2M13A

The zz domain of cytoplasmic polyadenylation element binding protein 1 (cpeb1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
GPVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKNRDSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The C-Terminal Region of Cytoplasmic Polyadenylation Element Binding Protein Is a ZZ Domain with Potential for Protein-Protein Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Cytoplasmic polyadenylation element-binding protein 1
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.130 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2m13A00
2MKEA 2M13A
chains in the Genus database with same CATH superfamily
4UP0A 2RI7A 1WESA 3PLWA 3PURA 2KREA 2YVRA 2G43A 4LADB 4Q6FA 2E61A 3O36A 5LKXA 3QZVA 2VJEB 3MHSA 2ECTA 3O33A 2VPDA 2E6SA 2LXPC 4AVXA 5LKTA 1WEEA 2L43A 4AYCB 2C2VS 3U5OA 5D1KB 4UP5A 4I7DA 4L7XA 4NN2A 2M6MA 2VJFB 3PHDA 5G04B 4TKPB 4LJNA 2AN6A 3JUEA 2CKLB 3M99A 3LRQA 5JG6A 5SVIA 3SOUA 1FBVA 3H7HA 2ECJA 3KQIA 3VK6A 2CSZA 2KKYA 3KDEC 1WEMA 2Y1MA 2LXHC 2YHOA 1VYXA 2G6QA 2JRJA 3C6WA 2E6RA 4FIPA 1E4UA 2G45A 2H0DA 1F62A 2D8UA 3U5PA 4OGEA 3N9QA 2QICA 3MDBC 2F42A 2LDRA 2FUUA 4H9DA 3LJUX 5C11A 4R8PK 4I7BA 4LKAA 4B7YC 4CA1A 1HYJA 2YW8A 2VPGA 5FB0A 5G0FA 2MUMA 2XOYA 2IQJA 1Z6UA 1DCQA 2KKXA 1Z60A 2VP7A 1WILA 3PUQA 1VFYA 1MBMA 3LDYA 3T7LA 2IDAA 4ZUXU 2L5UA 3N9MA 2MA6A 5TABA 2LGLA 4I7CA 2KE1A 3LQIA 5B75A 1X4UA 3M62A 3L1XA 1LDKC 2KWKA 4O64A 4AP4A 1DVPA 2L0BA 4LLBA 3M7KA 1X4JA 2MT5A 2YUCA 2VPBA 4ZDTA 2EODA 4PPEA 1WFKA 4F52B 2LN0A 2KWJA 3DQVR 1WGMA 2VJFA 4B86C 2VJEA 4AUQB 2ECIA 2PUYA 2QJ0A 2PNXA 2MNZA 3FM8C 2KWNA 5AIUA 3HCUA 4ZQLA 2KIZA 3SHBA 3ZVZB 1K2FA 2ECVA 3LVQE 4GB0A 2KR4A 3DWDA 1CHCA 1N87A 5LKZA 2K16A 2LV9A 3HCSA 2CKLA 2DJAA 5C13A 1HYIA 2MIQA 4GNEA 3T6RA 2LQ6A 3ZNIA 2KWOA 4V3LC 3ZTGA 2CT2A 5DKAA 1Z2QA 1G25A 2LAUA 2QIZA 4YC9A 4YBSA 2M3HA 2K17A 3GV4A 1RMDA 2JM3A 2XOZA 1WEPA 5TDWA 3U5NA 2CONA 4BHWA 1BORA 5H1UA 1WIMA 3KV5A 1V87A 4FO9A 2YYRA 3EB6A 4IC2A 2MNYA 4X3GA 3SOXA 2CRRA 2YQLA 3DDTA 3RPGB 3ZYQA 4GNDA 4BBQA 3N9LA 4YBTA 2HDPA 4WZ3B 2ECNA 3EB5A 4S3OC 2K1JA 2L75A 4MSXA 1ZBDB 1WEUA 2JMJA 3I2DA 4L58A 2XB1A 2F6NA 1T1HA 2LGGA 5H1TA 5SVXA 2YQMA 