1MM2A

Solution structure of the 2nd phd domain from mi2b
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
61
structure length
61
Chain Sequence
GPLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mi2-beta
publication title Engineering a Protein Scaffold from a PHD Finger
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 6
structure length 61
sequence length 61
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1mm2A00
1WFKA 2IDAA 4X3GA 4TKPB 3KV5A 2MIQA 4LKAA 1G25A 3L1XA 2F42A 4V3LC 4F52B 5B78A 1WIMA 4LLBA 3ZYQA 3MHSA 4FK5A 2K16A 3O36A 4GNDA 2MNZA 3O34A 2MD7B 3SHBA 2K1JA 4WA6A 4XI1A 2Y43A 3HTKC 3PURA 2F6NA 2ECVA 4I7CA 2L5UA 3O7AA 3O37A 1K2FA 5I3LA 1X4UA 3DQVR 1VD4A 5G05B 4LADB 4WZ3B 3ZNIA 5TBNA 2VNFA 2CSYA 4FO9A 4AP4A 1WE9A 4S3OC 4NN2A 1U6GB 2G43A 5H1VA 4MVTA 3FL2A 3L1ZB 4A49A 4LK9A 4V3KC 4YBSA 4QF3A 2EODA 2LXHC 2KWOA 2Y1MA 4FJCA 2LDRA 5D1LB 3LQIA 4S3OB 2MNYA 4GNEA 5G0FA 2MA6A 2KWNA 1T1HA 3ZVZB 1V87A 3L11A 3LQJA 5B76A 3N9OA 5LKUA 2YURA 2YW8A 3SOUA 2YHOA 2LN0A 4PPEA 2KU3A 5FB0A 1MM2A 1FBVA 3O33A 2DX8A 2PUYA 5B77A 5TRBA 2JMJA 3I2DA 4IC2A 4WZ0A 4P5OB 2KFTA 3LRQA 2ECTA 1X4JA 3PHDA 2G6QA 2YUCA 2M85A 3RPGC 5B79A 5J3XA 3HCSA 2VPDA 2RI7A 2K17A 2L43A 2F6JA 1Z6UA 4R2YA 2KREA 2XEUA 4MSXA 5LCWB 2FSAA 3EB5A 4YAXA 2QIZA 2KWJA 2ECJA 2QICA 2VPEA 2D8SA 1WEMA 4YC9A 2ZETC 2FUIA 1X4IA 2YYRA 3KQIA 3M63A 2MD8C 2HYED 1XWHA 3M99A 3KV6A 3RPGB 4I7DA 2CSZA 2CT2A 3ZVYA 3KNVA 5TDRA 3ZTGA 4GNFA 4ZDTA 2H0DB 4L7XA 2XB1A 2LQ6A 4IC3A 4CA1A 2KIZA 3N9QA 1WEEA 2C2VS 5C13A 2YQMA 1BORA 3GV4A 1ZBDB 4A0CD 4CCGX 1WEPA 1WENA 4Q6FA 3ZPV1 1HYIA 5TABA 2K4DA 3T6RA 4UI9B 5H1UA 5LKTA 4I7BA 5H9MA 4AYCB 3N9MA 5JG6A 4YBMA 3PUQA 4B7YC 5EYAF 2LGVA 4BHWA 2Y1NA 2YREA 2C2LA 3EB6A 3C6WA 4AVXA 4YATA 2LV9A 4R7EA 2I50A 5KH9A 2VPGA 4GNGA 2M1RA 2L0BA 1E4UA 1WEOA 4N3WA 3V43A 5G04B 3N9PA 3LQHA 5DKAA 1LDJB 5C11A 2VJFA 3ZPVE 2LRIC 4N4FA 4YABA 2EA6A 2AN6A 3DPLR 2YT5A 2YQLA 2KGGA 2H0DA 2L75A 1JOCA 2LXPC 4A4CA 2OXQC 2KWKA 1WEWA 2ECWA 3O70A 2NAAA 2VP7A 2ECNA 4ZQLA 5KH7A 2E6RA 4QF2A 3HCTA 5FERA 2YHNA 2PNXA 4B86C 2YSMA 5B75A 2RSDA 2VJEB 1Z2QA 2MUMA 2EGPA 4AYCA 3ASLA 4UP5A 2KYUA 1CHCA 3HCUA 3VK6A 5KH3A 5H1TA 3O35A 5FEYA 3U5MA 2G45A 2M3HA 3RTRB 1HYJA 2MT5A 4PTBA 4BBQA 1IYMA 2VJFB 1WILA 1FP0A 1WGMA 1JM7A 1MM3A 2BAYA 4GB0A 4YADA 4FIPA 4O64A 3SOWA 3MHHA 5AIUA 2KGIA 1DVPA 1F62A 2LGLA 4R8PK 3M62A 2VPBA 2CKLA 5AITA 5D1KB 1WEUA 