1MM2A

Solution structure of the 2nd phd domain from mi2b
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
61
structure length
61
Chain Sequence
b'GPLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mi2-beta
publication title Engineering a Protein Scaffold from a PHD Finger
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 6
structure length 61
sequence length 61
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1mm2A00
4C9ZA 5B77A 4UP0A 1VD4A 2F42A 2VPGA 4XI1A 5EYAF 3ZYQA 2VPDA 3LQHA 5DKAA 4GB0A 4YC9A 4FJCA 4MVTA 2VPBA 4WZ0A 2K17A 3NG2A 4YBMA 1MM2A 2ECNA 2L75A 4A0CD 3LRQA 5H1UA 4X3GA 1G25A 3C5KA 5D1MB 2M1RA 3GV4A 5G0FA 5LCWB 2JMJA 5J3XA 2BAYA 4W4UA 1F62A 2L43A 3N9PA 5B76A 4YABA 3U5MA 5TDRA 1WEMA 5KH7A 4AYCA 5H1VA 3HCUA 5TABA 4FIPA 3U5PA 5H1TA 3MHHA 4B7YC 5FB0A 2LGLA 5TBNA 5B8DA 2CSYA 2LGKA 2KYUA 4GNGA 2M85A 2AN6A 3PHDA 2K4DA 3KV6A 2EGPA 2KWOA 2MA5A 2YHOA 1LDJB 4ZUXU 3M63A 5AITA 2Y1MA 2ECWA 2QIZA 2YQLA 4WZ2A 2YURA 4CCGX 3LQJA 4NN2A 2QJ0A 2LV9A 2CKLB 3L1XA 4N3WA 1U6GB 4AUQB 2VP7A 2YSMA 4I7CA 4YBSA 4F52B 3DQVR 2VJFB 4L58A 5H9MA 2ECIA 2F6JA 5B79A 2I50A 2UZGA 3O33A 2KGGA 2Y1NA 4GNDA 4Q6FA 2ECGA 4LKAA 2CKLA 3M99A 3SOWA 2D8SA 1Z6UA 2RSDA 3EB6A 4A4BA 1XWHA 2G6QA 2VJEB 2C2LA 2ZETC 2PUYA 3T6RA 1CHCA 3O35A 2EA6A 2Y43A 4ZQLA 1JOCA 3N9QA 4MSXA 2E6SA 3V43A 2LGVA 2MA6A 2L80A 2VJFA 4AYCB 1FP0A 3N9NA 3PUQA 2XEUA 2FUUA 2MIQA 3L1ZB 2YU4A 1WE9A 4TKPB 4LK9A 3FL2A 3KQIA 5TDWA 1DVPA 2G43A 3VK6A 3ZVZB 4S3OC 1LDKC 2VJEA 1WESA 5FB1A 4R2YA 5TRBA 2YSJA 1N87A 3O70A 2LRIC 4YAXA 4GNFA 3KNVA 3I2DA 4LLBA 1Z2QA 1ZBDB 2MNYA 2YT5A 2YUCA 2HYED 2MD8C 4I7BA 1WILA 2KFTA 2YW8A 2DX8A 4GNEA 2PNXA 4O64A 1VFYA 3U5OA 4LADB 1HYJA 4P5OB 3EB5A 5B78A 4PPEA 4LJNA 1BORA 3SHBA 1WEEA 1X4UA 2LQ6A 1WEWA 4S3OB 4R8PK 4R7EA 4A4CA 2YQMA 4B86C 5DINA 4BHWA 4UP5A 4YATA 1JM7B 5LKUA 5C11A 2YHNA 5JG6A 2KU3A 2RI7A 5C13A 2IDAA 4V3LC 3PURA 2FUIA 4N4FA 3O34A 3O7AA 5KH9A 2NAAA 3HTKC 1FBVA 2JMDA 1WIMA 3C6WA 1Z60A 3ZPVE 1WENA 4AVXA 5LKXA 2KIZA 1WEUA 1RMDA 1WEVA 4ZDTA 2KGIA 1JM7A 3L11A 3M62A 2JMIA 3RPGC 2LXPC 3O36A 4A49A 1WEQA 5D1LB 3ZVYA 2L5UA 2LGGA 3QZVA 3KV5A 5I3LA 1WGMA 3N9LA 2MNZA 5LKZA 4QF3A 4AP4A 3ZNIA 3IHPA 2L0BA 3MHSA 2LXHC 1HYIA 2QICA 3DPLR 2K16A 4FO9A 2VNFA 3HCSA 4UI9B 2VPEA 1WFKA 1IYMA 4YADA 2MD7B 3U5NA 1X4IA 4L7XA 4CA1A 4QF2A 5AIUA 3ZPV1 4BBQA 1K2FA 2H0DB 3RPGB 5FEYA 1WEOA 2JRJA 5FERA 2F6NA 2KWJA 2MT5A 2ECTA 