1MM2A

Solution structure of the 2nd phd domain from mi2b
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
61
structure length
61
Chain Sequence
GPLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering a Protein Scaffold from a PHD Finger
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Mi2-beta
total genus 6
structure length 61
sequence length 61
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1mm2A00
1WEVA 2IDAA 3KV6A 4O64A 3C5KA 1DVPA 4FJCA 4FIPA 2L0BA 4YBTA 1Z60A 2KR4A 4PTBA 4S3OB 1K2FA 2QIZA 2ECJA 1LDKC 5B76A 3LRQA 2FUIA 2K16A 4A49A 4GNFA 4A0CD 5D1MB 3T6RA 3HCUA 5C13A 4N3WA 2KWKA 1WEQA 2KU3A 2PUYA 1WEWA 1WEUA 1WEOA 4PPEA 5B77A 2LGVA 2VJEA 2KWJA 2C2LA 1RMDA 2YW8A 3ZVZB 5I3LA 2MA6A 3RTRB 4QF2A 4V3KC 4B86C 4C9ZA 3HTKC 4ZUXU 2M3HA 2KGIA 3PURA 3EB6A 4GNGA 2MUMA 1G25A 1WGMA 2UZGA 4WA6A 2MD7B 2DX8A 1Z6UA 1WEEA 1ZBDB 2HYED 2M6MA 5D1KB 1T1HA 3SOWA 4R8PK 1JM7B 2FSAA 1WESA 5B8DA 2YREA 4I7CA 4FK5A 4AVXA 2YHOA 3FL2A 4LKAA 3GV4A 5B79A 2HDPA 3PHDA 1MM2A 1MM3A 1WIMA 5DINA 4FO9A 1JOCA 4YC9A 2CSZA 4IC2A 5KH7A 5KH3A 4YBMA 2EGPA 1CHCA 1U6GB 5G05B 5AIUA 4GB0A 1WEMA 2YYRA 4ZQLA 5FERA 4YAXA 5FEYA 4A4CA 3MHSA 2YURA 4X3GA 3U5OA 1JM7A 3HCSA 5TDWA 4WZ2A 5G0FA 4CCGX 2VPDA 2E6SA 5LKUA 1WFKA 2FUUA 2CKLB 2VJFB 2PNXA 3U5PA 5KH9A 2XB1A 2VJEB 3I2DA 3SOUA 2XEUA 1VD4A 4W4UA 2MNYA 4F52B 4WZ3B 5B78A 3ASLA 3NG2A 2VPGA 2VPBA 2ECGA 4XI1A 1FBVA 4CA1A 3N9MA 4GNDA 1N87A 2YT5A 1E4UA 2L75A 5LKZA 3EB5A 3C6WA 4LLBA 3KV5A 4B7YC 4N4FA 1VYXA 2MIQA 3ZTGA 5LKTA 3HCTA 2OXQC 2L43A 4TKPB 3O37A 5LCWB 3RPGC 5FB1A 4BBQA 2K17A 2NAAA 4UI9B 3L1ZB 2QJ0A 1X4UA 3SOXA 3ZPV1 3U5NA 3N9PA 2QICA 2ZETC 1VFYA 3L11A 5JG6A 2G43A 4GNEA 3LQJA 3M99A 1LDJB 2EODA 3O35A 2Y1MA 4YBSA 4I7DA 3SHBA 2YQLA 2ECIA 2CT2A 2KYUA 2H0DB 3IHPA 5TDRA 4MSXA 2M1RA 2CSYA 3KNVA 5J3XA 2YU4A 3ZVYA 2YQMA 3GL6A 5FB0A 2KWNA 2C2VS 4A4BA 4WZ0A 2F6NA 1Z2QA 2M85A 2H0DA 4UP0A 4ZDTA 2RI7A 4I7BA 1WILA 2MD8C 5C11A 2G45A 4L58A 3N9OA 2VNFA 3N9QA 4YATA 4QF3A 3MHHA 2L80A 3PUQA 3RPGB 2CKLA 3ZYQA 2KREA 3O33A 4Q6FA 2JMDA 3O7AA 2Y1NA 2F6JA 2AN6A 2I50A 4S3OC 2JMJA 4LJNA 1X4IA 3N9NA 1WE9A 2ECVA 2LRIC 4YADA 2LN0A 3KQIA 2VPEA 3M63A 3LQIA 2LDRA 2E6RA 3LQHA 2LXHC 2F42A 2ECWA 5H9MA 2VP7A 4UP5A 2Y43A 2VJFA 2JRJA 2L5UA 2BAYA 5LKXA 2K1JA 3V43A 2KIZA 4AYCA 4V3LC 4BHWA 2YSMA 1XWHA 2KGGA 3M62A 5DKAA 2LGKA 3ZPVE 5AITA 2MA5A 3O70A 2ECNA 2MT5A 5H1UA 4AUQB 2JMIA 2YHNA 2LV9A 1F62A 5D1LB 2ECTA 5H1TA 4R2YA 3DQVR 1HYJA 2LGGA 3VK6A 1FP0A 4AYCB 3DPLR 4NN2A 1IYMA 4YABA 2LQ6A 5G04B 2KFTA 2EA6A 3T7LA 2YUCA 1BORA 3O36A 3L1XA 4MVTA 1V87A 3O34A 5EYAF 3U5MA 2MNZA 4LK9A 2K4DA 4L7XA 4LADB 1HYIA 5TABA 2LXPC 5TBNA 5TRBA 2KWOA 2KE1A 1WENA 3N9LA 4P5OB 5H1VA 1X4JA 3QZVA 4AP4A 4IC3A 2D8SA 2G6QA 2LGLA 5B75A 4R7EA 2YSJA 3ZNIA 2RSDA 1WEPA
