3PURA

Cekdm7a from c.elegans, complex with d-2-hg
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
515
structure length
483
Chain Sequence
PKESDRCGGCGKFTLMSKKKSHHHKKNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKCVPHTGHSIRYKVVAPHRYRWYSPNEKHLGIEVGSKTWIEDFITRENTVPSPTDDEVCIVEDGYEFRREFEKLGGADNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETSPDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEANQEGSDMREQEKNIWTASQIMKAEMERWMDRELRLGPEKNAILPTDDKNKIMISVRKQIEIQTKIQNAKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 7 homolog
publication title Oncometabolite 2-hydroxyglutarate is a competitive inhibitor of alpha-ketoglutarate-dependent dioxygenases
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 148
structure length 483
sequence length 515
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3purA03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3purA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3purA01
4A4BA 4Y4RA 2YU1A 2VPEA 3MHSA 1WEOA 4V3KC 5FZ9A 2CKLA 5FZHA 4LJNA 5IVVA 1WESA 5A1LA 2HYED 5FERA 4GNGA 3ZPVE 5FUNA 2QICA 2YUCA 4GAZA 5LW9A 4YADA 1VYXA 2EA6A 2OQ6A 2RI7A 3KV6A 2M3HA 1FBVA 2C2LA 5F3IA 3N9PA 2WWUA 3RVHA 2ECTA 2CT2A 4QX8A 3EB5A 1JM7A 5FY9A 2P5BA 5FYUA 5CEHA 2JMJA 2XMLA 4UI9B 2OT7A 3KV9A 2JMDA 2CKLB 1MM2A 1T1HA 3OPWA 3RTRB 5A7WB 2MD7B 1E4UA 4WA6A 4EZHA 1Z60A 2NAAA 3AVRA 3ZPV1 4WZ0A 3O33A 2ECWA 2JRJA 1VRBA 4HONA 3PHDA 4AAPA 3U5MA 4MSXA 2XXZA 5A7SA 1JM7B 3O36A 2KGIA 2YYRA 3U4SA 3GL6A 5FP8A 3PUQA 2W2IA 2G45A 5FYTA 2OX0A 1K2FA 5IVEA 2ECIA 2F6JA 4BU2A 5TRBA 3ZVYA 2LGVA 4IC3A 4AI9A 5F3CA 4QF2A 5B78A 1DVPA 4BBQA 4BISA 2VD7A 4I7BA 3K3NA 3ZPOA 4CUGA 2OQ7A 2D8SA 3LQIA 