2JMIA 5FB1A 2YSJA 5LKZA 3NG2A 5B8DA 1VYXA 3T7LA 2QJ0A 2L80A 3IHPA 3U5OA 3SOXA 5TDWA 2LGGA 4A4BA 4LJNA 3N9LA 2VJEA 3N9NA 1Z60A 3GL6A 2JMDA 5LKXA 3U5NA 2FUUA 4L58A 1WEVA 3QZVA 5DINA 2E6SA 2LGKA 2JRJA 1N87A 1JM7B 1WESA 4YBTA 2ECIA 3C5KA 4W4UA 2MA5A 1VFYA 5D1MB 2KR4A 2ECGA 2UZGA 1WEQA 2M6MA 2YU4A 4ZUXU 2HDPA 4C9ZA 4UP0A 2CKLB 1LDKC 2KE1A 4WZ2A 4AUQB 3U5PA 1RMDA
chains in the Genus database with same CATH superfamily
1WFKA 3JUEA 2IDAA 4X3GA 4TKPB 3KV5A 2FFWA 2MIQA 4LKAA 1G25A 3L1XA 2F42A 4V3LC 4F52B 5B78A 1WIMA 4LLBA 3ZYQA 4Z0RA 3MHSA 4FK5A 2K16A 3O36A 4GNDA 2MNZA 3O34A 2MD7B 3SHBA 2K1JA 4WA6A 4XI1A 2Y43A 3HTKC 3PURA 2B0OE 2F6NA 2ECVA 4I7CA 2L5UA 2EXUA 3O7AA 3O37A 1K2FA 5I3LA 1X4UA 2XOCA 3DQVR 1VD4A 5G05B 4F1PA 3LVQE 4LADB 4WZ3B 3ZNIA 5TBNA 2VNFA 2CSYA 4FO9A 4AP4A 1WE9A 4S3OC 4NN2A 1U6GB 2G43A 5H1VA 4MVTA 3FL2A 3L1ZB 2CRRA 4A49A 4LK9A 4V3KC 4YBSA 2EGMA 4QF3A 2EODA 2LXHC 2KWOA 2Y1MA 4FJCA 4Z0OA 4O62A 4QQ4A 2LDRA 5D1LB 3LQIA 4S3OB 2M13A 2MNYA 2OWAA 2YVRA 4GNEA 5G0FA 2MA6A 2KWNA 3M7KA 1T1HA 2XOYA 3ZVZB 1V87A 3L11A 3LQJA 5B76A 3N9OA 5LKUA 2YURA 2YW8A 3SOUA 2YHOA 2LN0A 4PPEA 2KU3A 5FB0A 1MM2A 1FBVA 3O33A 3FM8C 2DX8A 2PUYA 5B77A 5TRBA 2KKYA 2JMJA 3I2DA 2JM3A 4IC2A 4WZ0A 4P5OB 3E2DA 2KFTA 3LRQA 2ECTA 3PLWA 1X4JA 3PHDA 2G6QA 2YUCA 2M85A 3RPGC 5B79A 5J3XA 3HCSA 2VPDA 3FJUB 2RI7A 2K17A 2L43A 2DSMA 2F6JA 1Z6UA 4R2YA 2KREA 2XEUA 4MSXA 5LCWB 2FSAA 3EB5A 2KKXA 4YAXA 2QIZA 2KWJA 2ECJA 2QICA 2VPEA 2D8SA 1WEMA 4OGCA 4YC9A 2IQJA 2FUIA 2ZETC 1X4IA 2YYRA 3KQIA 3M63A 3SUBA 2LAUA 2MD8C 2D8UA 2HYED 1XWHA 3M99A 3KV6A 3O47A 3RPGB 2FD4A 2XP0A 4I7DA 2CSZA 2CONA 3FAOA 2CT2A 3ZVYA 3KDEC 3KNVA 5TDRA 2P57A 3ZTGA 4GNFA 4ZDTA 4OGEA 2H0DB 4L7XA 2XB1A 2JUNA 2LQ6A 4IC3A 3LVRE 4CA1A 2KIZA 3N9QA 2MKEA 1WEEA 2C2VS 5SVIA 5C13A 2YQMA 1BORA 3GV4A 1ZBDB 4A0CD 4CCGX 1WEPA 1WENA 4Q6FA 3ZPV1 1HYIA 5TABA 2K4DA 3T6RA 4UI9B 2XOZA 5H1UA 5LKTA 4I7BA 5H9MA 4AYCB 3N9MA 5JG6A 4YBMA 3PUQA 4B7YC 5EYAF 2LGVA 3FEHA 3MDBC 4BHWA 3DWDA 2Y1NA 2YREA 3T9KA 2C2LA 3EB6A 3LDYA 3C6WA 4AVXA 4YATA 2LV9A 4R7EA 2I50A 5KH9A 2VPGA 4GNGA 2M1RA 2L0BA 1E4UA 1WEOA 4N3WA 3V43A 5G04B 3N9PA 3LQHA 5DKAA 1LDJB 5C11A 2VJFA 3ZPVE 2LRIC 4N4FA 4YABA 2EA6A 5SVIB 2AN6A 3DPLR 2YT5A 2YQLA 2KGGA 3Q1DA 2H0DA 2L75A 1JOCA 2LXPC 4A4CA 2OXQC 2KWKA 1WEWA 2ECWA 3O70A 2NAAA 2VP7A 2ECNA 2RR4A 1MBMA 4ZQLA 5KH7A 2E6RA 4QF2A 3HCTA 5FERA 2YHNA 3LJUX 2PNXA 4B86C 2CSVA 2YSMA 5B75A 