chains in the Genus database with same CATH superfamily
1WEVA 2IDAA 3KV6A 4O64A 3C5KA 1DVPA 4FJCA 4FIPA 2L0BA 4YBTA 1Z60A 2KR4A 4PTBA 4S3OB 1K2FA 2QIZA 2ECJA 1LDKC 5B76A 3LRQA 2FUIA 2K16A 3LJUX 4A49A 4GNFA 4A0CD 5D1MB 3T6RA 3HCUA 5C13A 4N3WA 2KWKA 1WEQA 5SVIA 2KU3A 2PUYA 1WEWA 1WEUA 1WEOA 4PPEA 5B77A 2LGVA 2VJEA 2KWJA 2C2LA 1RMDA 2YW8A 3ZVZB 5I3LA 2MA6A 3RTRB 4QF2A 4V3KC 4B86C 4C9ZA 3HTKC 4ZUXU 1MBMA 2M3HA 2KGIA 3PURA 3EB6A 3MDBC 4GNGA 2MUMA 2FFWA 1G25A 1WGMA 2UZGA 4WA6A 2FD4A 2MD7B 2DX8A 1Z6UA 1WEEA 1ZBDB 2HYED 2M6MA 5D1KB 1T1HA 3SOWA 4R8PK 1JM7B 2FSAA 1WESA 5B8DA 2YREA 3LVRE 4I7CA 4FK5A 4AVXA 2YHOA 3FL2A 4LKAA 3GV4A 5B79A 2HDPA 3PHDA 1MM2A 1MM3A 1WIMA 5DINA 4FO9A 1JOCA 4YC9A 2CSZA 4IC2A 5KH7A 5KH3A 2M13A 4YBMA 3E2DA 2EGPA 1CHCA 1U6GB 5G05B 5AIUA 4GB0A 2KKXA 1WEMA 2LAUA 3O47A 2YYRA 4ZQLA 5FERA 4YAXA 5FEYA 4A4CA 3MHSA 2YURA 4X3GA 3U5OA 3DWDA 3SUBA 1JM7A 3HCSA 5TDWA 4WZ2A 3KDEC 5G0FA 4CCGX 2VPDA 2E6SA 5LKUA 1WFKA 2FUUA 2CKLB 2VJFB 2OWAA 2PNXA 3U5PA 3FM8C 2JUNA 2XOZA 5KH9A 2XB1A 2VJEB 3I2DA 3SOUA 2XEUA 1VD4A 2XP0A 4W4UA 2MNYA 4F52B 4WZ3B 5B78A 3ASLA 3NG2A 2VPGA 2VPBA 2DJAA 2ECGA 1FBVA 4XI1A 4CA1A 3N9MA 4GNDA 1N87A 2YT5A 1E4UA 2L75A 2D8UA 2JM3A 5LKZA 3EB5A 3C6WA 4LLBA 3KV5A 3DDTA 4N4FA 1VYXA 2MIQA 3ZTGA 4B7YC 5LKTA 3HCTA 2OXQC 2L43A 4TKPB 3O37A 5LCWB 3RPGC 5FB1A 4BBQA 2K17A 2NAAA 4UI9B 3L1ZB 2QJ0A 3FAOA 1X4UA 3SOXA 3ZPV1 3U5NA 3N9PA 2QICA 2DSMA 2ZETC 1VFYA 3L11A 5JG6A 2G43A 4GNEA 3LQJA 2MKEA 3M99A 1LDJB 2EODA 3O35A 2Y1MA 4YBSA 4I7DA 3SHBA 2YQLA 2ECIA 2CT2A 2KYUA 2H0DB 3IHPA 5TDRA 3M7KA 4MSXA 2M1RA 2CSYA 3KNVA 2KKYA 5J3XA 2YU4A 3ZVYA 2YQMA 3GL6A 5FB0A 2KWNA 2C2VS 4A4BA 4WZ0A 2F6NA 1Z2QA 2M85A 4Z0RA 4O62A 2H0DA 4UP0A 4ZDTA 2RI7A 4I7BA 1WILA 1DCQA 2MD8C 5C11A 2G45A 4L58A 3N9OA 2VNFA 3N9QA 5SVYA 4YATA 4QF3A 3MHHA 2L80A 3PUQA 3RPGB 2CKLA 4F1PA 2IQJA 3ZYQA 2KREA 3O33A 4Q6FA 2JMDA 3FANA 2Y1NA 3O7AA 2F6JA 2AN6A 2I50A 4S3OC 2JMJA 4LJNA 1X4IA 3LDYA 3N9NA 1WE9A 2ECVA 2LRIC 4YADA 2LN0A 3KQIA 2VPEA 3M63A 3LQIA 2LDRA 2E6RA 3LQHA 2EXUA 3FJUB 