5IVFA 5FXZA 5FXXA 1BORA 3OPTA 3PU3A 5FWJA 1WIMA 5B75A 3IHPA 3QZVA 5FV3A 5A7QA 5F32A 3V43A 5ISLA 2ECNA 4QXBA 2Q8EA 5AIUA 2K17A 2K16A 4X3GA 2GP5A 1WEQA 5TDRA 2E6SA 5LY2A 3L1XA 3LQHA 4A49A 5C11A 5LKXA 2OS2A 2YREA 5LWBA 3PU8A 3KQIA 1V87A 4I7DA 4QXHA 2CSYA 1WEMA 4AYCA 4DO0A 2VJEA 3K3OA 2VJFA 4N3WA 5FB1A 3O37A 1G25A 2L5UA 5A7OA 4YATA 3KV4A 4CCNA 2DX8A 2ECVA 5LKZA 3KV5A 2F42A 3ZVZB 4QXCA 2RSDA 3O7AA 2MIQA 3M63A 2VPDA 2YPDA 4CA1A 4C8DA 5ANQA 4GJYA 1WEVA 3LRQA 2ECJA 3UYJA 1LDJB 1X4JA 2VNFA 2E6RA 5FB0A 5H9MA 4XDPA 1F62A 3N9QA 4AYCB 3HCUA 2YHOA 2VJFB 4LITA 5F39A 5AITA 3C6WA 2KFTA 4LIUA 2KIZA 2BAYA 2F6NA 4NN2A 3DPLR 5LKTA 1VD4A 2MNYA 3DXUA 5FY1A 1FP0A 5FY5A 3KVBA 2LXHC 3C5KA 3T7LA 3FL2A 3DXTA 3N9OA 1HYJA 2ZETC 3K2OA 2VP7A 3SOUA 3PURA 3ZLIA 1RMDA 5K4LA 3T6RA 5FP7A 4WZ3B 5FYBA 2LGLA 2C2VS 5FYVA 2L0BA 4FO9A 5TDWA 2KYUA 1X4UA 5FZFA 4QX7A 5KH7A 4R7EA 2PUYA 5IW0A 3HCSA 4W4UA 4Y3OA 5FZBA 3HCTA 4CCLA 2KWJA 5A7NA 3PUSA 5F2SA 4IC2A 4PPEA 3M62A 5FXVA 5A3WA 4D6RA 4HOOA 2Y1MA 2Y1NA 2KWKA 2Q8CA 3SOXA 2I50A 4D6SA 4GJZA 2LN0A 4UP0A 4XI1A 2WWJA 4YABA 5FZ0A 5F2WA 4TKPB 2ECGA 5B79A 3O34A 4MVTA 3LDBA 2YSMA 5FY7A 5FZEA 3VK6A 2VPGA 3PUAA 2YU2A 5FJHA 3N9NA 2MT5A 5FYCA 3AL5A 2KREA 3RPGB 4BXFA 4AUQB 5D1KB 2YBSA 4UF0A 2YBPA 4EYUA 1WEWA 3U5OA 2L75A 2QJ0A 5FZOA 5I3LA 3ASLA 4CCOA 4S3OB 4FIPA 3NG2A 1LDKC 4ASKA 2G6QA 4QWNA 5FP9A 1WE9A 2XUEA 2KU3A 4B86C 2FUIA 4CCGX 3LQJA 1HYIA 3N9LA 3GV4A 4CSWA 1ZBDB 2KE1A 4CCKA 5FY8A 4CCJA 4CCMA 5FPVA 4A4CA 4A0CD 2PNXA 4IGQA 5FZ1A 2LDRA 3ZTGA 5B8DA 5FZIA 4UF0B 5F37A 2EODA 5FP3A 2YQLA 5FUPA 3AL6A 3PTRB 2AN6A 5FZOB 2MNZA 2VJEB 2M6MA 4P5OB 5FZ4A 4N4FA 5D1MB 3HTKC 5FZMA 3N9MA 5IWFA 2KWOA 2OXQC 4AP4A 3U5PA 4C9ZA 5FXWA 