4I7DA 4FK5A 2EODA 4WA6A 3GL6A 3SOUA 2FSAA 2KWNA 1V87A 3LQIA 3N9MA 1E4UA 1VYXA 2KR4A 2KWKA 2CSZA 2C2VS 5G05B 2H0DA 3T7LA 1X4JA 2E6RA 3O37A 2M3HA 5KH3A 2LN0A 2K1JA 1MM3A 2KREA 2YYRA 4YBTA 2LDRA 2M6MA 4WZ3B 2ECVA 4PTBA 2KE1A 3RTRB 2HDPA 5D1KB 2ECJA 2CT2A 2YREA 2MUMA 3HCTA 2G45A 5B75A 2OXQC 3SOXA 4IC3A 5LKTA 1T1HA 3ZTGA 3ASLA 3N9OA 1WEPA 2XB1A 5G04B 4V3KC 4IC2A
chains in the Genus database with same CATH superfamily
4C9ZA 5B77A 4UP0A 1VD4A 2F42A 2VPGA 4XI1A 5EYAF 3ZYQA 2VPDA 2RR4A 3LQHA 5DKAA 4GB0A 4YC9A 4FJCA 4MVTA 2VPBA 4WZ0A 2K17A 3NG2A 4YBMA 1MM2A 2ECNA 2L75A 4A0CD 3LRQA 5H1UA 5SVYA 4X3GA 1G25A 3C5KA 5D1MB 3MDBC 2OWAA 2M1RA 3GV4A 5G0FA 5LCWB 3KDEC 2JMJA 5J3XA 2BAYA 2DJAA 4W4UA 1F62A 2L43A 3N9PA 5B76A 4F1PA 2D8UA 4YABA 3U5MA 2M13A 3O47A 2XOYA 5TDRA 1WEMA 5KH7A 2YVRA 4AYCA 5H1VA 3HCUA 5TABA 4FIPA 3JUEA 3U5PA 5H1TA 3MHHA 4B7YC 5FB0A 2LGLA 5TBNA 5B8DA 2CSYA 2LGKA 3DWDA 2KYUA 4GNGA 2M85A 2AN6A 3PHDA 2CRWA 2K4DA 3KV6A 3M7KA 2EGPA 2KWOA 2MA5A 2YHOA 1LDJB 4ZUXU 3M63A 5AITA 4OGCA 1DCQA 2Y1MA 2ECWA 2QIZA 2YQLA 4WZ2A 2YURA 4CCGX 3LQJA 4NN2A 2QJ0A 3FAOA 2LV9A 2CKLB 3L1XA 4Z0RA 4N3WA 1U6GB 4AUQB 3H7HA 2VP7A 2YSMA 4I7CA 4YBSA 4F52B 3DQVR 3FM8C 2VJFB 4L58A 5H9MA 2ECIA 2F6JA 5B79A 2I50A 2UZGA 3O33A 2KGGA 2Y1NA 4GNDA 4Q6FA 2ECGA 4LKAA 2CKLA 3M99A 3SOWA 2D8SA 1Z6UA 2RSDA 3EB6A 4A4BA 1XWHA 2G6QA 2VJEB 2C2LA 2ZETC 2PUYA 3T6RA 1CHCA 3O35A 2EA6A 2Y43A 2B0OE 4ZQLA 2CRRA 1JOCA 3N9QA 4MSXA 3SUBA 2E6SA 3V43A 2LGVA 2MA6A 2L80A 2VJFA 4AYCB 1FP0A 3N9NA 3PUQA 5SVIA 2XEUA 2FUUA 2MIQA 3L1ZB 2YU4A 1WE9A 4TKPB 3PLWA 4LK9A 3FL2A 2LAUA 3KQIA 5TDWA 1DVPA 2G43A 3VK6A 1MBMA 3ZVZB 4S3OC 1LDKC 2VJEA 3FEHA 1WESA 5FB1A 3T9KA 5TRBA 2YSJA 1N87A 3O70A 2LRIC 4YAXA 4GNFA 3KNVA 3I2DA 4LLBA 1Z2QA 2E61A 1ZBDB 2MNYA 2YT5A 2XOCA 3LVQE 2YUCA 2HYED 2MD8C 4I7BA 1WILA 2KFTA 2YW8A 2DX8A 4GNEA 2PNXA 5K3QA 4O64A 1VFYA 3U5OA 2P57A 4LADB 1HYJA 4P5OB 2XOZA 2MKEA 3EB5A 3FANA 5B78A 4PPEA 4LJNA 1BORA 4V3KC 3SHBA 1WEEA 3LDYA 1X4UA 2LQ6A 1WEWA 4S3OB 4R8PK 4R7EA 4A4CA 2YQMA 4B86C 5DINA 3FJUB 4BHWA 4UP5A 4YATA 1JM7B 5SVXA 5LKUA 2CSVA 5C11A 2YHNA 2L7PA 5JG6A 2KU3A 2RI7A 5C13A 2IDAA 4V3LC 3PURA 2FUIA 4N4FA 3O34A 5SVIB 3O7AA 5KH9A 2NAAA 3HTKC 2CONA 1FBVA 2JMDA 1WIMA 3C6WA 1Z60A 3ZPVE 1WENA 4AVXA 5LKXA 2KIZA 1WEUA 1RMDA 1WEVA 4ZDTA 2KGIA 1JM7A 3L11A 3M62A 2JMIA 3RPGC 2LXPC 3O36A 4A49A 1WEQA 3ZVYA 2KKYA 2L5UA 2IQJA 2LGGA 3LVRE 3QZVA 3KV5A 