2L43 A;  2D8S A;  2CT2 A;  2RI7 A;  2VPE A;  1WEN A;  4YAD A;  3ZVY A;  5LKX A;  2FD4 A;  2G43 A;  2YVR A;  4ZQL A;  4I7C A;  2DJA A;  2P57 A;  2LQ6 A;  4AVX A;  3C6W A;  5TBN A;  2MKE A;  3M7K A;  2LRI C;  2E61 A;  2M1R A;  2H0D B;  2F6N A;  3N9O A;  4XI1 A;  4YAX A;  2EOD A;  2NAA A;  3M62 A;  5D1L B;  2QIZ A;  3EB6 A;  2PNX A;  3O35 A;  2F42 A;  2VJF B;  4O64 A;  2ECG A;  2YUC A;  5C11 A;  3ZTG A;  5LKZ A;  2OWA A;  2YT5 A;  1HYI A;  4F1P A;  3O37 A;  3C5K A;  1X4J A;  2LXH C;  4A0C D;  4B86 C;  1MM2 A;  3T6R A;  1FP0 A;  3PUQ A;  5TDW A;  3U5M A;  3DQV R;  5H1T A;  4B7Y C;  2LGL A;  3L11 A;  4F52 B;  2KU3 A;  4CA1 A;  4LAD B;  5SVX A;  5SVI B;  4Z0R A;  4WZ3 B;  4YAT A;  2MNY A;  3KNV A;  3ZYQ A;  4LKA A;  5H1V A;  4L7X A;  3O47 A;  3KV6 A;  4V3L C;  5FEY A;  3QZV A;  2KKY A;  3E2D A;  5TAB A;  1HYJ A;  4I7B A;  4YBT A;  3ZPV 1;  4IC2 A;  4NN2 A;  1Z60 A;  5KH3 A;  3LQI A;  3T9K A;  2LV9 A;  3M99 A;  3SHB A;  1T1H A;  1RMD A;  2L7P A;  2ECV A;  3FAO A;  1CHC A;  5J3X A;  5SVY A;  2G6Q A;  2DSM A;  1V87 A;  2EA6 A;  5AIU A;  2AN6 A;  2FUU A;  3IHP A;  1X4I A;  2YSJ A;  2JM3 A;  2JRJ A;  2JMI A;  2YRE A;  1WE9 A;  2KGI A;  2LGG A;  4AP4 A;  3SOU A;  1WEO A;  3ZVZ B;  1JM7 A;  2MD8 C;  4OGC A;  3PLW A;  2LN0 A;  3RPG C;  2YU4 A;  3U5N A;  2CSY A;  3LQJ A;  2XEU A;  3LVR E;  3KDE C;  2YUR A;  1VFY A;  5K3Q A;  2MD7 B;  2VNF A;  3H7H A;  4Q6F A;  4R8P K;  4AUQ B;  2YHO A;  2VP7 A;  2KGG A;  4WZ0 A;  3L1Z B;  2CRR A;  5FER A;  1DCQ A;  2XOZ A;  3N9P A;  4BBQ A;  2E6S A;  2LAU A;  4L58 A;  2CSV A;  2KR4 A;  1BOR A;  2CSZ A;  2FSA A;  2KWJ A;  4C9Z A;  5H1U A;  5G05 B;  5JG6 A;  2KRE A;  2M85 A;  1E4U A;  3MDB C;  2LXP C;  2MA5 A;  2VPG A;  4GNF A;  2G45 A;  5AIT A;  2ECW A;  4H9D A;  2K17 A;  3ZPV E;  3LQH A;  2ECJ A;  2L0B A;  2VJE A;  4WZ2 A;  5D1M B;  2K16 A;  2K4D A;  3DPL R;  4QF3 A;  1JM7 B;  4BHW A;  4TKP B;  5B76 A;  3FEH A;  3GL6 A;  1VD4 A;  5FB0 A;  2LGV A;  2C2L A;  3V43 A;  1WFK A;  5LCW B;  2ECN A;  2KE1 A;  2FFW A;  1K2F A;  4GND A;  2F6J A;  2K1J A;  1WEV A;  2IDA A;  4A4B A;  1ZBD B;  1JOC A;  2OXQ C;  1MBM A;  3O33 A;  4YC9 A;  4CCG X;  2Y43 A;  2HYE D;  5LKU A;  5D1K B;  1WIM A;  2MNZ A;  4N4F A;  5I3L A;  4ZUX U;  3NG2 A;  3HCT A;  5DKA A;  1U6G B;  2XP0 A;  5B77 A;  2RSD A;  1N87 A;  4PPE A;  2VPD A;  3I2D A;  2RR4 A;  2B0O E;  2I50 A;  4YBS A;  2KWO A;  3MHH A;  2HDP A;  2EGM A;  2DX8 A;  4FO9 A;  2BAY A;  4R2Y A;  3ASL A;  1Z6U A;  1FBV A;  2VJE B;  2M6M A;  4WA6 A;  4ZDT A;  2L5U A;  3FAN A;  