2Q8DA 5FBJA 4R8PK 2YQMA 5FZ3A 4F52B 2FUUA 3KVAA 4EZ4A 5F5AA 3LD8A 2YSJA 2KWNA 4V2VA 5IVJA 3O70A 4YAXA 5C13A 2L43A 1Z6UA 5FYSA 5J3XA 2UZGA 4B7YC 2YURA 5F3EA 1JOCA 4IGPA 5A7WA 4ZQLA 5FPBA 1CHCA 3U78A 4YBSA 5FPAA 2MA6A 5IVYA 2YU4A 4YBMA 2YW8A 4O64A 5DINA 1MM3A 4LIVA 2LGGA 5JG6A 2CSZA 5A3PA 5G05B 2HDPA 1WEEA 2EGPA 4GNFA 1U6GB 5FYMA 5FZAA 3RPGC 5FZGA 3L11A 5KH3A 2YBKA 1WEUA 5DKAA 2YHNA 4YC9A 5FZ7A 4IGOA 5FZKA 4S3OC 4LKAA 2QIZA 2FSAA 3DQVR 4WZ2A 5D1LB 4E4HA 4LK9A 2K4DA 4V3LC 4ZUXU 5B76A 1Z2QA 5FY4A 3ZYQA 2XDVA 5FYIA 4XDOA 4R2YA 4LXLA 4GNEA 5H1TA 4AVXA 5FZ6A 2LV9A 2GP3A 1WFKA 5IVBA 2KGGA 3KNVA 2K1JA 1VFYA 2Y43A 4UP5A 5FEYA 5TABA 1WGMA 5A7PA 2LRIC 4Y33A 5FPLA 5FYZA 5LCWB 2MD8C 5FZDA 5FYYA 2MA5A 5FJKA 5FY0A 4GNDA 1IYMA 5FPUA 5B77A 5KR7A 3EB6A 2XB1A 4TN7A 3L1ZB 1X4IA 2YT5A 4V2WA 5FZ8A 5EYAF 2PXJA 5FWEA 5G0FA 4FJCA 2L80A 3AVSA 2LQ6A 5A80A 5F5IA 2IDAA 5KH9A 5TBNA 2KR4A 3MHHA 3I2DA 3U5NA 5FP4A 1WENA 4QF3A 4ZDTA 4L58A 5E6HA 2H0DA 4BHWA 4I7CA 1XWHA 3NJYA 2JMIA 2VPBA 5G04B 3SOWA 4QU1A 5LKUA 5F5CA 5A3NA 3O35A 3PDQA 1WEPA 1WILA 4GB0A 4NUBA 2M85A 2XEUA 5A1FA 2M1RA 4YBTA 4PTBA 2LXPC 4DIQA 4FK5A 3ZNIA 3M99A 2LGKA 1N87A 4LADB 5H1VA 5H1UA 5FYHA 4D6QA 4LLBA 4GD4A 4L7XA 3SHBA 5IVCA 5LY1A 5A3TA 2H0DB 2MUMA 5F3GA 4URAA 2G43A 5FZLA 4Q6FA 5FZCA
chains in the Genus database with same CATH superfamily
2CSVA 2CYFA 2OW4A 3PJYA 5JDLA 5FLHA 2ZGUA 3RJRA 4NIAA 4AEDB 5FUNA 1UKGA 3ZSKA 4QPGB 1OPOA 2V4VA 2X5IB 5ACA1 2ZACA 2WWUA 4FPHA 5FUIA 4DUYT 3M8LA 3EB5A 4M00A 5FPXA 1O3QA 1BEV1 3B7MA 1W6MB 5A7WB 2NP9A 3BIWE 3KGZA 2BGPA 2WDBA 2ZPXA 1J84A 1FOD2 1GANA 2J1RA 5TAOA 3T9KA 4AHYA 4YYOA 3O36A 2KGIA 2A6WA 1R1A2 2W2IA 1Y01A 3JD71 3SCGA 3SLIA 2ZMNA 