4OGCA 2LXHC 2F42A 2L7PA 2ECWA 3FEHA 5H9MA 2VP7A 5SVIB 4UP5A 2Y43A 2VJFA 2CRRA 2JRJA 2L5UA 3PLWA 2XOCA 2BAYA 2P57A 2K1JA 5LKXA 3V43A 2KIZA 4AYCA 2XOYA 4V3LC 4BHWA 2YSMA 1XWHA 2KGGA 3M62A 5DKAA 2LGKA 3ZPVE 5AITA 5K3QA 2MA5A 3O70A 2ECNA 5SVXA 2MT5A 4H9DA 5H1UA 4AUQB 2JMIA 2YHNA 2RR4A 2LV9A 2EGMA 2CONA 1F62A 2E61A 3LVQE 5D1LB 2ECTA 5H1TA 4R2YA 3DQVR 1HYJA 2LGGA 4OGEA 3VK6A 1FP0A 3Q1DA 4AYCB 2YVRA 3DPLR 4Z0OA 4NN2A 3T9KA 2CRWA 1IYMA 4YABA 2LQ6A 5G04B 2KFTA 2EA6A 3T7LA 2YUCA 1BORA 3O36A 3L1XA 3JUEA 4MVTA 1V87A 3O34A 5EYAF 3U5MA 2MNZA 4LK9A 2K4DA 4L7XA 3H7HA 4LADB 1HYIA 5TABA 2LXPC 5TBNA 5TRBA 2KWOA 2KE1A 1WENA 3N9LA 4P5OB 5H1VA 1X4JA 3QZVA 4AP4A 4IC3A 2D8SA 2G6QA 4QQ4A 2LGLA 5B75A 4R7EA 2YSJA 2CSVA 3ZNIA 2B0OE 2RSDA 1WEPA
chains in the Genus database with same CATH topology
1WEVA 2IDAA 3KV6A 4O64A 3C5KA 1DVPA 4FJCA 4FIPA 2L0BA 4YBTA 1Z60A 2KR4A 4PTBA 4S3OB 1K2FA 2QIZA 2ECJA 1LDKC 5B76A 3LRQA 2FUIA 2K16A 4A49A 4GNFA 4A0CD 5D1MB 3T6RA 3HCUA 5C13A 4N3WA 2KWKA 1WEQA 2KU3A 2PUYA 1WEWA 1WEUA 1WEOA 4PPEA 5B77A 2LGVA 2VJEA 2KWJA 2C2LA 1RMDA 2YW8A 3ZVZB 5I3LA 2MA6A 3RTRB 4QF2A 4V3KC 4B86C 4C9ZA 3HTKC 4ZUXU 2M3HA 2KGIA 3PURA 3EB6A 4GNGA 2MUMA 1G25A 1WGMA 2UZGA 4WA6A 2MD7B 2DX8A 1Z6UA 1WEEA 1ZBDB 2HYED 2M6MA 5D1KB 1T1HA 3SOWA 4R8PK 1JM7B 2FSAA 1WESA 5B8DA 2YREA 4I7CA 4FK5A 4AVXA 2YHOA 3FL2A 4LKAA 3GV4A 5B79A 2HDPA 3PHDA 1MM2A 1MM3A 1WIMA 5DINA 4FO9A 1JOCA 4YC9A 2CSZA 4IC2A 5KH7A 5KH3A 4YBMA 2EGPA 1CHCA 1U6GB 5G05B 5AIUA 4GB0A 1WEMA 2YYRA 4ZQLA 5FERA 4YAXA 5FEYA 4A4CA 3MHSA 2YURA 4X3GA 3U5OA 1JM7A 3HCSA 5TDWA 4WZ2A 5G0FA 4CCGX 2VPDA 2E6SA 5LKUA 1WFKA 2FUUA 2CKLB 2VJFB 2PNXA 3U5PA 5KH9A 2XB1A 2VJEB 3I2DA 3SOUA 2XEUA 1VD4A 4W4UA 2MNYA 4F52B 4WZ3B 5B78A 3ASLA 3NG2A 2VPGA 2VPBA 2ECGA 4XI1A 1FBVA 4CA1A 3N9MA 4GNDA 1N87A 2YT5A 1E4UA 2L75A 5LKZA 3EB5A 3C6WA 4LLBA 3KV5A 4B7YC 4N4FA 1VYXA 2MIQA 3ZTGA 5LKTA 3HCTA 2OXQC 2L43A 4TKPB 3O37A 5LCWB 3RPGC 5FB1A 4BBQA 2K17A 2NAAA 4UI9B 3L1ZB 2QJ0A 1X4UA 3SOXA 3ZPV1 3U5NA 3N9PA 2QICA 2ZETC 1VFYA 3L11A 5JG6A 2G43A 4GNEA 3LQJA 3M99A 1LDJB 2EODA 3O35A 2Y1MA 4YBSA 4I7DA 3SHBA 2YQLA 2ECIA 2CT2A 2KYUA 2H0DB 3IHPA 5TDRA 4MSXA 2M1RA 2CSYA 3KNVA 5J3XA 2YU4A 3ZVYA 2YQMA 3GL6A 5FB0A 2KWNA 2C2VS 4A4BA 4WZ0A 2F6NA 1Z2QA 2M85A 2H0DA 4UP0A 4ZDTA 2RI7A 4I7BA 1WILA 2MD8C 5C11A 2G45A 4L58A 3N9OA 2VNFA 3N9QA 4YATA 4QF3A 3MHHA 2L80A 3PUQA 3RPGB 2CKLA 3ZYQA 2KREA 3O33A 4Q6FA 