5I3LA 1WGMA 3N9LA 2MNZA 5G04B 5LKZA 4QF3A 4AP4A 3ZNIA 3IHPA 2L0BA 3MHSA 2LXHC 1HYIA 2QICA 3DPLR 2XP0A 2K16A 3Q1DA 4FO9A 2VNFA 3HCSA 4UI9B 2VPEA 1WFKA 1IYMA 4YADA 2MD7B 3U5NA 1X4IA 4L7XA 4CA1A 4QF2A 5AIUA 3ZPV1 4BBQA 3E2DA 1K2FA 3DDTA 2H0DB 3RPGB 5FEYA 1WEOA 2JRJA 5FERA 2F6NA 2FFWA 2KWJA 2MT5A 2ECTA 4I7DA 4FK5A 2JUNA 2EXUA 4H9DA 2EODA 4WA6A 3GL6A 3SOUA 4QQ4A 2FSAA 2FD4A 2KWNA 1V87A 2KKXA 3LQIA 3N9MA 4O62A 1E4UA 1VYXA 2KR4A 2KWKA 2CSZA 2C2VS 5G05B 2H0DA 3T7LA 1X4JA 2E6RA 4Z0OA 3O37A 2M3HA 5KH3A 2LN0A 2K1JA 1MM3A 2KREA 2EGMA 2YYRA 4YBTA 2LDRA 2M6MA 2JM3A 4WZ3B 2ECVA 4PTBA 2KE1A 3RTRB 2HDPA 5D1KB 2ECJA 2CT2A 2YREA 2MUMA 3HCTA 2G45A 5B75A 2OXQC 3SOXA 4IC3A 5LKTA 1T1HA 3ZTGA 3LJUX 3ASLA 3N9OA 1WEPA 2DSMA 2XB1A 5D1LB 4OGEA 4R2YA 4IC2A
chains in the Genus database with same CATH topology
4C9ZA 5B77A 4UP0A 1VD4A 2F42A 2VPGA 4XI1A 5EYAF 3ZYQA 2VPDA 3LQHA 5DKAA 4GB0A 4YC9A 4FJCA 4MVTA 2VPBA 4WZ0A 2K17A 3NG2A 4YBMA 1MM2A 2ECNA 2L75A 4A0CD 3LRQA 5H1UA 4X3GA 1G25A 3C5KA 5D1MB 2M1RA 3GV4A 5G0FA 5LCWB 2JMJA 5J3XA 2BAYA 4W4UA 1F62A 2L43A 3N9PA 5B76A 4YABA 3U5MA 5TDRA 1WEMA 5KH7A 4AYCA 5H1VA 3HCUA 5TABA 4FIPA 3U5PA 5H1TA 3MHHA 4B7YC 5FB0A 2LGLA 5TBNA 5B8DA 2CSYA 2LGKA 2KYUA 4GNGA 2M85A 2AN6A 3PHDA 2K4DA 3KV6A 2EGPA 2KWOA 2MA5A 2YHOA 1LDJB 4ZUXU 3M63A 5AITA 2Y1MA 2ECWA 2QIZA 2YQLA 4WZ2A 2YURA 4CCGX 3LQJA 4NN2A 2QJ0A 2LV9A 2CKLB 3L1XA 4N3WA 1U6GB 4AUQB 2VP7A 2YSMA 4I7CA 4YBSA 4F52B 3DQVR 2VJFB 4L58A 5H9MA 2ECIA 2F6JA 5B79A 2I50A 2UZGA 3O33A 2KGGA 2Y1NA 4GNDA 4Q6FA 2ECGA 4LKAA 2CKLA 3M99A 3SOWA 2D8SA 1Z6UA 2RSDA 3EB6A 4A4BA 1XWHA 2G6QA 2VJEB 2C2LA 2ZETC 2PUYA 3T6RA 1CHCA 3O35A 2EA6A 2Y43A 4ZQLA 1JOCA 3N9QA 4MSXA 2E6SA 3V43A 2LGVA 2MA6A 2L80A 2VJFA 4AYCB 1FP0A 3N9NA 3PUQA 2XEUA 2FUUA 2MIQA 3L1ZB 2YU4A 1WE9A 4TKPB 4LK9A 3FL2A 3KQIA 5TDWA 1DVPA 2G43A 3VK6A 3ZVZB 4S3OC 1LDKC 2VJEA 1WESA 5FB1A 4R2YA 5TRBA 2YSJA 1N87A 3O70A 2LRIC 4YAXA 4GNFA 3KNVA 3I2DA 4LLBA 1Z2QA 1ZBDB 2MNYA 2YT5A 2YUCA 2HYED 2MD8C 4I7BA 1WILA 2KFTA 2YW8A 2DX8A 4GNEA 2PNXA 4O64A 1VFYA 3U5OA 4LADB 1HYJA 4P5OB 3EB5A 5B78A 4PPEA 4LJNA 1BORA 3SHBA 1WEEA 1X4UA 2LQ6A 1WEWA 4S3OB 4R8PK 4R7EA 4A4CA 2YQMA 4B86C 5DINA 4BHWA 4UP5A 4YATA 1JM7B 5LKUA 5C11A 2YHNA 5JG6A 2KU3A 2RI7A 5C13A 2IDAA 4V3LC 3PURA 2FUIA 4N4FA 3O34A 3O7AA 5KH9A 2NAAA 3HTKC 1FBVA 2JMDA 1WIMA 3C6WA 1Z60A 3ZPVE 1WENA 4AVXA 5LKXA 2KIZA 1WEUA 1RMDA 1WEVA 4ZDTA 2KGIA 1JM7A 