1CX4A 3AA1B 2R6GF 5JPMB 4CN4A 4N7UA 3RYHE 4BISA 1V70A 2JE7A 5GZGA 1M4WA 4LK6A 2D2SA 3T0BA 4PLOA 5KMGP 2Q8EA 2E5VA 1KFYA 3LKJA 4IDPA 4LHKA 5LY2A 2WP9A 3DEMA 2WMNA 3IT8A 3B00A 2E26A 5AQHB 5LGTB 3ONJA 3BPSA 2BU9A 1E1HB 4TZ4C 2PG8A 5CZKA 2HWB1 3TLSA 3GZUC 3SRZA 2WWSA 2QUOA 1LGBA 2XLAA 4FXGB 3KV5A 2DTWA 2WMOA 4Q4Y3 1O5UA 3SOLA 2UWAA 3T1MA 3M63A 2FCTA 1R091 2XQXA 3D0TA 3EMRA 5LCYA 3LRQA 4YJ3E 3SNMA 4MGIE 4AI6A 2MNGA 2DHRA 4EIWA 1C5IA 2QZ3A 1YFWA 3ZMVB 3AYEA 2F6NA 2DWGA 2D6KA 2VL4A 3ZN4A 5EJ1B 5LRRA 1N47A 3WNOA 1OI6A 4HWCA 1VMFA 1AR81 3MF6A 3ZLIA 3RDIA 1Z0HA 1YQ4A 3C8XA 1CAVA 1FEWA 5K7PA 4QPYA 3I2FA 5FZFA 1W6PA 1XPWA 3VD4A 1X79A 3FZLB 4HVQA 1Q8OA 4TSVA 3KM5A 5JLVA 2E7AA 1Y9QA 2JJ9A 5LCWL 1VRH2 3IDCB 4ZPIA 2GSYA 3JBG1 1VOMA 3CIRA 2WB5A 3B3QE 2VPVA 2GK9A 1L3JA 3F2EA 2VZSA 2VH9A 3SOXA 5CB7A 3MIFA 3LA3A 1RUE2 3UGGA 1H30A 4H9DA 1WR6A 3H3MA 1JH5A 5FZEA 2RM22 5D1KB 3IBMA 1BXHA 2H0VA 2L75A 1E5IA 4NIHA 4DUWA 5FZOA 4CDUC 1CONA 5AVPA 5A3LA 3MBWA 2XGXA 3I2KA 2ZMLA 4QXBB 3UKVA 4FOWA 2A1XA 2VVEA 4AQFA 5AFBA 1WGPA 2QVAA 4M01A 1NLRA 4YSXA 3B94A 1UYYA 2YOEA 4RS5A 1NXD1 3A4UA 5HEGA 4XZPA 1POV3 3LD8A 2A9UA 2DYCA 5I93A 3WW4A 4CDUB 2Y6JA 1KITA 3CX7B 2DU1A 4COFA 4O64A 1X7NA 3M4FA 5HCJA 2UUBT 3N35A 4JVAA 2XQ5A 4AISA 4S3OC 3M65A 4R9BA 2FSAA 1QJU3 4YLHA 4E4DX 2LS6A 4KWUA 5HAXA 1DQ0A 1SE7A 2XDVA 1RUC2 2BVBA 3FBMA 1QIQA 1DQ5A 3I3MA 4EWAA 4LBLA 1NCQA 4ZONA 4Z1VA 3KINB 4BAYB 4XJ8A 1ODNA 3ON7A 4E2QA 2A73B 1HXS3 1OF3A 4AGRA 5L9VA 2FBWA 4Z07A 4BE3A 5HXRA 1H4GA 4FJCA 2HWC1 3AP9A 5ABGA 2W1QA 1B35C 2B5HA 1PO21 2Y6FA 1J5ET 1CAUA 1RUI2 4IEYA 4CXXA 5EFUA 2CHNA 4AGGA 3K3QC 3RKOA 2CRRA 3CNAA 3PL0A 4QH5A 4I7CA 3VZLA 3R05A 1YQ2A 2WDQA 4V1PA 3M70A 2WNUB 