2JMDA 3O7AA 2Y1NA 2F6JA 2AN6A 2I50A 4S3OC 2JMJA 4LJNA 1X4IA 3N9NA 1WE9A 2ECVA 2LRIC 4YADA 2LN0A 3KQIA 2VPEA 3M63A 3LQIA 2LDRA 2E6RA 3LQHA 2LXHC 2F42A 2ECWA 5H9MA 2VP7A 4UP5A 2Y43A 2VJFA 2JRJA 2L5UA 2BAYA 5LKXA 2K1JA 3V43A 2KIZA 4AYCA 4V3LC 4BHWA 2YSMA 1XWHA 2KGGA 3M62A 5DKAA 2LGKA 3ZPVE 5AITA 2MA5A 3O70A 2ECNA 2MT5A 5H1UA 4AUQB 2JMIA 2YHNA 2LV9A 1F62A 5D1LB 2ECTA 5H1TA 4R2YA 3DQVR 1HYJA 2LGGA 3VK6A 1FP0A 4AYCB 3DPLR 4NN2A 1IYMA 4YABA 2LQ6A 5G04B 2KFTA 2EA6A 3T7LA 2YUCA 1BORA 3O36A 3L1XA 4MVTA 1V87A 3O34A 5EYAF 3U5MA 2MNZA 4LK9A 2K4DA 4L7XA 4LADB 1HYIA 5TABA 2LXPC 5TBNA 5TRBA 2KWOA 2KE1A 1WENA 3N9LA 4P5OB 5H1VA 1X4JA 3QZVA 4AP4A 4IC3A 2D8SA 2G6QA 2LGLA 5B75A 4R7EA 2YSJA 3ZNIA 2RSDA 1WEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEV A;  2IDA A;  3KV6 A;  4O64 A;  3C5K A;  1DVP A;  4FJC A;  4FIP A;  2L0B A;  4YBT A;  1Z60 A;  2KR4 A;  4PTB A;  4S3O B;  1K2F A;  2QIZ A;  2ECJ A;  1LDK C;  5B76 A;  3LRQ A;  2FUI A;  2K16 A;  4A49 A;  4GNF A;  4A0C D;  5D1M B;  3T6R A;  3HCU A;  5C13 A;  4N3W A;  2KWK A;  1WEQ A;  2KU3 A;  2PUY A;  1WEW A;  1WEU A;  1WEO A;  4PPE A;  5B77 A;  2LGV A;  2VJE A;  2KWJ A;  2C2L A;  1RMD A;  2YW8 A;  3ZVZ B;  5I3L A;  2MA6 A;  3RTR B;  4QF2 A;  4V3K C;  4B86 C;  4C9Z A;  3HTK C;  4ZUX U;  2M3H A;  2KGI A;  3PUR A;  3EB6 A;  4GNG A;  2MUM A;  1G25 A;  1WGM A;  2UZG A;  4WA6 A;  2MD7 B;  2DX8 A;  1Z6U A;  1WEE A;  1ZBD B;  2HYE D;  2M6M A;  5D1K B;  1T1H A;  3SOW A;  4R8P K;  1JM7 B;  2FSA A;  1WES A;  5B8D A;  2YRE A;  4I7C A;  4FK5 A;  4AVX A;  2YHO A;  3FL2 A;  4LKA A;  3GV4 A;  5B79 A;  2HDP A;  3PHD A;  1MM2 A;  1MM3 A;  1WIM A;  5DIN A;  4FO9 A;  1JOC A;  4YC9 A;  2CSZ A;  4IC2 A;  5KH7 A;  5KH3 A;  4YBM A;  2EGP A;  1CHC A;  1U6G B;  5G05 B;  5AIU A;  4GB0 A;  1WEM A;  2YYR A;  4ZQL A;  5FER A;  4YAX A;  5FEY A;  4A4C A;  3MHS A;  2YUR A;  4X3G A;  3U5O A;  1JM7 A;  3HCS A;  5TDW A;  4WZ2 A;  5G0F A;  4CCG X;  2VPD A;  2E6S A;  5LKU A;  1WFK A;  2FUU A;  2CKL B;  2VJF B;  2PNX A;  3U5P A;  5KH9 A;  2XB1 A;  2VJE B;  3I2D A;  3SOU A;  2XEU A;  1VD4 A;  4W4U A;  2MNY A;  4F52 B;  4WZ3 B;  5B78 A;  3ASL A;  3NG2 A;  2VPG A;  2VPB A;  2ECG A;  4XI1 A;  1FBV A;  4CA1 A;  3N9M A;  4GND A;  1N87 A;  2YT5 A;  1E4U A;  2L75 A;  5LKZ A;  3EB5 A;  3C6W A;  4LLB A;  3KV5 A;  4B7Y C;  4N4F A;  1VYX A;  2MIQ A;  3ZTG A;  5LKT A;  3HCT A;  