2RSDA 2VJEB 1Z2QA 2MUMA 2EGPA 4AYCA 3ASLA 4UP5A 2L7PA 2KYUA 1CHCA 3HCUA 3VK6A 4H9DA 5KH3A 5H1TA 3O35A 5FEYA 3U5MA 2G45A 2M3HA 3RTRB 1HYJA 2MT5A 4PTBA 4BBQA 1IYMA 2VJFB 1WILA 1FP0A 2DJAA 1WGMA 1JM7A 1MM3A 2BAYA 4GB0A 4YADA 4FIPA 4O64A 3SOWA 3MHHA 5AIUA 5SVXA 2KGIA 1DVPA 1F62A 2LGLA 4R8PK 3M62A 2VPBA 2CKLA 5AITA 5D1KB 1WEUA 2JMIA 5FB1A 2YSJA 5LKZA 3NG2A 2E61A 5B8DA 1VYXA 3T7LA 2QJ0A 5K3QA 2L80A 3IHPA 3U5OA 3SOXA 5TDWA 2LGGA 5SVYA 4A4BA 4LJNA 3H7HA 3N9LA 2VJEA 3N9NA 1Z60A 3GL6A 2JMDA 5LKXA 3DDTA 3U5NA 2FUUA 4L58A 1WEVA 3QZVA 5DINA 2E6SA 2LGKA 1DCQA 2JRJA 1N87A 1JM7B 1WESA 4YBTA 2ECIA 3FANA 3C5KA 4W4UA 2MA5A 1VFYA 5D1MB 2KR4A 2ECGA 2UZGA 1WEQA 2M6MA 2YU4A 4ZUXU 2HDPA 4C9ZA 2CRWA 4UP0A 2CKLB 1LDKC 2KE1A 4WZ2A 4AUQB 3U5PA 1RMDA
chains in the Genus database with same CATH topology
1WFKA 2IDAA 4X3GA 4TKPB 3KV5A 2MIQA 4LKAA 1G25A 3L1XA 2F42A 4V3LC 4F52B 5B78A 1WIMA 4LLBA 3ZYQA 3MHSA 4FK5A 2K16A 3O36A 4GNDA 2MNZA 3O34A 2MD7B 3SHBA 2K1JA 4WA6A 4XI1A 2Y43A 3HTKC 3PURA 2F6NA 2ECVA 4I7CA 2L5UA 3O7AA 3O37A 1K2FA 5I3LA 1X4UA 3DQVR 1VD4A 5G05B 4LADB 4WZ3B 3ZNIA 5TBNA 2VNFA 2CSYA 4FO9A 4AP4A 1WE9A 4S3OC 4NN2A 1U6GB 2G43A 5H1VA 4MVTA 3FL2A 3L1ZB 4A49A 4LK9A 4V3KC 4YBSA 4QF3A 2EODA 2LXHC 2KWOA 2Y1MA 4FJCA 2LDRA 5D1LB 3LQIA 4S3OB 2MNYA 4GNEA 5G0FA 2MA6A 2KWNA 1T1HA 3ZVZB 1V87A 3L11A 3LQJA 5B76A 3N9OA 5LKUA 2YURA 2YW8A 3SOUA 2YHOA 2LN0A 4PPEA 2KU3A 5FB0A 1MM2A 1FBVA 3O33A 2DX8A 2PUYA 5B77A 5TRBA 2JMJA 3I2DA 4IC2A 4WZ0A 4P5OB 2KFTA 3LRQA 2ECTA 1X4JA 3PHDA 2G6QA 2YUCA 2M85A 3RPGC 5B79A 5J3XA 3HCSA 2VPDA 2RI7A 2K17A 2L43A 2F6JA 1Z6UA 4R2YA 2KREA 2XEUA 4MSXA 5LCWB 2FSAA 3EB5A 4YAXA 2QIZA 2KWJA 2ECJA 2QICA 2VPEA 2D8SA 1WEMA 4YC9A 2ZETC 2FUIA 1X4IA 2YYRA 3KQIA 3M63A 2MD8C 2HYED 1XWHA 3M99A 3KV6A 3RPGB 4I7DA 2CSZA 2CT2A 3ZVYA 3KNVA 5TDRA 3ZTGA 4GNFA 4ZDTA 2H0DB 4L7XA 2XB1A 2LQ6A 4IC3A 4CA1A 2KIZA 3N9QA 1WEEA 2C2VS 5C13A 2YQMA 1BORA 3GV4A 1ZBDB 4A0CD 4CCGX 1WEPA 1WENA 4Q6FA 3ZPV1 1HYIA 5TABA 2K4DA 3T6RA 4UI9B 5H1UA 5LKTA 4I7BA 5H9MA 4AYCB 3N9MA 5JG6A 4YBMA 3PUQA 4B7YC 5EYAF 2LGVA 4BHWA 2Y1NA 2YREA 2C2LA 3EB6A 3C6WA 4AVXA 4YATA 2LV9A 4R7EA 2I50A 5KH9A 2VPGA 4GNGA 2M1RA 2L0BA 1E4UA 1WEOA 4N3WA 3V43A 5G04B 3N9PA 3LQHA 5DKAA 1LDJB 5C11A 2VJFA 3ZPVE 2LRIC 4N4FA 4YABA 2EA6A 2AN6A 3DPLR 2YT5A 2YQLA 2KGGA 2H0DA 2L75A 1JOCA 2LXPC 4A4CA 2OXQC 2KWKA 1WEWA 2ECWA 3O70A 2NAAA 2VP7A 2ECNA 4ZQLA 5KH7A 2E6RA 