2LKHA 2UU8A 4NRMA 2B8MA 5GKAC 1RUH1 4NRPA 3AE6A 1KJRA 2OPWA 3M3IA 5L19A 5F5WA 4PTBA 2L8KA 1REFA 3WHTA 1FMD2 4QPIA 1VBE1 4OMCA 2G43A 1XYPA 5AQIB 3MLLA 3SH4A 4L92A 1C28A 1WEOA 2XJ7A 3RI8A 1OHFA 1XE0A 5L4EA 3H7HA 4GNGA 1XNCA 4COYA 3HEIA 5ABJA 1V6OA 4BA6A 5GZDA 3N9PA 3HNBM 2N9DA 1MS0A 4N53B 5T5OA 2ZABA 3LWCA 1F31A 1WFDA 5CB4E 4BPZA 3PUHA 3JAFA 4L8QA 1CAWB 2VECA 4ES8A 4G63A 5AFEA 1ENRA 2FJDA 2VAUA 1AJOA 2A70A 3ZFEC 3WHUA 1Q3EA 3ASIA 2JRJA 4U7YA 4HONA 3BOPA 5FMOL 3KLSA 3ES1A 2WLPA 4BQ3A 3WI3A 2WL1A 1JI6A 5CG9A 1UX7A 3DECA 4Q26A 4IL9A 1FI2A 1SLAA 3AK0A 4IDZA 2CDPA 1EV12 2D8SA 3IM0A 4CDQA 2A6ZA 5FXZA 4K9SA 4Q4V2 1IBMT 3AZXA 5FMNA 4HFSA 3H9AA 5KHGA 1LHUA 1TNFA 3MV11 1YC61 1SLIA 3GM8A 3ZFEB 3KQIA 1V87A 3G06A 4CCDA 3ACLA 3FZHB 2RR13 3WNMA 4R9DA 5A7OA 2WR9A 2QQLA 4DV4T 1AR62 2RA1A 3FWEA 5IWAT 3P5BA 2MIQA 2BFUS 1Q8VA 3LSDA 4OHZA 3LF7A 3OGRA 1PGSA 4XJWA 1WEVA 1UW8A 1GWMA 2JQ9A 1JTZX 3H3UA 5HCAA 5AQNB 2RVAA 4LITA 4JGZB 2DUOA 3JUEA 2BAYA 5IUXA 2QQPA 5LKTA 1GR3A 4QXCB 4XJUA 3KVBA 3ZPYA 1XU2A 3T3YA 4GYSA 2JIGA 4TNWA 2JQQA 3LA7A 2ID4A 4O2AE 4NUUA 2FDGA 2W94A 3LGRA 3RJ2X 5KC5A 4N43A 4AYUA 2K48A 1AX2A 3M3CA 1GNHA 5A6ZA 4I55E 4O9GA 2XQYA 2ZM2A 4Y4YA 5H6QB 3RC3A 2WZHA 4LF5T 4OUSA 3UGHA 2FZ2A 2P34A 2H88A 1XNKA 2G4IA 2E53A 1D4M3 4M3CE 3RI5A 2XBO1 4PPEA 2D8UA 3UUMA 4MGZE 4I0UA 2WFF1 2Y1MA 1NY72 1G9DA 1O91A 1OLQA 3PNAA 4XI1A 4KHPT 4U74A 2ZHKA 5CKQA 3IHRA 1HFAA 1RC6A 5GLVA 2OKXA 3OEAA 4RR3C 4P00B 3N9NA 2YBSA 4QGMA 4B86C 4CP9B 4OYKA 5CGMA 4O8SA 2KE1A 5EV7A 5A32B 2BKOA 4WBNE 4PJYA 3Q5DA 2AC1A 4Y26A 1XNAA 2WNEA 3FBYA 2J1AA 5FOJB 3ZVXA 1C8NA 1AR73 2NTXA 2JG8A 5D21A 2OXQC 4F52B 2RMU3 4NXNT 5FMDA 3I49A 5SVIB 1PHMA 5C13A 5GJ6A 1UY2A 2JDPA 