3L11A 3M62A 2JMIA 3RPGC 2LXPC 3O36A 4A49A 1WEQA 5D1LB 3ZVYA 2L5UA 2LGGA 3QZVA 3KV5A 5I3LA 1WGMA 3N9LA 2MNZA 5LKZA 4QF3A 4AP4A 3ZNIA 3IHPA 2L0BA 3MHSA 2LXHC 1HYIA 2QICA 3DPLR 2K16A 4FO9A 2VNFA 3HCSA 4UI9B 2VPEA 1WFKA 1IYMA 4YADA 2MD7B 3U5NA 1X4IA 4L7XA 4CA1A 4QF2A 5AIUA 3ZPV1 4BBQA 1K2FA 2H0DB 3RPGB 5FEYA 1WEOA 2JRJA 5FERA 2F6NA 2KWJA 2MT5A 2ECTA 4I7DA 4FK5A 2EODA 4WA6A 3GL6A 3SOUA 2FSAA 2KWNA 1V87A 3LQIA 3N9MA 1E4UA 1VYXA 2KR4A 2KWKA 2CSZA 2C2VS 5G05B 2H0DA 3T7LA 1X4JA 2E6RA 3O37A 2M3HA 5KH3A 2LN0A 2K1JA 1MM3A 2KREA 2YYRA 4YBTA 2LDRA 2M6MA 4WZ3B 2ECVA 4PTBA 2KE1A 3RTRB 2HDPA 5D1KB 2ECJA 2CT2A 2YREA 2MUMA 3HCTA 2G45A 5B75A 2OXQC 3SOXA 4IC3A 5LKTA 1T1HA 3ZTGA 3ASLA 3N9OA 1WEPA 2XB1A 5G04B 4V3KC 4IC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C9Z A;  5B77 A;  4UP0 A;  1VD4 A;  2F42 A;  2VPG A;  4XI1 A;  5EYA F;  3ZYQ A;  2VPD A;  3LQH A;  5DKA A;  4GB0 A;  4YC9 A;  4FJC A;  4MVT A;  2VPB A;  4WZ0 A;  2K17 A;  3NG2 A;  4YBM A;  1MM2 A;  2ECN A;  2L75 A;  4A0C D;  3LRQ A;  5H1U A;  4X3G A;  1G25 A;  3C5K A;  5D1M B;  2M1R A;  3GV4 A;  5G0F A;  5LCW B;  2JMJ A;  5J3X A;  2BAY A;  4W4U A;  1F62 A;  2L43 A;  3N9P A;  5B76 A;  4YAB A;  3U5M A;  5TDR A;  1WEM A;  5KH7 A;  4AYC A;  5H1V A;  3HCU A;  5TAB A;  4FIP A;  3U5P A;  5H1T A;  3MHH A;  4B7Y C;  5FB0 A;  2LGL A;  5TBN A;  5B8D A;  2CSY A;  2LGK A;  2KYU A;  4GNG A;  2M85 A;  2AN6 A;  3PHD A;  2K4D A;  3KV6 A;  2EGP A;  2KWO A;  2MA5 A;  2YHO A;  1LDJ B;  4ZUX U;  3M63 A;  5AIT A;  2Y1M A;  2ECW A;  2QIZ A;  2YQL A;  4WZ2 A;  2YUR A;  4CCG X;  3LQJ A;  4NN2 A;  2QJ0 A;  2LV9 A;  2CKL B;  3L1X A;  4N3W A;  1U6G B;  4AUQ B;  2VP7 A;  2YSM A;  4I7C A;  4YBS A;  4F52 B;  3DQV R;  2VJF B;  4L58 A;  5H9M A;  2ECI A;  2F6J A;  5B79 A;  2I50 A;  2UZG A;  3O33 A;  2KGG A;  2Y1N A;  4GND A;  4Q6F A;  2ECG A;  4LKA A;  2CKL A;  3M99 A;  3SOW A;  2D8S A;  1Z6U A;  2RSD A;  3EB6 A;  4A4B A;  1XWH A;  2G6Q A;  2VJE B;  2C2L A;  2ZET C;  2PUY A;  3T6R A;  1CHC A;  3O35 A;  2EA6 A;  2Y43 A;  4ZQL A;  1JOC A;  3N9Q A;  4MSX A;  2E6S A;  3V43 A;  2LGV A;  2MA6 A;  2L80 A;  2VJF A;  4AYC B;  1FP0 A;  3N9N A;  3PUQ A;  2XEU A;  2FUU A;  2MIQ A;  3L1Z B;  2YU4 A;  1WE9 A;  4TKP B;  4LK9 A;  3FL2 A;  3KQI A;  5TDW A;  1DVP A;  2G43 A;  3VK6 A;  3ZVZ B;  4S3O C;  1LDK C;  2VJE A;  1WES A;  5FB1 A;  4R2Y A;  5TRB A;  2YSJ A;  1N87 A;  3O70 