2OXQ C;  2L43 A;  4TKP B;  3O37 A;  5LCW B;  3RPG C;  5FB1 A;  4BBQ A;  2K17 A;  2NAA A;  4UI9 B;  3L1Z B;  2QJ0 A;  1X4U A;  3SOX A;  3ZPV 1;  3U5N A;  3N9P A;  2QIC A;  2ZET C;  1VFY A;  3L11 A;  5JG6 A;  2G43 A;  4GNE A;  3LQJ A;  3M99 A;  1LDJ B;  2EOD A;  3O35 A;  2Y1M A;  4YBS A;  4I7D A;  3SHB A;  2YQL A;  2ECI A;  2CT2 A;  2KYU A;  2H0D B;  3IHP A;  5TDR A;  4MSX A;  2M1R A;  2CSY A;  3KNV A;  5J3X A;  2YU4 A;  3ZVY A;  2YQM A;  3GL6 A;  5FB0 A;  2KWN A;  2C2V S;  4A4B A;  4WZ0 A;  2F6N A;  1Z2Q A;  2M85 A;  2H0D A;  4UP0 A;  4ZDT A;  2RI7 A;  4I7B A;  1WIL A;  2MD8 C;  5C11 A;  2G45 A;  4L58 A;  3N9O A;  2VNF A;  3N9Q A;  4YAT A;  4QF3 A;  3MHH A;  2L80 A;  3PUQ A;  3RPG B;  2CKL A;  3ZYQ A;  2KRE A;  3O33 A;  4Q6F A;  2JMD A;  3O7A A;  2Y1N A;  2F6J A;  2AN6 A;  2I50 A;  4S3O C;  2JMJ A;  4LJN A;  1X4I A;  3N9N A;  1WE9 A;  2ECV A;  2LRI C;  4YAD A;  2LN0 A;  3KQI A;  2VPE A;  3M63 A;  3LQI A;  2LDR A;  2E6R A;  3LQH A;  2LXH C;  2F42 A;  2ECW A;  5H9M A;  2VP7 A;  4UP5 A;  2Y43 A;  2VJF A;  2JRJ A;  2L5U A;  2BAY A;  5LKX A;  2K1J A;  3V43 A;  2KIZ A;  4AYC A;  4V3L C;  4BHW A;  2YSM A;  1XWH A;  2KGG A;  3M62 A;  5DKA A;  2LGK A;  3ZPV E;  5AIT A;  2MA5 A;  3O70 A;  2ECN A;  2MT5 A;  5H1U A;  4AUQ B;  2JMI A;  2YHN A;  2LV9 A;  1F62 A;  5D1L B;  2ECT A;  5H1T A;  4R2Y A;  3DQV R;  1HYJ A;  2LGG A;  3VK6 A;  1FP0 A;  4AYC B;  3DPL R;  4NN2 A;  1IYM A;  4YAB A;  2LQ6 A;  5G04 B;  2KFT A;  2EA6 A;  3T7L A;  2YUC A;  1BOR A;  3O36 A;  3L1X A;  4MVT A;  1V87 A;  3O34 A;  5EYA F;  3U5M A;  2MNZ A;  4LK9 A;  2K4D A;  4L7X A;  4LAD B;  1HYI A;  5TAB A;  2LXP C;  5TBN A;  5TRB A;  2KWO A;  2KE1 A;  1WEN A;  3N9L A;  4P5O B;  5H1V A;  1X4J A;  3QZV A;  4AP4 A;  4IC3 A;  2D8S A;  2G6Q A;  2LGL A;  5B75 A;  4R7E A;  2YSJ A;  3ZNI A;  2RSD A;  1WEP A; 
#chains in the Genus database with same CATH topology
 1WEV A;  2IDA A;  3KV6 A;  4O64 A;  3C5K A;  1DVP A;  4FJC A;  4FIP A;  2L0B A;  4YBT A;  1Z60 A;  2KR4 A;  4PTB A;  4S3O B;  1K2F A;  2QIZ A;  2ECJ A;  1LDK C;  5B76 A;  3LRQ A;  2FUI A;  2K16 A;  3LJU X;  4A49 A;  4GNF A;  4A0C D;  5D1M B;  3T6R A;  3HCU A;  5C13 A;  4N3W A;  2KWK A;  1WEQ A;  5SVI A;  2KU3 A;  2PUY A;  1WEW A;  1WEU A;  1WEO A;  4PPE A;  5B77 A;  2LGV A;  2VJE A;  2KWJ A;  2C2L A;  1RMD A;  2YW8 A;  3ZVZ B;  5I3L A;  2MA6 A;  3RTR B;  4QF2 A;  