1RUOA 1W6QA 4MGKE 3NAPA 2JB8A 3ZN5A 2ZGPA 5IVYA 2MA6A 3VKGA 2YW8A 2XJUA 1ZV4X 5L7OB 1H8TA 2Q8OA 2YHNA 4YC9A 3OBZA 2BJSA 4O4HE 2PHDA 5FVLA 3ACHA 4E4HA 4LK9A 1HX1B 4OHYA 4XBLA 4UAPA 1A8DA 1K5MB 2Y60A 4HK8A 5J1XA 3D0JA 5LMUT 4DBQA 2I07B 4OZOA 4KMQA 2EIEA 2G0UA 4CXYA 4D7SA 4AQTA 5A6QA 4JI5T 2CHOA 3BCWA 4QHOA 5JREA 4XF1A 2VZRA 2IXHA 1S0DA 2XJSA 3EB6A 1DLLA 4QDQA 2QE3A 1QOTA 4Z0RA 5F5IA 1RJ8A 1CZVA 2CGNA 4O4LE 4FT8A 4YHHT 3TN92 3NZPA 3OBVE 4OYUA 1ACCA 5L73A 3ZN6A 1VB4A 3RIAA 1O8SA 1J1JA 2D5HA 3POSA 2Y26A 3RLFF 1MS9A 2FBEA 1GP4A 2M85A 4AK3A 1NQJA 1OKOA 4ZZ5A 2YVRA 5EK3A 4D6QA 3CBNA 1WCUA 1SFPA 4NN0A 2V5DA 4DR1T 5FTTC 2PELA 4Y4RA 4A7YA 2WWVA 4EEDA 2WO1A 4I0BA 3NNLA 3WW1A 3VKOA 1QQP3 3AMHA 5FRAA 4XPVA 2R0FA 2PHUA 1LENA 2B45X 3AZZA 4FPKA 2ECTA 4O7XA 4BMEA 5CEHA 1PGL1 2Y33A 4QB6A 4O9EA 3TOJA 2CKLB 4LULA 2MD7B 3P8CD 3I0OA 2XQ4A 3AFGA 3ZPV1 5KXEA 5HV4A 3M1HA 2R072 3B9IA 2W47A 1OWAA 1NKGA 4AAPA 1DLCA 2XXZA 4QX8B 2GALA 3VGIA 1ZRCA 2ILMA 1W05A 4BU2A 5TRBA 5EYYA 1F8VA 4QPWA 4PIXA 1C5HA 2VZVA 1KJLA 1DVPA 2VTXA 3LEIA 3HT1A 3ZPOA 4DIDB 1GQGA 4QQHA 3H3LA 3TKLB 1WCRA 1U5ZA 3JXSA 4AQ2A 1CHUA 3FJUB 4YVWA 3BTAA 4UVBB 4CP2A 2K16A 2CXFA 1GZTA 1V9U1 2PQQA 2VUCA 4ANJA 2KWHA 3VZOA 1MS5A 1O5LA 1WYBA 2WZR3 3AYAA 2C9KA 4WM7B 4JI0T 1DU3D 4AWDA 1ULDA 2JDHA 3ZVZB 4EJRA 3Q8CA 4PJMA 4RN5A 4PBPA 4PK5A 4OUMA 1WD4A 2WNVA 2FDIA 2HYKA 2Y6HA 1MR5A 2X0YA 4ZZCA 2EXIA 4XDPA 3WDTA 1BR4A 3N9QA 2YHOA 3VBOC 4CYDA 1WUVA 1YLLA 2KFTA 2ZEZA 3I59A 1YWKA 2UXBT 5DDJ3 2CBJA 3KSCA 3RZKA 3A22A 3AE4A 1JW6A 5F1RA 1XBFA 4ZXEA 3S5QA 3VBUA 4XUNA 2DWKA 2CAUA 1VAMA 3VDCA 3VHRA 2VP7A 4D7YA 3GDBA 3I9YA 1ZX5A 1COV1 3MW3A 4COUA 1EP0A 3ACFA 4FO9A 3R4DB 3AE9A 3IBPA 1BBT3 1H8VA 