2EXU A;  3KQI A;  2FUI A;  2CKL A;  5G04 B;  4S3O B;  4FJC A;  5KH9 A;  2XOC A;  3DDT A;  1WIL A;  1VYX A;  2JMD A;  3DWD A;  3N9M A;  4YAB A;  3GV4 A;  3N9L A;  3RTR B;  2YYR A;  3FM8 C;  1Z2Q A;  4MVT A;  1IYM A;  4AYC A;  2KYU A;  1WEE A;  3LDY A;  2MUM A;  3O7A A;  3SOW A;  4A4C A;  2JUN A;  4O62 A;  5TDR A;  3LJU X;  2LDR A;  2E6R A;  2YW8 A;  4I7D A;  3PUR A;  4IC3 A;  4GB0 A;  3M63 A;  2ECT A;  2MT5 A;  2XB1 A;  2ZET C;  3JUE A;  3HCS A;  2PUY A;  2VPB A;  4UI9 B;  3PHD A;  5FB1 A;  2LGK A;  1LDJ B;  2XOY A;  3EB5 A;  3ZNI A;  4GNG A;  1WES A;  2C2V S;  2KWK A;  5EYA F;  2KFT A;  3L1X A;  2KWN A;  3O36 A;  1WEQ A;  4W4U A;  4PTB A;  3U5P A;  3HTK C;  1WEP A;  2CKL B;  4QQ4 A;  5TRB A;  1WEW A;  2YHN A;  3O34 A;  1WEM A;  4YBM A;  3N9N A;  2KIZ A;  4FIP A;  4OGE A;  2M13 A;  3VK6 A;  4AYC B;  1WEU A;  5B79 A;  4FK5 A;  3FL2 A;  5KH7 A;  4UP0 A;  5H9M A;  4P5O B;  3LVQ E;  2Y1M A;  5B78 A;  1LDK C;  2L75 A;  4A49 A;  4Z0O A;  4LJN A;  2QJ0 A;  2JMJ A;  3Q1D A;  4R7E A;  2D8U A;  3SUB A;  4V3K C;  3LRQ A;  1XWH A;  1DVP A;  4UP5 A;  4LK9 A;  2QIC A;  2CON A;  1F62 A;  4QF2 A;  2H0D A;  3N9Q A;  4LLB A;  4MSX A;  5B8D A;  2KKX A;  2MIQ A;  2ECI A;  3SOX A;  3KV5 A;  2VJF A;  3FJU B;  3T7L A;  5B75 A;  2EGP A;  2Y1N A;  1X4U A;  3RPG B;  2IQJ A;  2MA6 A;  5G0F A;  1G25 A;  3HCU A;  2L80 A;  3MHS A;  2UZG A;  1WGM A;  4S3O C;  5LKT A;  4X3G A;  5C13 A;  3U5O A;  2M3H A;  2YSM A;  1MM3 A;  2YQM A;  5SVI A;  3O70 A;  5DIN A;  4N3W A;  2YQL A;  2CRW A; 
#chains in the Genus database with same CATH homology
 4GNE A;  2L43 A;  2D8S A;  2CT2 A;  2RI7 A;  2VPE A;  1WEN A;  4YAD A;  3ZVY A;  5LKX A;  2G43 A;  4ZQL A;  4I7C A;  2LQ6 A;  4AVX A;  3C6W A;  5TBN A;  2LRI C;  2M1R A;  2H0D B;  2F6N A;  3N9O A;  4XI1 A;  4YAX A;  2EOD A;  2NAA A;  3M62 A;  5D1L B;  2QIZ A;  3EB6 A;  2PNX A;  3O35 A;  2F42 A;  2VJF B;  4O64 A;  2ECG A;  2YUC A;  5C11 A;  3ZTG A;  5LKZ A;  2YT5 A;  1HYI A;  3O37 A;  3C5K A;  1X4J A;  2LXH C;  4A0C D;  4B86 C;  1MM2 A;  3T6R A;  1FP0 A;  3PUQ A;  5TDW A;  3U5M A;  3DQV R;  5H1T A;  4B7Y C;  2LGL A;  3L11 A;  4F52 B;  2KU3 A;  4CA1 A;  4LAD B;  4WZ3 B;  4YAT A;  2MNY A;  3KNV A;  3ZYQ A;  4LKA A;  5H1V A;  4L7X A;  3KV6 A;  4V3L C;  5FEY A;  3QZV A;  1HYJ A;  5TAB A;  4I7B A;  4YBT A;  3ZPV 1;  4IC2 A;  4NN2 A;  1Z60 A;  5KH3 A;  3LQI A;  2LV9 A;  3M99 A;  3SHB A;  1T1H A;  1RMD A;  2ECV A;  1CHC A;  5J3X A;  2G6Q A;  1V87 A;  2EA6 A;  5AIU A;  2AN6 A;  2FUU A;  3IHP A;  1X4I A;  2YSJ A;  2JRJ A;  2JMI