4QF2A 3HCTA 5FERA 2YHNA 2PNXA 4B86C 2YSMA 5B75A 2RSDA 2VJEB 1Z2QA 2MUMA 2EGPA 4AYCA 3ASLA 4UP5A 2KYUA 1CHCA 3HCUA 3VK6A 5KH3A 5H1TA 3O35A 5FEYA 3U5MA 2G45A 2M3HA 3RTRB 1HYJA 2MT5A 4PTBA 4BBQA 1IYMA 2VJFB 1WILA 1FP0A 1WGMA 1JM7A 1MM3A 2BAYA 4GB0A 4YADA 4FIPA 4O64A 3SOWA 3MHHA 5AIUA 2KGIA 1DVPA 1F62A 2LGLA 4R8PK 3M62A 2VPBA 2CKLA 5AITA 5D1KB 1WEUA 2JMIA 5FB1A 2YSJA 5LKZA 3NG2A 5B8DA 1VYXA 3T7LA 2QJ0A 2L80A 3IHPA 3U5OA 3SOXA 5TDWA 2LGGA 4A4BA 4LJNA 3N9LA 2VJEA 3N9NA 1Z60A 3GL6A 2JMDA 5LKXA 3U5NA 2FUUA 4L58A 1WEVA 3QZVA 5DINA 2E6SA 2LGKA 2JRJA 1N87A 1JM7B 1WESA 4YBTA 2ECIA 3C5KA 4W4UA 2MA5A 1VFYA 5D1MB 2KR4A 2ECGA 2UZGA 1WEQA 2M6MA 2YU4A 4ZUXU 2HDPA 4C9ZA 4UP0A 2CKLB 1LDKC 2KE1A 4WZ2A 4AUQB 3U5PA 1RMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFK A;  2IDA A;  4X3G A;  4TKP B;  3KV5 A;  2MIQ A;  4LKA A;  1G25 A;  3L1X A;  2F42 A;  4V3L C;  4F52 B;  5B78 A;  1WIM A;  4LLB A;  3ZYQ A;  3MHS A;  4FK5 A;  2K16 A;  3O36 A;  4GND A;  2MNZ A;  3O34 A;  2MD7 B;  3SHB A;  2K1J A;  4WA6 A;  4XI1 A;  2Y43 A;  3HTK C;  3PUR A;  2F6N A;  2ECV A;  4I7C A;  2L5U A;  3O7A A;  3O37 A;  1K2F A;  5I3L A;  1X4U A;  3DQV R;  1VD4 A;  5G05 B;  4LAD B;  4WZ3 B;  3ZNI A;  5TBN A;  2VNF A;  2CSY A;  4FO9 A;  4AP4 A;  1WE9 A;  4S3O C;  4NN2 A;  1U6G B;  2G43 A;  5H1V A;  4MVT A;  3FL2 A;  3L1Z B;  4A49 A;  4LK9 A;  4V3K C;  4YBS A;  4QF3 A;  2EOD A;  2LXH C;  2KWO A;  2Y1M A;  4FJC A;  2LDR A;  5D1L B;  3LQI A;  4S3O B;  2MNY A;  4GNE A;  5G0F A;  2MA6 A;  2KWN A;  1T1H A;  3ZVZ B;  1V87 A;  3L11 A;  3LQJ A;  5B76 A;  3N9O A;  5LKU A;  2YUR A;  2YW8 A;  3SOU A;  2YHO A;  2LN0 A;  4PPE A;  2KU3 A;  5FB0 A;  1MM2 A;  1FBV A;  3O33 A;  2DX8 A;  2PUY A;  5B77 A;  5TRB A;  2JMJ A;  3I2D A;  4IC2 A;  4WZ0 A;  4P5O B;  2KFT A;  3LRQ A;  2ECT A;  1X4J A;  3PHD A;  2G6Q A;  2YUC A;  2M85 A;  3RPG C;  5B79 A;  5J3X A;  3HCS A;  2VPD A;  2RI7 A;  2K17 A;  2L43 A;  2F6J A;  1Z6U A;  4R2Y A;  2KRE A;  2XEU A;  4MSX A;  5LCW B;  2FSA A;  3EB5 A;  4YAX A;  2QIZ A;  2KWJ A;  2ECJ A;  2QIC A;  2VPE A;  2D8S A;  1WEM A;  4YC9 A;  2ZET C;  2FUI A;  1X4I A;  2YYR A;  3KQI A;  3M63 A;  2MD8 C;  2HYE D;  1XWH A;  3M99 A;  3KV6 A;  3RPG B;  4I7D A;  2CSZ A;  2CT2 A;  3ZVY A;  3KNV A;  5TDR A;  3ZTG A;  4GNF A;  4ZDT A;  2H0D B;  4L7X A;  2XB1 A;  2LQ6 A;  4IC3 A;  4CA1 A;  2KIZ A;  3N9Q A;  1WEE A;  2C2V S;  5C13 