4V3K C;  4B86 C;  4C9Z A;  3HTK C;  4ZUX U;  1MBM A;  2M3H A;  2KGI A;  3PUR A;  3EB6 A;  3MDB C;  4GNG A;  2MUM A;  2FFW A;  1G25 A;  1WGM A;  2UZG A;  4WA6 A;  2FD4 A;  2MD7 B;  2DX8 A;  1Z6U A;  1WEE A;  1ZBD B;  2HYE D;  2M6M A;  5D1K B;  1T1H A;  3SOW A;  4R8P K;  1JM7 B;  2FSA A;  1WES A;  5B8D A;  2YRE A;  3LVR E;  4I7C A;  4FK5 A;  4AVX A;  2YHO A;  3FL2 A;  4LKA A;  3GV4 A;  5B79 A;  2HDP A;  3PHD A;  1MM2 A;  1MM3 A;  1WIM A;  5DIN A;  4FO9 A;  1JOC A;  4YC9 A;  2CSZ A;  4IC2 A;  5KH7 A;  5KH3 A;  2M13 A;  4YBM A;  3E2D A;  2EGP A;  1CHC A;  1U6G B;  5G05 B;  5AIU A;  4GB0 A;  2KKX A;  1WEM A;  2LAU A;  3O47 A;  2YYR A;  4ZQL A;  5FER A;  4YAX A;  5FEY A;  4A4C A;  3MHS A;  2YUR A;  4X3G A;  3U5O A;  3DWD A;  3SUB A;  1JM7 A;  3HCS A;  5TDW A;  4WZ2 A;  3KDE C;  5G0F A;  4CCG X;  2VPD A;  2E6S A;  5LKU A;  1WFK A;  2FUU A;  2CKL B;  2VJF B;  2OWA A;  2PNX A;  3U5P A;  3FM8 C;  2JUN A;  2XOZ A;  5KH9 A;  2XB1 A;  2VJE B;  3I2D A;  3SOU A;  2XEU A;  1VD4 A;  2XP0 A;  4W4U A;  2MNY A;  4F52 B;  4WZ3 B;  5B78 A;  3ASL A;  3NG2 A;  2VPG A;  2VPB A;  2DJA A;  2ECG A;  1FBV A;  4XI1 A;  4CA1 A;  3N9M A;  4GND A;  1N87 A;  2YT5 A;  1E4U A;  2L75 A;  2D8U A;  2JM3 A;  5LKZ A;  3EB5 A;  3C6W A;  4LLB A;  3KV5 A;  3DDT A;  4N4F A;  1VYX A;  2MIQ A;  3ZTG A;  4B7Y C;  5LKT A;  3HCT A;  2OXQ C;  2L43 A;  4TKP B;  3O37 A;  5LCW B;  3RPG C;  5FB1 A;  4BBQ A;  2K17 A;  2NAA A;  4UI9 B;  3L1Z B;  2QJ0 A;  3FAO A;  1X4U A;  3SOX A;  3ZPV 1;  3U5N A;  3N9P A;  2QIC A;  2DSM A;  2ZET C;  1VFY A;  3L11 A;  5JG6 A;  2G43 A;  4GNE A;  3LQJ A;  2MKE A;  3M99 A;  1LDJ B;  2EOD A;  3O35 A;  2Y1M A;  4YBS A;  4I7D A;  3SHB A;  2YQL A;  2ECI A;  2CT2 A;  2KYU A;  2H0D B;  3IHP A;  5TDR A;  3M7K A;  4MSX A;  2M1R A;  2CSY A;  3KNV A;  2KKY A;  5J3X A;  2YU4 A;  3ZVY A;  2YQM A;  3GL6 A;  5FB0 A;  2KWN A;  2C2V S;  4A4B A;  4WZ0 A;  2F6N A;  1Z2Q A;  2M85 A;  4Z0R A;  4O62 A;  2H0D A;  4UP0 A;  4ZDT A;  2RI7 A;  4I7B A;  1WIL A;  1DCQ A;  2MD8 C;  5C11 A;  2G45 A;  4L58 A;  3N9O A;  2VNF A;  3N9Q A;  5SVY A;  4YAT A;  4QF3 A;  3MHH A;  2L80 A;  3PUQ A;  3RPG B;  2CKL A;  4F1P A;  2IQJ A;  3ZYQ A;  2KRE A;  3O33 A;  4Q6F A;  2JMD A;  3FAN A;  2Y1N A;  3O7A A;  2F6J A;  2AN6 A;  2I50 A;  4S3O C;  2JMJ A;  4LJN A;  1X4I A;  3LDY A;  3N9N A;  1WE9 A;  2ECV A;  2LRI C;  4YAD A;  2LN0 A;  3KQI