4DY3A 1XE8A 5CADA 1POV1 3NVOA 2TUNA 3HI2A 2FJEA 3VBOB 2Y6LA 4A3XA 2NW8A 1I5ZA 3U4XA 4EWDA 5LGUB 1G9CA 5DZFA 3AMMA 3ZOIA 3A5XA 4JZRA 2R7EB 1I3HA 4XJAA 2ZAAA 2ZGLA 5KHHA 2RJLA 2B1EA 3NWKA 3R4SA 4QX1A 3J7LA 3I8TA 5FYCA 1DYPA 3AJYA 1QU0A 1YHFA 3VBHC 4S2FA 4PDWC 5I3LA 4IV3C 5CKMA 3NSTA 3KT1A 4YZ4A 3O1SA 4QWNA 1UPSA 3MO4A 4CUCA 4C91A 1N1VA 2B76A 2WZPP 4CP1A 1DBNA 3AAEB 1UCUA 3WR0A 3VN4A 4A4CA 4RGGA 4GK5E 2IXJA 4COWA 3N2KE 2E33A 1X8EA 2RDRA 4KGGA 3WF1A 3GN5A 4KI0F 4ZS3A 4HFHA 2A71A 1LR5A 4U31A 1XNRT 2IC6A 4PF5A 4Q8LA 2O14A 3KVAA 1W9WA 1VBA2 4UOJA 4PQQA 2Z6EA 1VR3A 3WF3A 4R9CA 3VBHB 2AZ5A 4PDWB 4UFKA 4IV3B 4ZQLA 3ZMOA 3USSA 1TZOA 3SITA 4AHWA 3MICA 3EABA 1S0EA 5JG6A 4Q27A 1JYIA 5C71A 2V1DB 1YFXA 2VTXJ 1VBB3 3WNXA 4XAAA 3OYZA 2ZEXA 4TZDA 4DRVA 2B0OE 3C64A 2JDMA 3K1SA 2IXLA 2D3PA 1SDDB 3QACA 4V3LC 4ZUXU 1J58A 3RYCE 3ETPA 4W6XA 3UJOA 4GNEA 3HKCE 1H6XA 2GP3A 2KGGA 4FFFA 2YN6A 3O1PA 2V09A 2WT1A 2V6YA 4LKSA 3I1AA 3S57A 4XMAA 2Q1ZB 2J47A 1KNRA 2VZUA 4XCAA 4P9WA 4IEOA 4OQ8A 3CZJA 4AF9A 5A80A 4BZ4A 4ZKTB 1S0GA 2IDAA 1UQXA 5KH9A 1TMF1 2KR4A 2WRAA 1SCRA 3CPZA 4Y1UA 4LNVA 3V5SA 3ZXKA 1ZP0A 4CEYB 5BMVE 2D44A 1JUHA 5L9BA 4QB1A 3ILFA 2PA7A 2D0TA 3KD4A 1ZBE2 3IMNA 4PFPA 4KHZF 1QF3A 2UYAA 4X6RB 2R16A 3A8YC 3ZNIA 3T2TA 3VBFC 2Q30A 1LU2A 1SHWB 2VQUA 1M62A 2MUMA 4M3CA 5A33A 3IZOA 1N1TA 5JI9A 3ZMNA 5CBLA 4GH4C 3WDVA 5FZHA 4LJNA 5A1LA 2HYED 4CN1A 1RUD2 3QK6A 4HFEA 2JQKA 4YFWA 2RS11 4IUGA 4Y22A 1WWYA 1AYM1 4Q4X2 4O4JE 4IEWA 3OSDA 2JMJA 2HH7A 1HIXA 3ATGA 1C8M2 1XDOA 2OT7A 2V26A 5LBQB 2BKNA 1MZEA 3NV1A 2H3RA 1Z60A 2WFPA 4B3TT 1SACA 1N34T 3FBLA 5CYYA 2X09A 4JI3T 4X20E 4DEVA 3VDDC 2J1VA 5TSWA 2YYRA 3MXZA 5FP8A 3T1HT 2RJKA 2BS2A 2YZ4A 3CLPA 