A;  2YQM A;  1BOR A;  3GV4 A;  1ZBD B;  4A0C D;  4CCG X;  1WEP A;  1WEN A;  4Q6F A;  3ZPV 1;  1HYI A;  5TAB A;  2K4D A;  3T6R A;  4UI9 B;  5H1U A;  5LKT A;  4I7B A;  5H9M A;  4AYC B;  3N9M A;  5JG6 A;  4YBM A;  3PUQ A;  4B7Y C;  5EYA F;  2LGV A;  4BHW A;  2Y1N A;  2YRE A;  2C2L A;  3EB6 A;  3C6W A;  4AVX A;  4YAT A;  2LV9 A;  4R7E A;  2I50 A;  5KH9 A;  2VPG A;  4GNG A;  2M1R A;  2L0B A;  1E4U A;  1WEO A;  4N3W A;  3V43 A;  5G04 B;  3N9P A;  3LQH A;  5DKA A;  1LDJ B;  5C11 A;  2VJF A;  3ZPV E;  2LRI C;  4N4F A;  4YAB A;  2EA6 A;  2AN6 A;  3DPL R;  2YT5 A;  2YQL A;  2KGG A;  2H0D A;  2L75 A;  1JOC A;  2LXP C;  4A4C A;  2OXQ C;  2KWK A;  1WEW A;  2ECW A;  3O70 A;  2NAA A;  2VP7 A;  2ECN A;  4ZQL A;  5KH7 A;  2E6R A;  4QF2 A;  3HCT A;  5FER A;  2YHN A;  2PNX A;  4B86 C;  2YSM A;  5B75 A;  2RSD A;  2VJE B;  1Z2Q A;  2MUM A;  2EGP A;  4AYC A;  3ASL A;  4UP5 A;  2KYU A;  1CHC A;  3HCU A;  3VK6 A;  5KH3 A;  5H1T A;  3O35 A;  5FEY A;  3U5M A;  2G45 A;  2M3H A;  3RTR B;  1HYJ A;  2MT5 A;  4PTB A;  4BBQ A;  1IYM A;  2VJF B;  1WIL A;  1FP0 A;  1WGM A;  1JM7 A;  1MM3 A;  2BAY A;  4GB0 A;  4YAD A;  4FIP A;  4O64 A;  3SOW A;  3MHH A;  5AIU A;  2KGI A;  1DVP A;  1F62 A;  2LGL A;  4R8P K;  3M62 A;  2VPB A;  2CKL A;  5AIT A;  5D1K B;  1WEU A;  2JMI A;  5FB1 A;  2YSJ A;  5LKZ A;  3NG2 A;  5B8D A;  1VYX A;  3T7L A;  2QJ0 A;  2L80 A;  3IHP A;  3U5O A;  3SOX A;  5TDW A;  2LGG A;  4A4B A;  4LJN A;  3N9L A;  2VJE A;  3N9N A;  1Z60 A;  3GL6 A;  2JMD A;  5LKX A;  3U5N A;  2FUU A;  4L58 A;  1WEV A;  3QZV A;  5DIN A;  2E6S A;  2LGK A;  2JRJ A;  1N87 A;  1JM7 B;  1WES A;  4YBT A;  2ECI A;  3C5K A;  4W4U A;  2MA5 A;  1VFY A;  5D1M B;  2KR4 A;  2ECG A;  2UZG A;  1WEQ A;  2M6M A;  2YU4 A;  4ZUX U;  2HDP A;  4C9Z A;  4UP0 A;  2CKL B;  1LDK C;  2KE1 A;  4WZ2 A;  4AUQ B;  3U5P A;  1RMD A; 
#chains in the Genus database with same CATH topology
 1WFK A;  3JUE A;  2IDA A;  4X3G A;  4TKP B;  3KV5 A;  2FFW A;  2MIQ A;  4LKA A;  1G25 A;  3L1X A;  2F42 A;  4V3L C;  4F52 B;  5B78 A;  1WIM A;  4LLB A;  3ZYQ A;  4Z0R A;  3MHS A;  4FK5 A;  2K16 A;  3O36 A;  4GND A;  2MNZ A;  3O34 A;  2MD7 B;  3SHB A;  2K1J A;  4WA6 A;  4XI1 A;  2Y43 A;  3HTK C;  3PUR A;  2B0O E;  2F6N A;  2ECV A;  4I7C A;  2L5U A;  2EXU A;  3O7A A;  3O37 A;  1K2F A;  5I3L A;  1X4U A;  2XOC A;  3DQV R;  1VD4 A;  5G05 B;  4F1P A;  3LVQ E;  4LAD