2M13A

The zz domain of cytoplasmic polyadenylation element binding protein 1 (cpeb1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GPVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKNRDSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Cytoplasmic polyadenylation element-binding protein 1
publication title The C-Terminal Region of Cytoplasmic Polyadenylation Element Binding Protein Is a ZZ Domain with Potential for Protein-Protein Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.130 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2m13A00
2MKEA 2M13A
chains in the Genus database with same CATH superfamily
2KR4A 3PURA 1K2FA 3KV5A 4UP0A 5FERA 4CCGX 4A0CD 4X3GA 3U5NA 5DKAA 3SOXA 4Z0RA 5FB0A 4F1PA 3LJUX 4Q6FA 3N9NA 2CONA 3U5PA 4R2YA 3PUQA 2RR4A 1Z2QA 3HTKC 2D8SA 3RPGB 1ZBDB 2EA6A 5H1UA 2EGPA 1T1HA 4V3LC 2VNFA 5B78A 2KFTA 5H9MA 4WZ2A 3ZPV1 2MIQA 4O64A 2ECVA 2L7PA 5H1VA 5TBNA 4OGEA 3M62A 2CKLB 2CSVA 2YW8A 5C13A 2KGGA 3E2DA 2NAAA 2KREA 4ZDTA 3DWDA 1G25A 3ZTGA 1WESA 3LQJA 2YQLA 1VFYA 2L5UA 3C6WA 3SOWA 5KH9A 4P5OB 4WA6A 2M13A 3MDBC 3M7KA 4QF2A 1HYIA 2KE1A 4A4BA 2YHNA 2LN0A 2VP7A 4C9ZA 2G6QA 5H1TA 3O47A 5G0FA 2L0BA 2JMDA 4GNDA 3T6RA 5AIUA 3DQVR 4AYCA 3FJUB 4YBTA 4N4FA 3O70A 2QICA 2KWOA 3T9KA 3O33A 2MD8C 4QF3A 3LQIA 3RTRB 5B75A 2MA6A 2XB1A 2ZETC 4H9DA 5EYAF 1MM2A 5D1LB 2KGIA 4B7YC 3ZNIA 5TRBA 1WENA 3NG2A 2G43A 4QQ4A 2MA5A 1X4UA 2Y1MA 1DVPA 2JM3A 2L75A 3FM8C 1WEMA 2LXPC 4GNEA 2YU4A 4ZUXU 4IC2A 3PHDA 3ZVYA 2FUUA 5J3XA 4CA1A 2FFWA 2L80A 5K3QA 1WFKA 2K4DA 4R7EA 4MVTA 5B77A 5LKZA 2AN6A 4NN2A 3HCTA 1XWHA 2YURA 2XP0A 1Z6UA 4YABA 5TABA 4TKPB 2LDRA 5I3LA 3ZPVE 3JUEA 2EGMA 4GNGA 2KWJA 2YQMA 2E6SA 1WILA 2H0DA 2LXHC 2Y1NA 3RPGC 2F42A 2UZGA 5AITA 5TDRA 3Q1DA 4YATA 5SVXA 2MT5A 4AYCB 4A49A 2F6NA 1BORA 1E4UA 4OGCA 2YVRA 3GL6A 3O35A 4YADA 3O34A 3M63A 3HCSA 3PLWA 4AUQB 2I50A 2LAUA 2LGLA 4I7BA 2FSAA 3L1ZB 3KV6A 2PUYA 3HCUA 4LLBA 2DSMA 5JG6A 2FUIA 2ECIA 5B8DA 4F52B 1U6GB 5KH3A 1V87A 2K16A 4YAXA 2XEUA 3U5OA 5DINA 2LRIC 5D1KB 4MSXA 2CSZA 2KWNA 4PPEA 3N9LA 1WEPA 3C5KA 1WE9A 4FIPA 3M99A 4L58A 1MM3A 2LGGA 3KQIA 2EXUA 5LKTA 2JUNA 5SVIA 1WEUA 1WEWA 4YBMA 1Z60A 2H0DB 1FBVA 2YSMA 2YYRA 3N9OA 