A;  2LRI C;  4YAX A;  4GNF A;  3KNV A;  3I2D A;  4LLB A;  1Z2Q A;  1ZBD B;  2MNY A;  2YT5 A;  2YUC A;  2HYE D;  2MD8 C;  4I7B A;  1WIL A;  2KFT A;  2YW8 A;  2DX8 A;  4GNE A;  2PNX A;  4O64 A;  1VFY A;  3U5O A;  4LAD B;  1HYJ A;  4P5O B;  3EB5 A;  5B78 A;  4PPE A;  4LJN A;  1BOR A;  3SHB A;  1WEE A;  1X4U A;  2LQ6 A;  1WEW A;  4S3O B;  4R8P K;  4R7E A;  4A4C A;  2YQM A;  4B86 C;  5DIN A;  4BHW A;  4UP5 A;  4YAT A;  1JM7 B;  5LKU A;  5C11 A;  2YHN A;  5JG6 A;  2KU3 A;  2RI7 A;  5C13 A;  2IDA A;  4V3L C;  3PUR A;  2FUI A;  4N4F A;  3O34 A;  3O7A A;  5KH9 A;  2NAA A;  3HTK C;  1FBV A;  2JMD A;  1WIM A;  3C6W A;  1Z60 A;  3ZPV E;  1WEN A;  4AVX A;  5LKX A;  2KIZ A;  1WEU A;  1RMD A;  1WEV A;  4ZDT A;  2KGI A;  1JM7 A;  3L11 A;  3M62 A;  2JMI A;  3RPG C;  2LXP C;  3O36 A;  4A49 A;  1WEQ A;  5D1L B;  3ZVY A;  2L5U A;  2LGG A;  3QZV A;  3KV5 A;  5I3L A;  1WGM A;  3N9L A;  2MNZ A;  5LKZ A;  4QF3 A;  4AP4 A;  3ZNI A;  3IHP A;  2L0B A;  3MHS A;  2LXH C;  1HYI A;  2QIC A;  3DPL R;  2K16 A;  4FO9 A;  2VNF A;  3HCS A;  4UI9 B;  2VPE A;  1WFK A;  1IYM A;  4YAD A;  2MD7 B;  3U5N A;  1X4I A;  4L7X A;  4CA1 A;  4QF2 A;  5AIU A;  3ZPV 1;  4BBQ A;  1K2F A;  2H0D B;  3RPG B;  5FEY A;  1WEO A;  2JRJ A;  5FER A;  2F6N A;  2KWJ A;  2MT5 A;  2ECT A;  4I7D A;  4FK5 A;  2EOD A;  4WA6 A;  3GL6 A;  3SOU A;  2FSA A;  2KWN A;  1V87 A;  3LQI A;  3N9M A;  1E4U A;  1VYX A;  2KR4 A;  2KWK A;  2CSZ A;  2C2V S;  5G05 B;  2H0D A;  3T7L A;  1X4J A;  2E6R A;  3O37 A;  2M3H A;  5KH3 A;  2LN0 A;  2K1J A;  1MM3 A;  2KRE A;  2YYR A;  4YBT A;  2LDR A;  2M6M A;  4WZ3 B;  2ECV A;  4PTB A;  2KE1 A;  3RTR B;  2HDP A;  5D1K B;  2ECJ A;  2CT2 A;  2YRE A;  2MUM A;  3HCT A;  2G45 A;  5B75 A;  2OXQ C;  3SOX A;  4IC3 A;  5LKT A;  1T1H A;  3ZTG A;  3ASL A;  3N9O A;  1WEP A;  2XB1 A;  5G04 B;  4V3K C;  4IC2 A; 
#chains in the Genus database with same CATH topology
 4C9Z A;  5B77 A;  4UP0 A;  1VD4 A;  2F42 A;  2VPG A;  4XI1 A;  5EYA F;  3ZYQ A;  2VPD A;  2RR4 A;  3LQH A;  5DKA A;  4GB0 A;  4YC9 A;  4FJC A;  4MVT A;  2VPB A;  4WZ0 A;  2K17 A;  3NG2 A;  4YBM A;  1MM2 A;  2ECN A;  2L75 A;  4A0C D;  3LRQ A;  5H1U A;  5SVY A;  4X3G A;  1G25 A;  3C5K A;  5D1M B;  3MDB C;  2OWA A;  2M1R A;  3GV4 A;  5G0F A;  5LCW B;  3KDE C;  2JMJ A;  5J3X A;  2BAY A;  2DJA A;  4W4U A;  1F62 A;  2L43 A;  3N9P A;  5B76 A;  4F1P A;  2D8U A;  4YAB