B;  4WZ3 B;  3ZNI A;  5TBN A;  2VNF A;  2CSY A;  4FO9 A;  4AP4 A;  1WE9 A;  4S3O C;  4NN2 A;  1U6G B;  2G43 A;  5H1V A;  4MVT A;  3FL2 A;  3L1Z B;  2CRR A;  4A49 A;  4LK9 A;  4V3K C;  4YBS A;  2EGM A;  4QF3 A;  2EOD A;  2LXH C;  2KWO A;  2Y1M A;  4FJC A;  4Z0O A;  4O62 A;  4QQ4 A;  2LDR A;  5D1L B;  3LQI A;  4S3O B;  2M13 A;  2MNY A;  2OWA A;  2YVR A;  4GNE A;  5G0F A;  2MA6 A;  2KWN A;  3M7K A;  1T1H A;  2XOY A;  3ZVZ B;  1V87 A;  3L11 A;  3LQJ A;  5B76 A;  3N9O A;  5LKU A;  2YUR A;  2YW8 A;  3SOU A;  2YHO A;  2LN0 A;  4PPE A;  2KU3 A;  5FB0 A;  1MM2 A;  1FBV A;  3O33 A;  3FM8 C;  2DX8 A;  2PUY A;  5B77 A;  5TRB A;  2KKY A;  2JMJ A;  3I2D A;  2JM3 A;  4IC2 A;  4WZ0 A;  4P5O B;  3E2D A;  2KFT A;  3LRQ A;  2ECT A;  3PLW A;  1X4J A;  3PHD A;  2G6Q A;  2YUC A;  2M85 A;  3RPG C;  5B79 A;  5J3X A;  3HCS A;  2VPD A;  3FJU B;  2RI7 A;  2K17 A;  2L43 A;  2DSM A;  2F6J A;  1Z6U A;  4R2Y A;  2KRE A;  2XEU A;  4MSX A;  5LCW B;  2FSA A;  3EB5 A;  2KKX A;  4YAX A;  2QIZ A;  2KWJ A;  2ECJ A;  2QIC A;  2VPE A;  2D8S A;  1WEM A;  4OGC A;  4YC9 A;  2IQJ A;  2FUI A;  2ZET C;  1X4I A;  2YYR A;  3KQI A;  3M63 A;  3SUB A;  2LAU A;  2MD8 C;  2D8U A;  2HYE D;  1XWH A;  3M99 A;  3KV6 A;  3O47 A;  3RPG B;  2FD4 A;  2XP0 A;  4I7D A;  2CSZ A;  2CON A;  3FAO A;  2CT2 A;  3ZVY A;  3KDE C;  3KNV A;  5TDR A;  2P57 A;  3ZTG A;  4GNF A;  4ZDT A;  4OGE A;  2H0D B;  4L7X A;  2XB1 A;  2JUN A;  2LQ6 A;  4IC3 A;  3LVR E;  4CA1 A;  2KIZ A;  3N9Q A;  2MKE A;  1WEE A;  2C2V S;  5SVI A;  5C13 A;  2YQM A;  1BOR A;  3GV4 A;  1ZBD B;  4A0C D;  4CCG X;  1WEP A;  1WEN A;  4Q6F A;  3ZPV 1;  1HYI A;  5TAB A;  2K4D A;  3T6R A;  4UI9 B;  2XOZ A;  5H1U A;  5LKT A;  4I7B A;  5H9M A;  4AYC B;  3N9M A;  5JG6 A;  4YBM A;  3PUQ A;  4B7Y C;  5EYA F;  2LGV A;  3FEH A;  3MDB C;  4BHW A;  3DWD A;  2Y1N A;  2YRE A;  3T9K A;  2C2L A;  3EB6 A;  3LDY A;  3C6W A;  4AVX A;  4YAT A;  2LV9 A;  4R7E A;  2I50 A;  5KH9 A;  2VPG A;  4GNG A;  2M1R A;  2L0B A;  1E4U A;  1WEO A;  4N3W A;  3V43 A;  5G04 B;  3N9P A;  3LQH A;  5DKA A;  1LDJ B;  5C11 A;  2VJF A;  3ZPV E;  2LRI C;  4N4F A;  4YAB A;  2EA6 A;  5SVI B;  2AN6 A;  3DPL R;  2YT5 A;  2YQL A;  2KGG A;  3Q1D A;  2H0D A;  2L75 A;  1JOC A;  2LXP C;  4A4C A;  2OXQ C;  2KWK A;  1WEW A;  2ECW A;  3O70 A;  2NAA A;  2VP7 A;  2ECN A;  2RR4 A;  1MBM A;  4ZQL A;  5KH7 A;  2E6R A;  4QF2 A;  3HCT A;  