2M13A

The zz domain of cytoplasmic polyadenylation element binding protein 1 (cpeb1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
b'GPVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKNRDSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytoplasmic polyadenylation element-binding protein 1
publication title The C-Terminal Region of Cytoplasmic Polyadenylation Element Binding Protein Is a ZZ Domain with Potential for Protein-Protein Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.130 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2m13A00
2M13A 2MKEA
chains in the Genus database with same CATH superfamily
2JM3A 2ECWA 3HCSA 2PUYA 4X3GA 2QICA 2JUNA 4B7YC 2M6MA 1IYMA 3LQIA 3QZVA 3T9KA 4W4UA 3M7KA 2C2LA 1F62A 3HCTA 5FB1A 2E6SA 1LDKC 2CRRA 4YABA 4F52B 1WEMA 2EGPA 3I2DA 3ZTGA 2FSAA 1WEEA 3JUEA 2JMJA 5LKZA 3PURA 4PTBA 2VPDA 1DCQA 2EXUA 4NN2A 2MA6A 4QF2A 4R2YA 5G05B 3LVRE 4L7XA 3O34A 2K1JA 2YSMA 4OGCA 4Z0OA 2VP7A 4GNGA 2KFTA 2JRJA 2LXHC 2JMIA 3EB6A 2LXPC 3LQHA 3C6WA 4AYCB 4GNFA 3SHBA 3N9OA 4PPEA 1WE9A 4LLBA 2KWNA 4MVTA 4A4BA 1LDJB 2MUMA 3PLWA 2CKLA 2CRWA 2Y43A 5TDWA 4WZ0A 2MT5A 1FBVA 2K4DA 3KV5A 5EYAF 4CCGX 2LN0A 2MA5A 5H1UA 2MNZA 3DPLR 3PHDA 5D1MB 5FERA 3O7AA 2KKXA 1WEQA 4O64A 4WA6A 2YQLA 2M13A 2AN6A 4AVXA 2K17A 4TKPB 1ZBDB 4I7BA 2LGGA 1Z60A 5SVIB 2L7PA 2XOCA 2ECVA 3ZPVE 3EB5A 4UP5A 2KGGA 2RI7A 1Z6UA 2D8UA 2VJFA 1WEUA 5B79A 4AP4A 2OWAA 3M99A 4YATA 2F6JA 2D8SA 5TDRA 5B8DA 1WEWA 2JMDA 2VJEB 2DX8A 4GNDA 3O37A 2YYRA 4CA1A 5TBNA 4GB0A 2RSDA 3M62A 5SVIA 1JM7A 2FD4A 2H0DA 2MNYA 2ECNA 1HYIA 2NAAA 2KREA 5TRBA 4A4CA 2XP0A 2IDAA 3FEHA 1WESA 5H1VA 2YSJA 4L58A 2LDRA 3LRQA 3PUQA 3SOWA 1G25A 4V3LC 3SOUA 5G04B 1U6GB 2M3HA 3O35A 2HDPA 1MM3A 3KV6A 5KH9A 4IC3A 2CSYA 3LDYA 3M63A 3U5MA 4YADA 3ZYQA 3T6RA 3ZVYA 2KYUA 5LKUA 2G45A 4FK5A 3N9QA 1X4UA 3L1ZB 1WEPA 4ZUXU 2EA6A 1DVPA 4Z0RA 4MSXA 2ECGA 1MM2A 2XOZA 4C9ZA 2G43A 4F1PA 2L75A 2CSVA 2C2VS 2LRIC 4FO9A 4YBMA 5AITA 3MDBC 3ZPV1 3N9NA 3ASLA 4YBSA 2XEUA 2UZGA 2KIZA 1T1HA 4BBQA 2XB1A 3KQIA 3SUBA 4ZDTA 2L80A 2QIZA 2KR4A 2G6QA 2KWKA 3GL6A 2VPBA 5FB0A 5SVYA 4N4FA 4AYCA 2KE1A 1X4JA 4BHWA 2ECJA 5I3LA 1FP0A 1E4UA 2MD7B 2EODA 3RPGC 2KKYA 2YW8A 