1WEEA 4LJNA 5D1MB 4WZ3B 2RSDA 2KKXA 1WEQA 4GNFA 3MHSA 5B76A 5TDWA 1DCQA 2KU3A 2LGVA 3T7LA 3ASLA 2E6RA 3SHBA 2KWKA 4YC9A 3N9PA 3SOUA 5C11A 2XOYA 3FL2A 2VJEA 1IYMA 5LCWB 4N3WA 3DDTA 4UP5A 2ECJA 2M3HA 2KYUA 3L1XA 2YREA 2ECNA 2OXQC 4V3KC 1LDJB 3N9QA 2VJFA 2VPGA 3LVQE 3U5MA 4R8PK 3LVRE 1JM7A 2RI7A 3LQHA 1JOCA 3V43A 4LADB 3FAOA 3DPLR 2YT5A 4S3OB 2LV9A 4WZ0A 4YBSA 2K1JA 1WEVA 1X4JA 2VPEA 5G04B 4A4CA 3H7HA 2VPBA 2XOZA 4IC3A 5G05B 1HYJA 1VD4A 5SVIB 2DJAA 4ZQLA 5FEYA 2HYED 5LKUA 2MNZA 2CSYA 4FJCA 2ECTA 2YHOA 4BHWA 3ZYQA 3KNVA 2PNXA 3ZVZB 1N87A 1WEOA 1WIMA 2C2VS 2CRRA 2ECGA 2LGKA 4AP4A 5B79A 3O37A 3KDEC 2JMIA 2QJ0A 3N9MA 3QZVA 5FB1A 2CT2A 2MKEA 2C2LA 2VJEB 1VYXA 2QIZA 2F6JA 2MNYA 2LQ6A 2L43A 2D8UA 1F62A 4UI9B 4Z0OA 3LRQA 3SUBA 1CHCA 2VJFB 1JM7B 1MBMA 2YSJA 2CRWA 2FD4A 3IHPA 1RMDA 2EODA 2P57A 3O7AA 2IDAA 1WGMA 3L11A 2K17A 2KKYA 4I7CA 5SVYA 2XOCA 2B0OE 1LDKC 4AVXA 3VK6A 2M85A 4L7XA 2OWAA 2DX8A 2KIZA 4FK5A 3I2DA 5KH7A 2MUMA 2ECWA 1FP0A 2Y43A 2JMJA 4PTBA 4GB0A 1X4IA 2M1RA 2YUCA 4LKAA 4B86C 2CKLA 2G45A 4BBQA 3O36A 3FANA 4XI1A 2JRJA 2HDPA 4O62A 4FO9A 2E61A 3GV4A 2IQJA 2MD7B 3LDYA 3EB5A 3MHHA 4W4UA 2VPDA 4S3OC 4LK9A 3EB6A 5LKXA 4I7DA 3FEHA 2BAYA 2M6MA
chains in the Genus database with same CATH topology
3H7HA 2XOZA 2YREA 3KDEC 4O62A 2KKXA 3Q1DA 2E61A 3O47A 5SVXA 2IQJA 5SVIB 2FD4A 2CRWA 2DJAA 1DCQA 3LVQE 5K3QA 3LDYA 4QQ4A 2EXUA 2M13A 3LVRE 3MDBC 2JUNA 4Z0RA 2MKEA 3M7KA 5SVIA 2JM3A 2XP0A 4F1PA 4OGCA 2P57A 3FJUB 3LJUX 2L7PA 4OGEA 2YVRA 3FM8C 2CONA 2CSVA 2XOYA 3JUEA 3T9KA 2EGMA 3E2DA 2KKYA 3PLWA 3DWDA 5SVYA 3SUBA 3FEHA 2XOCA 2D8UA 2CRRA 2LAUA 4Z0OA 4H9DA 2FFWA 2B0OE 2RR4A 3DDTA 2OWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKE A;  2M13 A; 
#chains in the Genus database with same CATH topology
 2KR4 A;  3PUR A;  1K2F A;  3KV5 A;  4UP0 A;  5FER A;  4CCG X;  4A0C D;  4X3G A;  3U5N A;  5DKA A;  3SOX A;  4Z0R A;  5FB0 A;  4F1P A;  3LJU X;  4Q6F A;  3N9N A;  2CON A;  3U5P A;  4R2Y A;  3PUQ A;  2RR4 A;  1Z2Q A;  3HTK C;  2D8S A;  3RPG B;  1ZBD B;  2EA6 A;  5H1U A;  2EGP A;  1T1H A;  4V3L C;  2VNF A;  5B78 A;  2KFT A;  5H9M A;  4WZ2 A;  3ZPV 1;  2MIQ A;  4O64 A;  2ECV A;  2L7P A;  5H1V A;  5TBN