A;  3U5M A;  2M13 A;  3O47 A;  2XOY A;  5TDR A;  1WEM A;  5KH7 A;  2YVR A;  4AYC A;  5H1V A;  3HCU A;  5TAB A;  4FIP A;  3JUE A;  3U5P A;  5H1T A;  3MHH A;  4B7Y C;  5FB0 A;  2LGL A;  5TBN A;  5B8D A;  2CSY A;  2LGK A;  3DWD A;  2KYU A;  4GNG A;  2M85 A;  2AN6 A;  3PHD A;  2CRW A;  2K4D A;  3KV6 A;  3M7K A;  2EGP A;  2KWO A;  2MA5 A;  2YHO A;  1LDJ B;  4ZUX U;  3M63 A;  5AIT A;  4OGC A;  1DCQ A;  2Y1M A;  2ECW A;  2QIZ A;  2YQL A;  4WZ2 A;  2YUR A;  4CCG X;  3LQJ A;  4NN2 A;  2QJ0 A;  3FAO A;  2LV9 A;  2CKL B;  3L1X A;  4Z0R A;  4N3W A;  1U6G B;  4AUQ B;  3H7H A;  2VP7 A;  2YSM A;  4I7C A;  4YBS A;  4F52 B;  3DQV R;  3FM8 C;  2VJF B;  4L58 A;  5H9M A;  2ECI A;  2F6J A;  5B79 A;  2I50 A;  2UZG A;  3O33 A;  2KGG A;  2Y1N A;  4GND A;  4Q6F A;  2ECG A;  4LKA A;  2CKL A;  3M99 A;  3SOW A;  2D8S A;  1Z6U A;  2RSD A;  3EB6 A;  4A4B A;  1XWH A;  2G6Q A;  2VJE B;  2C2L A;  2ZET C;  2PUY A;  3T6R A;  1CHC A;  3O35 A;  2EA6 A;  2Y43 A;  2B0O E;  4ZQL A;  2CRR A;  1JOC A;  3N9Q A;  4MSX A;  3SUB A;  2E6S A;  3V43 A;  2LGV A;  2MA6 A;  2L80 A;  2VJF A;  4AYC B;  1FP0 A;  3N9N A;  3PUQ A;  5SVI A;  2XEU A;  2FUU A;  2MIQ A;  3L1Z B;  2YU4 A;  1WE9 A;  4TKP B;  3PLW A;  4LK9 A;  3FL2 A;  2LAU A;  3KQI A;  5TDW A;  1DVP A;  2G43 A;  3VK6 A;  1MBM A;  3ZVZ B;  4S3O C;  1LDK C;  2VJE A;  3FEH A;  1WES A;  5FB1 A;  3T9K A;  5TRB A;  2YSJ A;  1N87 A;  3O70 A;  2LRI C;  4YAX A;  4GNF A;  3KNV A;  3I2D A;  4LLB A;  1Z2Q A;  2E61 A;  1ZBD B;  2MNY A;  2YT5 A;  2XOC A;  3LVQ E;  2YUC A;  2HYE D;  2MD8 C;  4I7B A;  1WIL A;  2KFT A;  2YW8 A;  2DX8 A;  4GNE A;  2PNX A;  5K3Q A;  4O64 A;  1VFY A;  3U5O A;  2P57 A;  4LAD B;  1HYJ A;  4P5O B;  2XOZ A;  2MKE A;  3EB5 A;  3FAN A;  5B78 A;  4PPE A;  4LJN A;  1BOR A;  4V3K C;  3SHB A;  1WEE A;  3LDY A;  1X4U A;  2LQ6 A;  1WEW A;  4S3O B;  4R8P K;  4R7E A;  4A4C A;  2YQM A;  4B86 C;  5DIN A;  3FJU B;  4BHW A;  4UP5 A;  4YAT A;  1JM7 B;  5SVX A;  5LKU A;  2CSV A;  5C11 A;  2YHN A;  2L7P A;  5JG6 A;  2KU3 A;  2RI7 A;  5C13 A;  2IDA A;  4V3L C;  3PUR A;  2FUI A;  4N4F A;  3O34 A;  5SVI B;  3O7A A;  5KH9 A;  2NAA A;  3HTK C;  2CON A;  1FBV A;  2JMD A;  1WIM A;  3C6W A;  1Z60 A;  3ZPV E;  1WEN A;  4AVX A;  5LKX A;  2KIZ A;  1WEU A;  1RMD A;  1WEV A;  4ZDT A;  2KGI A;  1JM7 A;  3L11 A;  3M62 A;  2JMI A;  3RPG C;  2LXP C;  3O36 A;  4A49 A;  1WEQ A;  3ZVY A;  