3O33A 5DKAA 2Y1MA 4YAXA 4LADB 1CHCA 4YC9A 4ZQLA 5H1TA 5B75A 1MBMA 2YUCA 4Q6FA 3RPGB 1V87A 3N9LA 4V3KC 3E2DA 3FM8C 4UP0A 2YREA 3FAOA 4FIPA 2KGIA 1X4IA 5G0FA 2K16A 2PNXA 3L1XA 3O70A 2LQ6A 1K2FA 2B0OE 3O47A 3GV4A 5LKTA 2MIQA 2HYED 4WZ2A 2MD8C 5LCWB 5D1KB 1WEVA 3SOXA 3LJUX 3MHHA 4R7EA 2CSZA 4P5OB 2VJEA 4OGEA 1WENA 2KWOA 2YU4A 5KH7A 2P57A 4GNEA 3DWDA 2M85A 3O36A 2KU3A 4LJNA 1JOCA 1WILA 4WZ3B 5K3QA 2E6RA 5H9MA 2LV9A 2QJ0A 3NG2A 3FL2A 3KNVA 3FANA 4R8PK 3U5PA 4B86C 1N87A 4QF3A 3FJUB 3U5NA 3HCUA 4H9DA 4I7DA 2IQJA 4O62A 1VYXA 3C5KA 2L43A 3L11A 2L0BA 3Q1DA 3KDEC 2YQMA 5TABA 2VNFA 3N9MA 1WIMA 3U5OA 2EGMA 3RTRB 2CT2A 3MHSA 2CKLB 3IHPA 2ECIA 5KH3A 2L5UA 2LGVA 2OXQC 2YVRA 4QQ4A 2VPGA 3V43A 3H7HA 2FUUA 4A0CD 2YURA 4S3OC 1XWHA 2CONA 2KWJA 4LKAA 1HYJA 5FEYA 1RMDA 3HTKC 5LKXA 2ECTA 2LAUA 2YHOA 4S3OB 2XOYA 2RR4A 3DDTA 4I7CA 4LK9A 2DJAA 2Y1NA 4AUQB 2FUIA 2VJFB 3T7LA 4A49A 2E61A 2ZETC 2M1RA 2F6NA 2VPEA 5B77A 3DQVR 5AIUA 1Z2QA 1BORA 1WFKA 2F42A 4N3WA 4YBTA 2MKEA 2YHNA 2LGKA 3VK6A 2I50A 1WGMA 1WEOA 3LQJA 3ZNIA 4FJCA 1JM7B 3ZVZB 2H0DB 2FFWA 2YT5A 5J3XA 2BAYA 5C11A 1VD4A 4IC2A 3LVQE 5JG6A 5B78A 5C13A 4UI9B 5DINA 3N9PA 2DSMA 5D1LB 4XI1A 1VFYA 5SVXA 5B76A 2LGLA
chains in the Genus database with same CATH topology
4OGCA 4Z0OA 3SUBA 2P57A 4H9DA 2JM3A 2MKEA 2B0OE 2IQJA 2XOYA 4O62A 3DWDA 2XOZA 2RR4A 3DDTA 3O47A 5SVIA 2JUNA 2YVRA 5SVYA 5SVIB 1DCQA 2EXUA 4QQ4A 2DJAA 2L7PA 2FD4A 2XOCA 3T9KA 4F1PA 3Q1DA 3KDEC 2FFWA 3H7HA 2CSVA 3E2DA 3FM8C 3JUEA 2D8UA 5K3QA 3M7KA 2E61A 2YREA 3LVRE 3LDYA 3LVQE 2CONA 3MDBC 2OWAA 2XP0A 3LJUX 2KKXA 5SVXA 3FEHA 2CRRA 2LAUA 2KKYA 2EGMA 4OGEA 3FJUB 2M13A 4Z0RA 3PLWA 2CRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M13 A;  2MKE A; 
#chains in the Genus database with same CATH topology
 2JM3 A;  2ECW A;  3HCS A;  2PUY A;  4X3G A;  2QIC A;  2JUN A;  4B7Y C;  2M6M A;  1IYM A;  3LQI A;  3QZV A;  3T9K A;  4W4U A;  3M7K A;  2C2L A;  1F62 A;  3HCT A;  5FB1 A;  2E6S A;  1LDK C;  2CRR A;  4YAB A;  4F52 B;  1WEM A;  2EGP A;  3I2D A;  3ZTG A;  2FSA A;  1WEE A;  3JUE A;  2JMJ A;  5LKZ A;  3PUR A;  4PTB A;  2VPD A;  1DCQ A;  2EXU A;  4NN2 A;  2MA6 A;  4QF2 A;  4R2Y A;  5G05 B;  3LVR E;  4L7X