5FER A;  2YHN A;  3LJU X;  2PNX A;  4B86 C;  2CSV A;  2YSM A;  5B75 A;  2RSD A;  2VJE B;  1Z2Q A;  2MUM A;  2EGP A;  4AYC A;  3ASL A;  4UP5 A;  2L7P A;  2KYU A;  1CHC A;  3HCU A;  3VK6 A;  4H9D A;  5KH3 A;  5H1T A;  3O35 A;  5FEY A;  3U5M A;  2G45 A;  2M3H A;  3RTR B;  1HYJ A;  2MT5 A;  4PTB A;  4BBQ A;  1IYM A;  2VJF B;  1WIL A;  1FP0 A;  2DJA A;  1WGM A;  1JM7 A;  1MM3 A;  2BAY A;  4GB0 A;  4YAD A;  4FIP A;  4O64 A;  3SOW A;  3MHH A;  5AIU A;  5SVX A;  2KGI A;  1DVP A;  1F62 A;  2LGL A;  4R8P K;  3M62 A;  2VPB A;  2CKL A;  5AIT A;  5D1K B;  1WEU A;  2JMI A;  5FB1 A;  2YSJ A;  5LKZ A;  3NG2 A;  2E61 A;  5B8D A;  1VYX A;  3T7L A;  2QJ0 A;  5K3Q A;  2L80 A;  3IHP A;  3U5O A;  3SOX A;  5TDW A;  2LGG A;  5SVY A;  4A4B A;  4LJN A;  3H7H A;  3N9L A;  2VJE A;  3N9N A;  1Z60 A;  3GL6 A;  2JMD A;  5LKX A;  3DDT A;  3U5N A;  2FUU A;  4L58 A;  1WEV A;  3QZV A;  5DIN A;  2E6S A;  2LGK A;  1DCQ A;  2JRJ A;  1N87 A;  1JM7 B;  1WES A;  4YBT A;  2ECI A;  3FAN A;  3C5K A;  4W4U A;  2MA5 A;  1VFY A;  5D1M B;  2KR4 A;  2ECG A;  2UZG A;  1WEQ A;  2M6M A;  2YU4 A;  4ZUX U;  2HDP A;  4C9Z A;  2CRW A;  4UP0 A;  2CKL B;  1LDK C;  2KE1 A;  4WZ2 A;  4AUQ B;  3U5P A;  1RMD A; 
#chains in the Genus database with same CATH homology
 1WFK A;  2IDA A;  4X3G A;  4TKP B;  3KV5 A;  2MIQ A;  4LKA A;  1G25 A;  3L1X A;  2F42 A;  4V3L C;  4F52 B;  5B78 A;  1WIM A;  4LLB A;  3ZYQ A;  3MHS A;  4FK5 A;  2K16 A;  3O36 A;  4GND A;  2MNZ A;  3O34 A;  2MD7 B;  3SHB A;  2K1J A;  4WA6 A;  4XI1 A;  2Y43 A;  3HTK C;  3PUR A;  2F6N A;  2ECV A;  4I7C A;  2L5U A;  3O7A A;  3O37 A;  1K2F A;  5I3L A;  1X4U A;  3DQV R;  1VD4 A;  5G05 B;  4LAD B;  4WZ3 B;  3ZNI A;  5TBN A;  2VNF A;  2CSY A;  4FO9 A;  4AP4 A;  1WE9 A;  4S3O C;  4NN2 A;  1U6G B;  2G43 A;  5H1V A;  4MVT A;  3FL2 A;  3L1Z B;  4A49 A;  4LK9 A;  4V3K C;  4YBS A;  4QF3 A;  2EOD A;  2LXH C;  2KWO A;  2Y1M A;  4FJC A;  2LDR A;  5D1L B;  3LQI A;  4S3O B;  2MNY A;  4GNE A;  5G0F A;  2MA6 A;  2KWN A;  1T1H A;  3ZVZ B;  1V87 A;  3L11 A;  3LQJ A;  5B76 A;  3N9O A;  5LKU A;  2YUR A;  2YW8 A;  3SOU A;  2YHO A;  2LN0 A;  4PPE A;  2KU3 A;  5FB0 A;  1MM2 A;  1FBV A;  3O33 A;  2DX8 A;  2PUY A;  5B77 A;  5TRB A;  2JMJ A;  3I2D A;  4IC2 A;  4WZ0 A;  4P5O B;  2KFT A;  3LRQ A;  2ECT A;  1X4J A;  3PHD A;  2G6Q A;  2YUC A;  2M85 A;  3RPG C;  5B79 A;  5J3X A;  3HCS A;  2VPD A;  