A;  2VPE A;  3M63 A;  3LQI A;  2LDR A;  2E6R A;  3LQH A;  2EXU A;  3FJU B;  4OGC A;  2LXH C;  2F42 A;  2L7P A;  2ECW A;  3FEH A;  5H9M A;  2VP7 A;  5SVI B;  4UP5 A;  2Y43 A;  2VJF A;  2CRR A;  2JRJ A;  2L5U A;  3PLW A;  2XOC A;  2BAY A;  2P57 A;  2K1J A;  5LKX A;  3V43 A;  2KIZ A;  4AYC A;  2XOY A;  4V3L C;  4BHW A;  2YSM A;  1XWH A;  2KGG A;  3M62 A;  5DKA A;  2LGK A;  3ZPV E;  5AIT A;  5K3Q A;  2MA5 A;  3O70 A;  2ECN A;  5SVX A;  2MT5 A;  4H9D A;  5H1U A;  4AUQ B;  2JMI A;  2YHN A;  2RR4 A;  2LV9 A;  2EGM A;  2CON A;  1F62 A;  2E61 A;  3LVQ E;  5D1L B;  2ECT A;  5H1T A;  4R2Y A;  3DQV R;  1HYJ A;  2LGG A;  4OGE A;  3VK6 A;  1FP0 A;  3Q1D A;  4AYC B;  2YVR A;  3DPL R;  4Z0O A;  4NN2 A;  3T9K A;  2CRW A;  1IYM A;  4YAB A;  2LQ6 A;  5G04 B;  2KFT A;  2EA6 A;  3T7L A;  2YUC A;  1BOR A;  3O36 A;  3L1X A;  3JUE A;  4MVT A;  1V87 A;  3O34 A;  5EYA F;  3U5M A;  2MNZ A;  4LK9 A;  2K4D A;  4L7X A;  3H7H A;  4LAD B;  1HYI A;  5TAB A;  2LXP C;  5TBN A;  5TRB A;  2KWO A;  2KE1 A;  1WEN A;  3N9L A;  4P5O B;  5H1V A;  1X4J A;  3QZV A;  4AP4 A;  4IC3 A;  2D8S A;  2G6Q A;  4QQ4 A;  2LGL A;  5B75 A;  4R7E A;  2YSJ A;  2CSV A;  3ZNI A;  2B0O E;  2RSD A;  1WEP A; 
#chains in the Genus database with same CATH homology
 1WEV A;  2IDA A;  3KV6 A;  4O64 A;  3C5K A;  1DVP A;  4FJC A;  4FIP A;  2L0B A;  4YBT A;  1Z60 A;  2KR4 A;  4PTB A;  4S3O B;  1K2F A;  2QIZ A;  2ECJ A;  1LDK C;  5B76 A;  3LRQ A;  2FUI A;  2K16 A;  4A49 A;  4GNF A;  4A0C D;  5D1M B;  3T6R A;  3HCU A;  5C13 A;  4N3W A;  2KWK A;  1WEQ A;  2KU3 A;  2PUY A;  1WEW A;  1WEU A;  1WEO A;  4PPE A;  5B77 A;  2LGV A;  2VJE A;  2KWJ A;  2C2L A;  1RMD A;  2YW8 A;  3ZVZ B;  5I3L A;  2MA6 A;  3RTR B;  4QF2 A;  4V3K C;  4B86 C;  4C9Z A;  3HTK C;  4ZUX U;  2M3H A;  2KGI A;  3PUR A;  3EB6 A;  4GNG A;  2MUM A;  1G25 A;  1WGM A;  2UZG A;  4WA6 A;  2MD7 B;  2DX8 A;  1Z6U A;  1WEE A;  1ZBD B;  2HYE D;  2M6M A;  5D1K B;  1T1H A;  3SOW A;  4R8P K;  1JM7 B;  2FSA A;  1WES A;  5B8D A;  2YRE A;  4I7C A;  4FK5 A;  4AVX A;  2YHO A;  3FL2 A;  4LKA A;  3GV4 A;  5B79 A;  2HDP A;  3PHD A;  1MM2 A;  1MM3 A;  1WIM A;  5DIN A;  4FO9 A;  1JOC A;  4YC9 A;  2CSZ A;  4IC2 A;  5KH7 A;  5KH3 A;  4YBM A;  2EGP A;  1CHC A;  1U6G B;  5G05 B;  5AIU A;  4GB0 A;  1WEM A;  2YYR A;  4ZQL A;  5FER A;  4YAX A;  5FEY A;  4A4C A;  3MHS A;  2YUR A;  4X3G A;  3U5O A;  1JM7 