A;  2YRE A;  1WE9 A;  2KGI A;  2LGG A;  4AP4 A;  3SOU A;  1WEO A;  3ZVZ B;  1JM7 A;  2MD8 C;  2LN0 A;  3RPG C;  2YU4 A;  3U5N A;  2CSY A;  3LQJ A;  2XEU A;  2YUR A;  1VFY A;  2MD7 B;  2VNF A;  4Q6F A;  4R8P K;  4AUQ B;  2YHO A;  2VP7 A;  2KGG A;  4WZ0 A;  3L1Z B;  5FER A;  3N9P A;  4BBQ A;  2E6S A;  4L58 A;  2KR4 A;  1BOR A;  2CSZ A;  2FSA A;  2KWJ A;  4C9Z A;  5H1U A;  5G05 B;  5JG6 A;  2KRE A;  2M85 A;  1E4U A;  2LXP C;  2MA5 A;  2VPG A;  4GNF A;  2G45 A;  5AIT A;  2ECW A;  2K17 A;  3ZPV E;  3LQH A;  2ECJ A;  2L0B A;  2VJE A;  4WZ2 A;  5D1M B;  2K16 A;  2K4D A;  3DPL R;  4QF3 A;  1JM7 B;  4BHW A;  4TKP B;  5B76 A;  3GL6 A;  1VD4 A;  5FB0 A;  2LGV A;  2C2L A;  3V43 A;  1WFK A;  5LCW B;  2ECN A;  2KE1 A;  1K2F A;  4GND A;  2F6J A;  2K1J A;  1WEV A;  2IDA A;  4A4B A;  1ZBD B;  1JOC A;  2OXQ C;  3O33 A;  4YC9 A;  4CCG X;  2Y43 A;  2HYE D;  5LKU A;  5D1K B;  1WIM A;  2MNZ A;  4N4F A;  5I3L A;  4ZUX U;  3NG2 A;  3HCT A;  5DKA A;  1U6G B;  5B77 A;  2RSD A;  1N87 A;  4PPE A;  2VPD A;  3I2D A;  2I50 A;  4YBS A;  2KWO A;  3MHH A;  2HDP A;  2DX8 A;  4FO9 A;  2BAY A;  4R2Y A;  3ASL A;  1Z6U A;  1FBV A;  2VJE B;  2M6M A;  4WA6 A;  4ZDT A;  2L5U A;  3KQI A;  2FUI A;  2CKL A;  5G04 B;  4S3O B;  4FJC A;  5KH9 A;  1WIL A;  1VYX A;  2JMD A;  3N9M A;  4YAB A;  3GV4 A;  3N9L A;  3RTR B;  2YYR A;  1Z2Q A;  4MVT A;  1IYM A;  4AYC A;  2KYU A;  1WEE A;  2MUM A;  3O7A A;  3SOW A;  4A4C A;  5TDR A;  2LDR A;  2E6R A;  2YW8 A;  4I7D A;  3PUR A;  4IC3 A;  4GB0 A;  3M63 A;  2ECT A;  2MT5 A;  2XB1 A;  2ZET C;  3HCS A;  2PUY A;  2VPB A;  4UI9 B;  3PHD A;  5FB1 A;  2LGK A;  1LDJ B;  3EB5 A;  3ZNI A;  4GNG A;  1WES A;  2C2V S;  2KWK A;  5EYA F;  2KFT A;  3L1X A;  2KWN A;  3O36 A;  1WEQ A;  4W4U A;  4PTB A;  3U5P A;  3HTK C;  1WEP A;  2CKL B;  5TRB A;  1WEW A;  2YHN A;  3O34 A;  1WEM A;  4YBM A;  3N9N A;  2KIZ A;  4FIP A;  3VK6 A;  4AYC B;  1WEU A;  5B79 A;  4FK5 A;  3FL2 A;  5KH7 A;  4UP0 A;  5H9M A;  4P5O B;  2Y1M A;  5B78 A;  1LDK C;  2L75 A;  4A49 A;  4LJN A;  2QJ0 A;  2JMJ A;  4R7E A;  4V3K C;  3LRQ A;  1XWH A;  1DVP A;  4UP5 A;  4LK9 A;  2QIC A;  1F62 A;  4QF2 A;  2H0D A;  3N9Q A;  4LLB A;  4MSX A;  5B8D A;  2MIQ A;  2ECI A;  3SOX A;  3KV5 A;  2VJF A;  3T7L A;  5B75 A;  2EGP A;  2Y1N A;  1X4U A;  3RPG B;  2MA6 A;  5G0F A;  1G25 A;  3HCU A;  2L80 A;  3MHS A;  2UZG A;  1WGM A;  4S3O C;  5LKT A;  4X3G A;  5C13 A;  3U5O A;  2M3H A;  2YSM A;  1MM3 A;  2YQM A;  3O70 A;  5DIN A;  4N3W A;  2YQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...