2RI7 A;  2K17 A;  2L43 A;  2F6J A;  1Z6U A;  4R2Y A;  2KRE A;  2XEU A;  4MSX A;  5LCW B;  2FSA A;  3EB5 A;  4YAX A;  2QIZ A;  2KWJ A;  2ECJ A;  2QIC A;  2VPE A;  2D8S A;  1WEM A;  4YC9 A;  2ZET C;  2FUI A;  1X4I A;  2YYR A;  3KQI A;  3M63 A;  2MD8 C;  2HYE D;  1XWH A;  3M99 A;  3KV6 A;  3RPG B;  4I7D A;  2CSZ A;  2CT2 A;  3ZVY A;  3KNV A;  5TDR A;  3ZTG A;  4GNF A;  4ZDT A;  2H0D B;  4L7X A;  2XB1 A;  2LQ6 A;  4IC3 A;  4CA1 A;  2KIZ A;  3N9Q A;  1WEE A;  2C2V S;  5C13 A;  2YQM A;  1BOR A;  3GV4 A;  1ZBD B;  4A0C D;  4CCG X;  1WEP A;  1WEN A;  4Q6F A;  3ZPV 1;  1HYI A;  5TAB A;  2K4D A;  3T6R A;  4UI9 B;  5H1U A;  5LKT A;  4I7B A;  5H9M A;  4AYC B;  3N9M A;  5JG6 A;  4YBM A;  3PUQ A;  4B7Y C;  5EYA F;  2LGV A;  4BHW A;  2Y1N A;  2YRE A;  2C2L A;  3EB6 A;  3C6W A;  4AVX A;  4YAT A;  2LV9 A;  4R7E A;  2I50 A;  5KH9 A;  2VPG A;  4GNG A;  2M1R A;  2L0B A;  1E4U A;  1WEO A;  4N3W A;  3V43 A;  5G04 B;  3N9P A;  3LQH A;  5DKA A;  1LDJ B;  5C11 A;  2VJF A;  3ZPV E;  2LRI C;  4N4F A;  4YAB A;  2EA6 A;  2AN6 A;  3DPL R;  2YT5 A;  2YQL A;  2KGG A;  2H0D A;  2L75 A;  1JOC A;  2LXP C;  4A4C A;  2OXQ C;  2KWK A;  1WEW A;  2ECW A;  3O70 A;  2NAA A;  2VP7 A;  2ECN A;  4ZQL A;  5KH7 A;  2E6R A;  4QF2 A;  3HCT A;  5FER A;  2YHN A;  2PNX A;  4B86 C;  2YSM A;  5B75 A;  2RSD A;  2VJE B;  1Z2Q A;  2MUM A;  2EGP A;  4AYC A;  3ASL A;  4UP5 A;  2KYU A;  1CHC A;  3HCU A;  3VK6 A;  5KH3 A;  5H1T A;  3O35 A;  5FEY A;  3U5M A;  2G45 A;  2M3H A;  3RTR B;  1HYJ A;  2MT5 A;  4PTB A;  4BBQ A;  1IYM A;  2VJF B;  1WIL A;  1FP0 A;  1WGM A;  1JM7 A;  1MM3 A;  2BAY A;  4GB0 A;  4YAD A;  4FIP A;  4O64 A;  3SOW A;  3MHH A;  5AIU A;  2KGI A;  1DVP A;  1F62 A;  2LGL A;  4R8P K;  3M62 A;  2VPB A;  2CKL A;  5AIT A;  5D1K B;  1WEU A;  2JMI A;  5FB1 A;  2YSJ A;  5LKZ A;  3NG2 A;  5B8D A;  1VYX A;  3T7L A;  2QJ0 A;  2L80 A;  3IHP A;  3U5O A;  3SOX A;  5TDW A;  2LGG A;  4A4B A;  4LJN A;  3N9L A;  2VJE A;  3N9N A;  1Z60 A;  3GL6 A;  2JMD A;  5LKX A;  3U5N A;  2FUU A;  4L58 A;  1WEV A;  3QZV A;  5DIN A;  2E6S A;  2LGK A;  2JRJ A;  1N87 A;  1JM7 B;  1WES A;  4YBT A;  2ECI A;  3C5K A;  4W4U A;  2MA5 A;  1VFY A;  5D1M B;  2KR4 A;  2ECG A;  2UZG A;  1WEQ A;  2M6M A;  2YU4 A;  4ZUX U;  2HDP A;  4C9Z A;  4UP0 A;  2CKL B;  1LDK C;  2KE1 A;  4WZ2 A;  4AUQ B;  3U5P A;  1RMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...