A;  3HCS A;  5TDW A;  4WZ2 A;  5G0F A;  4CCG X;  2VPD A;  2E6S A;  5LKU A;  1WFK A;  2FUU A;  2CKL B;  2VJF B;  2PNX A;  3U5P A;  5KH9 A;  2XB1 A;  2VJE B;  3I2D A;  3SOU A;  2XEU A;  1VD4 A;  4W4U A;  2MNY A;  4F52 B;  4WZ3 B;  5B78 A;  3ASL A;  3NG2 A;  2VPG A;  2VPB A;  2ECG A;  4XI1 A;  1FBV A;  4CA1 A;  3N9M A;  4GND A;  1N87 A;  2YT5 A;  1E4U A;  2L75 A;  5LKZ A;  3EB5 A;  3C6W A;  4LLB A;  3KV5 A;  4B7Y C;  4N4F A;  1VYX A;  2MIQ A;  3ZTG A;  5LKT A;  3HCT A;  2OXQ C;  2L43 A;  4TKP B;  3O37 A;  5LCW B;  3RPG C;  5FB1 A;  4BBQ A;  2K17 A;  2NAA A;  4UI9 B;  3L1Z B;  2QJ0 A;  1X4U A;  3SOX A;  3ZPV 1;  3U5N A;  3N9P A;  2QIC A;  2ZET C;  1VFY A;  3L11 A;  5JG6 A;  2G43 A;  4GNE A;  3LQJ A;  3M99 A;  1LDJ B;  2EOD A;  3O35 A;  2Y1M A;  4YBS A;  4I7D A;  3SHB A;  2YQL A;  2ECI A;  2CT2 A;  2KYU A;  2H0D B;  3IHP A;  5TDR A;  4MSX A;  2M1R A;  2CSY A;  3KNV A;  5J3X A;  2YU4 A;  3ZVY A;  2YQM A;  3GL6 A;  5FB0 A;  2KWN A;  2C2V S;  4A4B A;  4WZ0 A;  2F6N A;  1Z2Q A;  2M85 A;  2H0D A;  4UP0 A;  4ZDT A;  2RI7 A;  4I7B A;  1WIL A;  2MD8 C;  5C11 A;  2G45 A;  4L58 A;  3N9O A;  2VNF A;  3N9Q A;  4YAT A;  4QF3 A;  3MHH A;  2L80 A;  3PUQ A;  3RPG B;  2CKL A;  3ZYQ A;  2KRE A;  3O33 A;  4Q6F A;  2JMD A;  3O7A A;  2Y1N A;  2F6J A;  2AN6 A;  2I50 A;  4S3O C;  2JMJ A;  4LJN A;  1X4I A;  3N9N A;  1WE9 A;  2ECV A;  2LRI C;  4YAD A;  2LN0 A;  3KQI A;  2VPE A;  3M63 A;  3LQI A;  2LDR A;  2E6R A;  3LQH A;  2LXH C;  2F42 A;  2ECW A;  5H9M A;  2VP7 A;  4UP5 A;  2Y43 A;  2VJF A;  2JRJ A;  2L5U A;  2BAY A;  5LKX A;  2K1J A;  3V43 A;  2KIZ A;  4AYC A;  4V3L C;  4BHW A;  2YSM A;  1XWH A;  2KGG A;  3M62 A;  5DKA A;  2LGK A;  3ZPV E;  5AIT A;  2MA5 A;  3O70 A;  2ECN A;  2MT5 A;  5H1U A;  4AUQ B;  2JMI A;  2YHN A;  2LV9 A;  1F62 A;  5D1L B;  2ECT A;  5H1T A;  4R2Y A;  3DQV R;  1HYJ A;  2LGG A;  3VK6 A;  1FP0 A;  4AYC B;  3DPL R;  4NN2 A;  1IYM A;  4YAB A;  2LQ6 A;  5G04 B;  2KFT A;  2EA6 A;  3T7L A;  2YUC A;  1BOR A;  3O36 A;  3L1X A;  4MVT A;  1V87 A;  3O34 A;  5EYA F;  3U5M A;  2MNZ A;  4LK9 A;  2K4D A;  4L7X A;  4LAD B;  1HYI A;  5TAB A;  2LXP C;  5TBN A;  5TRB A;  2KWO A;  2KE1 A;  1WEN A;  3N9L A;  4P5O B;  5H1V A;  1X4J A;  3QZV A;  4AP4 A;  4IC3 A;  2D8S A;  2G6Q A;  2LGL A;  5B75 A;  4R7E A;  2YSJ A;  3ZNI A;  2RSD A;  1WEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...