2OWAA 3L1ZB 3O37A 1WEVA 2RSDA 2CRWA 2ECWA 2YURA 2EGPA 4R2YA 3FJUB 3O47A 2FUIA 3N9PA 1U6GB 1X4IA 2XP0A 1FP0A 3O35A 3IHPA 4UI9B 4A4BA 3T9KA 2XOCA 2EXUA 3FAOA 3HTKC 4P5OB 2ZETC 3V43A 5KH7A 4CCGX 4WZ2A 2LGVA 4WZ0A 4FK5A 2I50A 2K4DA 4YATA 1MM2A 5G05B 4XI1A 4N3WA 3ZVYA 2FSAA 2JMIA 3ZPV1 1MM3A 1JOCA 2M85A 2YSJA 2XEUA 4WA6A 3KV6A 2EGMA 2M13A 2OXQC 3C5KA 5H1VA 5J3XA 5B8DA 5B76A 1JM7A 5B79A 5K3QA 4R7EA 2FFWA 2YREA 3RTRB 5LCWB 5KH3A 2JUNA 4MVTA 3RPGC 5KH9A 3O34A 1WE9A 4PTBA 2RR4A 2CSYA 3O70A 3GL6A 3FL2A 4QF3A 2F6JA 2CSVA 2H0DB 2YU4A 3E2DA 3LVRE 4S3OB 1IYMA 1XWHA 2YSMA 2VPEA 4A4CA 2P57A 5SVYA 5FERA 5D1LB 2MKEA 4C9ZA 5FB1A 5B78A 5EYAF 2Y1NA 2B0OE 5FEYA 4Z0OA 2NAAA 3U5MA 5LKUA 4GNFA 2YT5A 3MHHA 2KU3A 4YABA 3FEHA 4FJCA 4A49A 4F1PA 2KGIA 3N9OA 3SUBA 2KFTA 3L11A 2VNFA 5SVIB 2EA6A 3KNVA 1WEWA 3LQJA 2JMDA 3LQHA 3M63A 5DINA 4GNGA 4N4FA 2UZGA 4YADA 3N9NA 1WEOA 4OGCA 3Q1DA 4QQ4A 2C2LA 4QF2A 3FANA 2ECGA 2KYUA 4Z0RA 5H9MA 2MA5A 4W4UA 2L7PA 1WENA 1WEQA 5B77A 5I3LA 2HYED 2DSMA 2FD4A 2MD8C 3NG2A 4IC3A 5TBNA 5TRBA 4AYCA 3O7AA 1JM7B 4A0CD 2BAYA 2Y43A 3SOWA 1VD4A 5D1MB 3ASLA 4V3KC 4YAXA 2M1RA 2DX8A 4O62A 2LGKA 3HCTA 2KGGA 2LRIC 2D8SA 3DPLR 4YBMA 2L80A 2MD7B 1LDJB 2YHNA 5TDRA 4LK9A 5AITA 3ZPVE
chains in the Genus database with same CATH topology
2JM3A 2XOZA 3FJUB 3FM8C 3O47A 3M7KA 3E2DA 3LVRE 2D8UA 5K3QA 2P57A 2XP0A 3JUEA 3PLWA 2CONA 2FFWA 4OGEA 2YREA 3FEHA 2YVRA 5SVYA 4Z0RA 3LDYA 4F1PA 3MDBC 2MKEA 3SUBA 2E61A 4H9DA 5SVIB 2JUNA 3LJUX 5SVXA 4O62A 5SVIA 2L7PA 3LVQE 3T9KA 2LAUA 2OWAA 2CRRA 2EXUA 2B0OE 2RR4A 2XOCA 3DDTA 3H7HA 3DWDA 2XOYA 2IQJA 2FD4A 4Z0OA 1DCQA 2CRWA 2KKXA 2KKYA 4OGCA 3Q1DA 3KDEC 2CSVA 4QQ4A 2EGMA 2DJAA 2M13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKE A;  2M13 A; 
#chains in the Genus database with same CATH topology
 4UP0 A;  2RI7 A;  1WES A;  3PLW A;  3PUR A;  2KRE A;  2YVR A;  2G43 A;  4LAD B;  4Q6F A;  2E61 A;  3O36 A;  5LKX A;  3QZV A;  2VJE B;  3MHS A;  2ECT A;  3O33 A;  2VPD A;  2E6S A;  2LXP C;  4AVX A;  5LKT A;  1WEE A;  2L43 A;  4AYC B;  2C2V S;  3U5O A;  5D1K B;  4UP5 A;  4I7D A;  4L7X A;  4NN2 A;  2M6M A;  2VJF B;  3PHD A;  5G04 B;  4TKP B;  4LJN A;  2AN6 A;  3JUE A;  2CKL B;  3M99 