A;  4OGE A;  3M62 A;  2CKL B;  2CSV A;  2YW8 A;  5C13 A;  2KGG A;  3E2D A;  2NAA A;  2KRE A;  4ZDT A;  3DWD A;  1G25 A;  3ZTG A;  1WES A;  3LQJ A;  2YQL A;  1VFY A;  2L5U A;  3C6W A;  3SOW A;  5KH9 A;  4P5O B;  4WA6 A;  2M13 A;  3MDB C;  3M7K A;  4QF2 A;  1HYI A;  2KE1 A;  4A4B A;  2YHN A;  2LN0 A;  2VP7 A;  4C9Z A;  2G6Q A;  5H1T A;  3O47 A;  5G0F A;  2L0B A;  2JMD A;  4GND A;  3T6R A;  5AIU A;  3DQV R;  4AYC A;  3FJU B;  4YBT A;  4N4F A;  3O70 A;  2QIC A;  2KWO A;  3T9K A;  3O33 A;  2MD8 C;  4QF3 A;  3LQI A;  3RTR B;  5B75 A;  2MA6 A;  2XB1 A;  2ZET C;  4H9D A;  5EYA F;  1MM2 A;  5D1L B;  2KGI A;  4B7Y C;  3ZNI A;  5TRB A;  1WEN A;  3NG2 A;  2G43 A;  4QQ4 A;  2MA5 A;  1X4U A;  2Y1M A;  1DVP A;  2JM3 A;  2L75 A;  3FM8 C;  1WEM A;  2LXP C;  4GNE A;  2YU4 A;  4ZUX U;  4IC2 A;  3PHD A;  3ZVY A;  2FUU A;  5J3X A;  4CA1 A;  2FFW A;  2L80 A;  5K3Q A;  1WFK A;  2K4D A;  4R7E A;  4MVT A;  5B77 A;  5LKZ A;  2AN6 A;  4NN2 A;  3HCT A;  1XWH A;  2YUR A;  2XP0 A;  1Z6U A;  4YAB A;  5TAB A;  4TKP B;  2LDR A;  5I3L A;  3ZPV E;  3JUE A;  2EGM A;  4GNG A;  2KWJ A;  2YQM A;  2E6S A;  1WIL A;  2H0D A;  2LXH C;  2Y1N A;  3RPG C;  2F42 A;  2UZG A;  5AIT A;  5TDR A;  3Q1D A;  4YAT A;  5SVX A;  2MT5 A;  4AYC B;  4A49 A;  2F6N A;  1BOR A;  1E4U A;  4OGC A;  2YVR A;  3GL6 A;  3O35 A;  4YAD A;  3O34 A;  3M63 A;  3HCS A;  3PLW A;  4AUQ B;  2I50 A;  2LAU A;  2LGL A;  4I7B A;  2FSA A;  3L1Z B;  3KV6 A;  2PUY A;  3HCU A;  4LLB A;  2DSM A;  5JG6 A;  2FUI A;  2ECI A;  5B8D A;  4F52 B;  1U6G B;  5KH3 A;  1V87 A;  2K16 A;  4YAX A;  2XEU A;  3U5O A;  5DIN A;  2LRI C;  5D1K B;  4MSX A;  2CSZ A;  2KWN A;  4PPE A;  3N9L A;  1WEP A;  3C5K A;  1WE9 A;  4FIP A;  3M99 A;  4L58 A;  1MM3 A;  2LGG A;  3KQI A;  2EXU A;  5LKT A;  2JUN A;  5SVI A;  1WEU A;  1WEW A;  4YBM A;  1Z60 A;  2H0D B;  1FBV A;  2YSM A;  2YYR A;  3N9O A;  1WEE A;  4LJN A;  5D1M B;  4WZ3 B;  2RSD A;  2KKX A;  1WEQ A;  4GNF A;  3MHS A;  5B76 A;  5TDW A;  1DCQ A;  2KU3 A;  2LGV A;  3T7L A;  3ASL A;  2E6R A;  3SHB A;  2KWK A;  4YC9 A;  3N9P A;  3SOU A;  5C11 A;  2XOY A;  3FL2 A;  2VJE A;  1IYM A;  5LCW B;  4N3W A;  3DDT A;  4UP5 A;  2ECJ A;  2M3H A;  