2KKY A;  2L5U A;  2IQJ A;  2LGG A;  3LVR E;  3QZV A;  3KV5 A;  5I3L A;  1WGM A;  3N9L A;  2MNZ A;  5G04 B;  5LKZ A;  4QF3 A;  4AP4 A;  3ZNI A;  3IHP A;  2L0B A;  3MHS A;  2LXH C;  1HYI A;  2QIC A;  3DPL R;  2XP0 A;  2K16 A;  3Q1D A;  4FO9 A;  2VNF A;  3HCS A;  4UI9 B;  2VPE A;  1WFK A;  1IYM A;  4YAD A;  2MD7 B;  3U5N A;  1X4I A;  4L7X A;  4CA1 A;  4QF2 A;  5AIU A;  3ZPV 1;  4BBQ A;  3E2D A;  1K2F A;  3DDT A;  2H0D B;  3RPG B;  5FEY A;  1WEO A;  2JRJ A;  5FER A;  2F6N A;  2FFW A;  2KWJ A;  2MT5 A;  2ECT A;  4I7D A;  4FK5 A;  2JUN A;  2EXU A;  4H9D A;  2EOD A;  4WA6 A;  3GL6 A;  3SOU A;  4QQ4 A;  2FSA A;  2FD4 A;  2KWN A;  1V87 A;  2KKX A;  3LQI A;  3N9M A;  4O62 A;  1E4U A;  1VYX A;  2KR4 A;  2KWK A;  2CSZ A;  2C2V S;  5G05 B;  2H0D A;  3T7L A;  1X4J A;  2E6R A;  4Z0O A;  3O37 A;  2M3H A;  5KH3 A;  2LN0 A;  2K1J A;  1MM3 A;  2KRE A;  2EGM A;  2YYR A;  4YBT A;  2LDR A;  2M6M A;  2JM3 A;  4WZ3 B;  2ECV A;  4PTB A;  2KE1 A;  3RTR B;  2HDP A;  5D1K B;  2ECJ A;  2CT2 A;  2YRE A;  2MUM A;  3HCT A;  2G45 A;  5B75 A;  2OXQ C;  3SOX A;  4IC3 A;  5LKT A;  1T1H A;  3ZTG A;  3LJU X;  3ASL A;  3N9O A;  1WEP A;  2DSM A;  2XB1 A;  5D1L B;  4OGE A;  4R2Y A;  4IC2 A; 
#chains in the Genus database with same CATH homology
 4C9Z A;  5B77 A;  4UP0 A;  1VD4 A;  2F42 A;  2VPG A;  4XI1 A;  5EYA F;  3ZYQ A;  2VPD A;  3LQH A;  5DKA A;  4GB0 A;  4YC9 A;  4FJC A;  4MVT A;  2VPB A;  4WZ0 A;  2K17 A;  3NG2 A;  4YBM A;  1MM2 A;  2ECN A;  2L75 A;  4A0C D;  3LRQ A;  5H1U A;  4X3G A;  1G25 A;  3C5K A;  5D1M B;  2M1R A;  3GV4 A;  5G0F A;  5LCW B;  2JMJ A;  5J3X A;  2BAY A;  4W4U A;  1F62 A;  2L43 A;  3N9P A;  5B76 A;  4YAB A;  3U5M A;  5TDR A;  1WEM A;  5KH7 A;  4AYC A;  5H1V A;  3HCU A;  5TAB A;  4FIP A;  3U5P A;  5H1T A;  3MHH A;  4B7Y C;  5FB0 A;  2LGL A;  5TBN A;  5B8D A;  2CSY A;  2LGK A;  2KYU A;  4GNG A;  2M85 A;  2AN6 A;  3PHD A;  2K4D A;  3KV6 A;  2EGP A;  2KWO A;  2MA5 A;  2YHO A;  1LDJ B;  4ZUX U;  3M63 A;  5AIT A;  2Y1M A;  2ECW A;  2QIZ A;  2YQL A;  4WZ2 A;  2YUR A;  4CCG X;  3LQJ A;  4NN2 A;  2QJ0 A;  2LV9 A;  2CKL B;  3L1X A;  4N3W A;  1U6G B;  4AUQ B;  2VP7 A;  2YSM A;  4I7C A;  4YBS A;  4F52 B;  3DQV R;  2VJF B;  4L58 A;  5H9M A;  2ECI A;  2F6J A;  5B79 A;  2I50 A;  2UZG A;  3O33 A;  2KGG A;  2Y1N A;  4GND A;  4Q6F A;  2ECG A;  4LKA A;  2CKL A;  3M99 A;  3SOW A;  2D8S A;  1Z6U A;  