A;  3LRQ A;  5JG6 A;  5SVI A;  3SOU A;  1FBV A;  3H7H A;  2ECJ A;  3KQI A;  3VK6 A;  2CSZ A;  2KKY A;  3KDE C;  1WEM A;  2Y1M A;  2LXH C;  2YHO A;  1VYX A;  2G6Q A;  2JRJ A;  3C6W A;  2E6R A;  4FIP A;  1E4U A;  2G45 A;  2H0D A;  1F62 A;  2D8U A;  3U5P A;  4OGE A;  3N9Q A;  2QIC A;  3MDB C;  2F42 A;  2LDR A;  2FUU A;  4H9D A;  3LJU X;  5C11 A;  4R8P K;  4I7B A;  4LKA A;  4B7Y C;  4CA1 A;  1HYJ A;  2YW8 A;  2VPG A;  5FB0 A;  5G0F A;  2MUM A;  2XOY A;  2IQJ A;  1Z6U A;  1DCQ A;  2KKX A;  1Z60 A;  2VP7 A;  1WIL A;  3PUQ A;  1VFY A;  1MBM A;  3LDY A;  3T7L A;  2IDA A;  4ZUX U;  2L5U A;  3N9M A;  2MA6 A;  5TAB A;  2LGL A;  4I7C A;  2KE1 A;  3LQI A;  5B75 A;  1X4U A;  3M62 A;  3L1X A;  1LDK C;  2KWK A;  4O64 A;  4AP4 A;  1DVP A;  2L0B A;  4LLB A;  3M7K A;  1X4J A;  2MT5 A;  2YUC A;  2VPB A;  4ZDT A;  2EOD A;  4PPE A;  1WFK A;  4F52 B;  2LN0 A;  2KWJ A;  3DQV R;  1WGM A;  2VJF A;  4B86 C;  2VJE A;  4AUQ B;  2ECI A;  2PUY A;  2QJ0 A;  2PNX A;  2MNZ A;  3FM8 C;  2KWN A;  5AIU A;  3HCU A;  4ZQL A;  2KIZ A;  3SHB A;  3ZVZ B;  1K2F A;  2ECV A;  3LVQ E;  4GB0 A;  2KR4 A;  3DWD A;  1CHC A;  1N87 A;  5LKZ A;  2K16 A;  2LV9 A;  3HCS A;  2CKL A;  2DJA A;  5C13 A;  1HYI A;  2MIQ A;  4GNE A;  3T6R A;  2LQ6 A;  3ZNI A;  2KWO A;  4V3L C;  3ZTG A;  2CT2 A;  5DKA A;  1Z2Q A;  1G25 A;  2LAU A;  2QIZ A;  4YC9 A;  4YBS A;  2M3H A;  2K17 A;  3GV4 A;  1RMD A;  2JM3 A;  2XOZ A;  1WEP A;  5TDW A;  3U5N A;  2CON A;  4BHW A;  1BOR A;  5H1U A;  1WIM A;  3KV5 A;  1V87 A;  4FO9 A;  2YYR A;  3EB6 A;  4IC2 A;  2MNY A;  4X3G A;  3SOX A;  2CRR A;  2YQL A;  3DDT A;  3RPG B;  3ZYQ A;  4GND A;  4BBQ A;  3N9L A;  4YBT A;  2HDP A;  4WZ3 B;  2ECN A;  3EB5 A;  4S3O C;  2K1J A;  2L75 A;  4MSX A;  1ZBD B;  1WEU A;  2JMJ A;  3I2D A;  4L58 A;  2XB1 A;  2F6N A;  1T1H A;  2LGG A;  5H1T A;  5SVX A;  2YQM A;  2OWA A;  3L1Z B;  3O37 A;  1WEV A;  2RSD A;  2CRW A;  2ECW A;  2YUR A;  2EGP A;  4R2Y A;  3FJU B;  3O47 A;  2FUI A;  3N9P A;  1U6G B;  1X4I A;  2XP0 A;  1FP0 A;  3O35 A;  3IHP A;  4UI9 B;  4A4B A;  3T9K A;  2XOC A;  2EXU A;  3FAO A;  3HTK C;  4P5O B;  2ZET C;  3V43 A;  5KH7 A;  4CCG X;  4WZ2 A;  2LGV A;  4WZ0 A;  4FK5 A;  2I50 A;  