A;  3O34 A;  2K1J A;  2YSM A;  4OGC A;  4Z0O A;  2VP7 A;  4GNG A;  2KFT A;  2JRJ A;  2LXH C;  2JMI A;  3EB6 A;  2LXP C;  3LQH A;  3C6W A;  4AYC B;  4GNF A;  3SHB A;  3N9O A;  4PPE A;  1WE9 A;  4LLB A;  2KWN A;  4MVT A;  4A4B A;  1LDJ B;  2MUM A;  3PLW A;  2CKL A;  2CRW A;  2Y43 A;  5TDW A;  4WZ0 A;  2MT5 A;  1FBV A;  2K4D A;  3KV5 A;  5EYA F;  4CCG X;  2LN0 A;  2MA5 A;  5H1U A;  2MNZ A;  3DPL R;  3PHD A;  5D1M B;  5FER A;  3O7A A;  2KKX A;  1WEQ A;  4O64 A;  4WA6 A;  2YQL A;  2M13 A;  2AN6 A;  4AVX A;  2K17 A;  4TKP B;  1ZBD B;  4I7B A;  2LGG A;  1Z60 A;  5SVI B;  2L7P A;  2XOC A;  2ECV A;  3ZPV E;  3EB5 A;  4UP5 A;  2KGG A;  2RI7 A;  1Z6U A;  2D8U A;  2VJF A;  1WEU A;  5B79 A;  4AP4 A;  2OWA A;  3M99 A;  4YAT A;  2F6J A;  2D8S A;  5TDR A;  5B8D A;  1WEW A;  2JMD A;  2VJE B;  2DX8 A;  4GND A;  3O37 A;  2YYR A;  4CA1 A;  5TBN A;  4GB0 A;  2RSD A;  3M62 A;  5SVI A;  1JM7 A;  2FD4 A;  2H0D A;  2MNY A;  2ECN A;  1HYI A;  2NAA A;  2KRE A;  5TRB A;  4A4C A;  2XP0 A;  2IDA A;  3FEH A;  1WES A;  5H1V A;  2YSJ A;  4L58 A;  2LDR A;  3LRQ A;  3PUQ A;  3SOW A;  1G25 A;  4V3L C;  3SOU A;  5G04 B;  1U6G B;  2M3H A;  3O35 A;  2HDP A;  1MM3 A;  3KV6 A;  5KH9 A;  4IC3 A;  2CSY A;  3LDY A;  3M63 A;  3U5M A;  4YAD A;  3ZYQ A;  3T6R A;  3ZVY A;  2KYU A;  5LKU A;  2G45 A;  4FK5 A;  3N9Q A;  1X4U A;  3L1Z B;  1WEP A;  4ZUX U;  2EA6 A;  1DVP A;  4Z0R A;  4MSX A;  2ECG A;  1MM2 A;  2XOZ A;  4C9Z A;  2G43 A;  4F1P A;  2L75 A;  2CSV A;  2C2V S;  2LRI C;  4FO9 A;  4YBM A;  5AIT A;  3MDB C;  3ZPV 1;  3N9N A;  3ASL A;  4YBS A;  2XEU A;  2UZG A;  2KIZ A;  1T1H A;  4BBQ A;  2XB1 A;  3KQI A;  3SUB A;  4ZDT A;  2L80 A;  2QIZ A;  2KR4 A;  2G6Q A;  2KWK A;  3GL6 A;  2VPB A;  5FB0 A;  5SVY A;  4N4F A;  4AYC A;  2KE1 A;  1X4J A;  4BHW A;  2ECJ A;  5I3L A;  1FP0 A;  1E4U A;  2MD7 B;  2EOD A;  3RPG C;  2KKY A;  2YW8 A;  3O33 A;  5DKA A;  2Y1M A;  4YAX A;  4LAD B;  1CHC A;  4YC9 A;  4ZQL A;  5H1T A;  5B75 A;  1MBM A;  2YUC A;  4Q6F A;  3RPG B;  1V87 A;  3N9L A;  4V3K C;  3E2D A;  3FM8 C;  4UP0 A;  2YRE A;  3FAO A;  4FIP A;  2KGI A;  1X4I A;  5G0F A;  2K16 A;  2PNX A;  3L1X A;  3O70 A;  2LQ6 A;  1K2F A;  2B0O E;  