2RSD A;  3EB6 A;  4A4B A;  1XWH A;  2G6Q A;  2VJE B;  2C2L A;  2ZET C;  2PUY A;  3T6R A;  1CHC A;  3O35 A;  2EA6 A;  2Y43 A;  4ZQL A;  1JOC A;  3N9Q A;  4MSX A;  2E6S A;  3V43 A;  2LGV A;  2MA6 A;  2L80 A;  2VJF A;  4AYC B;  1FP0 A;  3N9N A;  3PUQ A;  2XEU A;  2FUU A;  2MIQ A;  3L1Z B;  2YU4 A;  1WE9 A;  4TKP B;  4LK9 A;  3FL2 A;  3KQI A;  5TDW A;  1DVP A;  2G43 A;  3VK6 A;  3ZVZ B;  4S3O C;  1LDK C;  2VJE A;  1WES A;  5FB1 A;  4R2Y A;  5TRB A;  2YSJ A;  1N87 A;  3O70 A;  2LRI C;  4YAX A;  4GNF A;  3KNV A;  3I2D A;  4LLB A;  1Z2Q A;  1ZBD B;  2MNY A;  2YT5 A;  2YUC A;  2HYE D;  2MD8 C;  4I7B A;  1WIL A;  2KFT A;  2YW8 A;  2DX8 A;  4GNE A;  2PNX A;  4O64 A;  1VFY A;  3U5O A;  4LAD B;  1HYJ A;  4P5O B;  3EB5 A;  5B78 A;  4PPE A;  4LJN A;  1BOR A;  3SHB A;  1WEE A;  1X4U A;  2LQ6 A;  1WEW A;  4S3O B;  4R8P K;  4R7E A;  4A4C A;  2YQM A;  4B86 C;  5DIN A;  4BHW A;  4UP5 A;  4YAT A;  1JM7 B;  5LKU A;  5C11 A;  2YHN A;  5JG6 A;  2KU3 A;  2RI7 A;  5C13 A;  2IDA A;  4V3L C;  3PUR A;  2FUI A;  4N4F A;  3O34 A;  3O7A A;  5KH9 A;  2NAA A;  3HTK C;  1FBV A;  2JMD A;  1WIM A;  3C6W A;  1Z60 A;  3ZPV E;  1WEN A;  4AVX A;  5LKX A;  2KIZ A;  1WEU A;  1RMD A;  1WEV A;  4ZDT A;  2KGI A;  1JM7 A;  3L11 A;  3M62 A;  2JMI A;  3RPG C;  2LXP C;  3O36 A;  4A49 A;  1WEQ A;  5D1L B;  3ZVY A;  2L5U A;  2LGG A;  3QZV A;  3KV5 A;  5I3L A;  1WGM A;  3N9L A;  2MNZ A;  5LKZ A;  4QF3 A;  4AP4 A;  3ZNI A;  3IHP A;  2L0B A;  3MHS A;  2LXH C;  1HYI A;  2QIC A;  3DPL R;  2K16 A;  4FO9 A;  2VNF A;  3HCS A;  4UI9 B;  2VPE A;  1WFK A;  1IYM A;  4YAD A;  2MD7 B;  3U5N A;  1X4I A;  4L7X A;  4CA1 A;  4QF2 A;  5AIU A;  3ZPV 1;  4BBQ A;  1K2F A;  2H0D B;  3RPG B;  5FEY A;  1WEO A;  2JRJ A;  5FER A;  2F6N A;  2KWJ A;  2MT5 A;  2ECT A;  4I7D A;  4FK5 A;  2EOD A;  4WA6 A;  3GL6 A;  3SOU A;  2FSA A;  2KWN A;  1V87 A;  3LQI A;  3N9M A;  1E4U A;  1VYX A;  2KR4 A;  2KWK A;  2CSZ A;  2C2V S;  5G05 B;  2H0D A;  3T7L A;  1X4J A;  2E6R A;  3O37 A;  2M3H A;  5KH3 A;  2LN0 A;  2K1J A;  1MM3 A;  2KRE A;  2YYR A;  4YBT A;  2LDR A;  2M6M A;  4WZ3 B;  2ECV A;  4PTB A;  2KE1 A;  3RTR B;  2HDP A;  5D1K B;  2ECJ A;  2CT2 A;  2YRE A;  2MUM A;  3HCT A;  2G45 A;  5B75 A;  2OXQ C;  3SOX A;  4IC3 A;  5LKT A;  1T1H A;  3ZTG A;  3ASL A;  3N9O A;  1WEP A;  2XB1 A;  5G04 B;  4V3K C;  4IC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...