2K4D A;  4YAT A;  1MM2 A;  5G05 B;  4XI1 A;  4N3W A;  3ZVY A;  2FSA A;  2JMI A;  3ZPV 1;  1MM3 A;  1JOC A;  2M85 A;  2YSJ A;  2XEU A;  4WA6 A;  3KV6 A;  2EGM A;  2M13 A;  2OXQ C;  3C5K A;  5H1V A;  5J3X A;  5B8D A;  5B76 A;  1JM7 A;  5B79 A;  5K3Q A;  4R7E A;  2FFW A;  2YRE A;  3RTR B;  5LCW B;  5KH3 A;  2JUN A;  4MVT A;  3RPG C;  5KH9 A;  3O34 A;  1WE9 A;  4PTB A;  2RR4 A;  2CSY A;  3O70 A;  3GL6 A;  3FL2 A;  4QF3 A;  2F6J A;  2CSV A;  2H0D B;  2YU4 A;  3E2D A;  3LVR E;  4S3O B;  1IYM A;  1XWH A;  2YSM A;  2VPE A;  4A4C A;  2P57 A;  5SVY A;  5FER A;  5D1L B;  2MKE A;  4C9Z A;  5FB1 A;  5B78 A;  5EYA F;  2Y1N A;  2B0O E;  5FEY A;  4Z0O A;  2NAA A;  3U5M A;  5LKU A;  4GNF A;  2YT5 A;  3MHH A;  2KU3 A;  4YAB A;  3FEH A;  4FJC A;  4A49 A;  4F1P A;  2KGI A;  3N9O A;  3SUB A;  2KFT A;  3L11 A;  2VNF A;  5SVI B;  2EA6 A;  3KNV A;  1WEW A;  3LQJ A;  2JMD A;  3LQH A;  3M63 A;  5DIN A;  4GNG A;  4N4F A;  2UZG A;  4YAD A;  3N9N A;  1WEO A;  4OGC A;  3Q1D A;  4QQ4 A;  2C2L A;  4QF2 A;  3FAN A;  2ECG A;  2KYU A;  4Z0R A;  5H9M A;  2MA5 A;  4W4U A;  2L7P A;  1WEN A;  1WEQ A;  5B77 A;  5I3L A;  2HYE D;  2DSM A;  2FD4 A;  2MD8 C;  3NG2 A;  4IC3 A;  5TBN A;  5TRB A;  4AYC A;  3O7A A;  1JM7 B;  4A0C D;  2BAY A;  2Y43 A;  3SOW A;  1VD4 A;  5D1M B;  3ASL A;  4V3K C;  4YAX A;  2M1R A;  2DX8 A;  4O62 A;  2LGK A;  3HCT A;  2KGG A;  2LRI C;  2D8S A;  3DPL R;  4YBM A;  2L80 A;  2MD7 B;  1LDJ B;  2YHN A;  5TDR A;  4LK9 A;  5AIT A;  3ZPV E; 
#chains in the Genus database with same CATH homology
 2JM3 A;  2XOZ A;  3FJU B;  3FM8 C;  3O47 A;  3M7K A;  3E2D A;  3LVR E;  2D8U A;  5K3Q A;  2P57 A;  2XP0 A;  3JUE A;  3PLW A;  2CON A;  2FFW A;  4OGE A;  2YRE A;  3FEH A;  2YVR A;  5SVY A;  4Z0R A;  3LDY A;  4F1P A;  3MDB C;  2MKE A;  3SUB A;  2E61 A;  4H9D A;  5SVI B;  2JUN A;  3LJU X;  5SVX A;  4O62 A;  5SVI A;  2L7P A;  3LVQ E;  3T9K A;  2LAU A;  2OWA A;  2CRR A;  2EXU A;  2B0O E;  2RR4 A;  2XOC A;  3DDT A;  3H7H A;  3DWD A;  2XOY A;  2IQJ A;  2FD4 A;  4Z0O A;  1DCQ A;  2CRW A;  2KKX A;  2KKY A;  4OGC A;  3Q1D A;  3KDE C;  2CSV A;  4QQ4 A;  2EGM A;  2DJA A;  2M13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...