2KYU A;  3L1X A;  2YRE A;  2ECN A;  2OXQ C;  4V3K C;  1LDJ B;  3N9Q A;  2VJF A;  2VPG A;  3LVQ E;  3U5M A;  4R8P K;  3LVR E;  1JM7 A;  2RI7 A;  3LQH A;  1JOC A;  3V43 A;  4LAD B;  3FAO A;  3DPL R;  2YT5 A;  4S3O B;  2LV9 A;  4WZ0 A;  4YBS A;  2K1J A;  1WEV A;  1X4J A;  2VPE A;  5G04 B;  4A4C A;  3H7H A;  2VPB A;  2XOZ A;  4IC3 A;  5G05 B;  1HYJ A;  1VD4 A;  5SVI B;  2DJA A;  4ZQL A;  5FEY A;  2HYE D;  5LKU A;  2MNZ A;  2CSY A;  4FJC A;  2ECT A;  2YHO A;  4BHW A;  3ZYQ A;  3KNV A;  2PNX A;  3ZVZ B;  1N87 A;  1WEO A;  1WIM A;  2C2V S;  2CRR A;  2ECG A;  2LGK A;  4AP4 A;  5B79 A;  3O37 A;  3KDE C;  2JMI A;  2QJ0 A;  3N9M A;  3QZV A;  5FB1 A;  2CT2 A;  2MKE A;  2C2L A;  2VJE B;  1VYX A;  2QIZ A;  2F6J A;  2MNY A;  2LQ6 A;  2L43 A;  2D8U A;  1F62 A;  4UI9 B;  4Z0O A;  3LRQ A;  3SUB A;  1CHC A;  2VJF B;  1JM7 B;  1MBM A;  2YSJ A;  2CRW A;  2FD4 A;  3IHP A;  1RMD A;  2EOD A;  2P57 A;  3O7A A;  2IDA A;  1WGM A;  3L11 A;  2K17 A;  2KKY A;  4I7C A;  5SVY A;  2XOC A;  2B0O E;  1LDK C;  4AVX A;  3VK6 A;  2M85 A;  4L7X A;  2OWA A;  2DX8 A;  2KIZ A;  4FK5 A;  3I2D A;  5KH7 A;  2MUM A;  2ECW A;  1FP0 A;  2Y43 A;  2JMJ A;  4PTB A;  4GB0 A;  1X4I A;  2M1R A;  2YUC A;  4LKA A;  4B86 C;  2CKL A;  2G45 A;  4BBQ A;  3O36 A;  3FAN A;  4XI1 A;  2JRJ A;  2HDP A;  4O62 A;  4FO9 A;  2E61 A;  3GV4 A;  2IQJ A;  2MD7 B;  3LDY A;  3EB5 A;  3MHH A;  4W4U A;  2VPD A;  4S3O C;  4LK9 A;  3EB6 A;  5LKX A;  4I7D A;  3FEH A;  2BAY A;  2M6M A; 
#chains in the Genus database with same CATH homology
 3H7H A;  2XOZ A;  2YRE A;  3KDE C;  4O62 A;  2KKX A;  3Q1D A;  2E61 A;  3O47 A;  5SVX A;  2IQJ A;  5SVI B;  2FD4 A;  2CRW A;  2DJA A;  1DCQ A;  3LVQ E;  5K3Q A;  3LDY A;  4QQ4 A;  2EXU A;  2M13 A;  3LVR E;  3MDB C;  2JUN A;  4Z0R A;  2MKE A;  3M7K A;  5SVI A;  2JM3 A;  2XP0 A;  4F1P A;  4OGC A;  2P57 A;  3FJU B;  3LJU X;  2L7P A;  4OGE A;  2YVR A;  3FM8 C;  2CON A;  2CSV A;  2XOY A;  3JUE A;  3T9K A;  2EGM A;  3E2D A;  2KKY A;  3PLW A;  3DWD A;  5SVY A;  3SUB A;  3FEH A;  2XOC A;  2D8U A;  2CRR A;  2LAU A;  4Z0O A;  4H9D A;  2FFW A;  2B0O E;  2RR4 A;  3DDT A;  2OWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...