3O47 A;  3GV4 A;  5LKT A;  2MIQ A;  2HYE D;  4WZ2 A;  2MD8 C;  5LCW B;  5D1K B;  1WEV A;  3SOX A;  3LJU X;  3MHH A;  4R7E A;  2CSZ A;  4P5O B;  2VJE A;  4OGE A;  1WEN A;  2KWO A;  2YU4 A;  5KH7 A;  2P57 A;  4GNE A;  3DWD A;  2M85 A;  3O36 A;  2KU3 A;  4LJN A;  1JOC A;  1WIL A;  4WZ3 B;  5K3Q A;  2E6R A;  5H9M A;  2LV9 A;  2QJ0 A;  3NG2 A;  3FL2 A;  3KNV A;  3FAN A;  4R8P K;  3U5P A;  4B86 C;  1N87 A;  4QF3 A;  3FJU B;  3U5N A;  3HCU A;  4H9D A;  4I7D A;  2IQJ A;  4O62 A;  1VYX A;  3C5K A;  2L43 A;  3L11 A;  2L0B A;  3Q1D A;  3KDE C;  2YQM A;  5TAB A;  2VNF A;  3N9M A;  1WIM A;  3U5O A;  2EGM A;  3RTR B;  2CT2 A;  3MHS A;  2CKL B;  3IHP A;  2ECI A;  5KH3 A;  2L5U A;  2LGV A;  2OXQ C;  2YVR A;  4QQ4 A;  2VPG A;  3V43 A;  3H7H A;  2FUU A;  4A0C D;  2YUR A;  4S3O C;  1XWH A;  2CON A;  2KWJ A;  4LKA A;  1HYJ A;  5FEY A;  1RMD A;  3HTK C;  5LKX A;  2ECT A;  2LAU A;  2YHO A;  4S3O B;  2XOY A;  2RR4 A;  3DDT A;  4I7C A;  4LK9 A;  2DJA A;  2Y1N A;  4AUQ B;  2FUI A;  2VJF B;  3T7L A;  4A49 A;  2E61 A;  2ZET C;  2M1R A;  2F6N A;  2VPE A;  5B77 A;  3DQV R;  5AIU A;  1Z2Q A;  1BOR A;  1WFK A;  2F42 A;  4N3W A;  4YBT A;  2MKE A;  2YHN A;  2LGK A;  3VK6 A;  2I50 A;  1WGM A;  1WEO A;  3LQJ A;  3ZNI A;  4FJC A;  1JM7 B;  3ZVZ B;  2H0D B;  2FFW A;  2YT5 A;  5J3X A;  2BAY A;  5C11 A;  1VD4 A;  4IC2 A;  3LVQ E;  5JG6 A;  5B78 A;  5C13 A;  4UI9 B;  5DIN A;  3N9P A;  2DSM A;  5D1L B;  4XI1 A;  1VFY A;  5SVX A;  5B76 A;  2LGL A; 
#chains in the Genus database with same CATH homology
 4OGC A;  4Z0O A;  3SUB A;  2P57 A;  4H9D A;  2JM3 A;  2MKE A;  2B0O E;  2IQJ A;  2XOY A;  4O62 A;  3DWD A;  2XOZ A;  2RR4 A;  3DDT A;  3O47 A;  5SVI A;  2JUN A;  2YVR A;  5SVY A;  5SVI B;  1DCQ A;  2EXU A;  4QQ4 A;  2DJA A;  2L7P A;  2FD4 A;  2XOC A;  3T9K A;  4F1P A;  3Q1D A;  3KDE C;  2FFW A;  3H7H A;  2CSV A;  3E2D A;  3FM8 C;  3JUE A;  2D8U A;  5K3Q A;  3M7K A;  2E61 A;  2YRE A;  3LVR E;  3LDY A;  3LVQ E;  2CON A;  3MDB C;  2OWA A;  2XP0 A;  3LJU X;  2KKX A;  5SVX A;  3FEH A;  2CRR A;  2LAU A;  2KKY A;  2EGM A;  4OGE A;  3FJU B;  2M13 A;  4Z0R A;  3PLW A;  2CRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...