1PMJX 3ZN0B 4B8EA 4I7BA 2XOCA 4NOTA 5T52A 2XOMA 1UZWA 2DCJA 4PQ9A 4Q4W2 5I8SA 1UD1A 1QLBA 3KBTA 3IHPA 2Q5TA 1LULA 5FV3A 4LJHA 5F32A 5ISLA 4SLIA 4AVAA 5GLTA 5AIUA 4GWMA 2C24A 5K3QA 5TDRA 2WS91 1PK6C 1XC6A 5BNPA 4CU7A 4Q29A 1J5WA 4FQZA 1KF6A 2ETEA 2XQ8A 3ZMTB 5D1IA 3VDDB 4U7IA 1ASJ1 2HWE1 1YNAA 3KV4A 2ZEWA 1Q8QA 2F42A 2UY9A 3APBA 1G9BA 1UY3A 1VBC3 3H0OA 3H8UA 4YG6A 3ZSMA 3MDPA 4J6GA 3UYJA 5EHDA 1S2EA 3LCPA 4O2BE 3MK7C 1UXXX 5T54A 2IXCA 4CEWA 2IVJA 5C5TA 1N33T 4GOUA 3FM8C 2P9BA 1NAFA 4B3MT 4CPBA 1PK6B 4O4IE 2E61A 3NJXA 1O4ZA 5JDBA 2NW9A 1W6NB 1UYPA 4D0QA 5DAWA 5K4LA 2QTWB 1FXZA 5FYVA 2NN8A 2XQRA 2CLYB 3RFRA 2R042 4DUXA 2L9LA 4EQVA 2QQVA 1S35A 4XAXB 2RMU1 5IW0A 2ZHLA 4L97A 4KL1A 3ABZA 4BB3A 2KWJA 3RQWA 4KBZA 2RP4A 4HEAA 5C4WA 2W68A 2DCYA 3ZM8A 4KX6A 4JX0A 2P2KA 4HOOA 2Y1NA 1D0YA 4YT0A 3RRWA 2DVBA 2WUHA 1H7CA 2VMIA 4LO7A 2ECGA 2W46A 4QQ4A 2CA5A 1VE0A 2C26A 3VHOA 4GA9A 4ZU4A 2IDOB 4LA2A 1LEDA 1VCSA 5DJQC 3ZFGB 3O1IA 1CZSA 1ZBA2 2BNNA 3UK9A 2W0XA 2W00A 5T55A 4Z91A 3HPNA 4MX3A 1OT5A 3ELNA 1LTEA 4DMIA 1IG0A 4Q5OA 1PMHX 1TME3 5JTGA 4TLGA 2ZGNA 2YQLA 2FDKA 1OQEA 5T5JA 3H37A 1LU1A 4DV3T 3N9MA 1AYN3 3B57A 4C0BA 2OPKA 1JZ7A 5C7GA 3Q9OA 4EZ4A 5FBZA 2DCZA 4H7LA 1I1EA 1V00A 2ERFA 3L2HA 2JG9B 4LE3A 2YU4A 1MBMA 3TEWA 5EQUA 3RSJA 2HDPA 1LVKA 3NNMA 4XFGA 2BDEA 2CDOA 1DGWX 1WEUA 4LBNA 1W8WA 1VB2A 5FZKA 4Q8KA 2KSRA 1ZZ9A 4TYSA 1SHZC 2WY2A 2YUEA 2DVFA 2HWF1 3O12A 4UFMA 2E51A 5BR8T 1JODA 4XDOA 3DWDA 4HPKB 4ZI2D 5HPOA 3KQRA 3TEZA 5T3NA 3WP6A 5TABA 1FOD3 3FZ3A 3PV0F 4QX7B 3B93A 1DZTA 4X5TA 4BXSV 1ZA4A 3UU3A 4Q2FA 3U11A 4L0RA 1A34A 1Z78A 1R1A3 2O8OA 5EYAF 2IXIA 1NE4A 2KINB 2BRTA 5KXDA 5HXMA 1TE1B 2BBHA 1FYUA 5ACA2 3URFA 1X8MA 3UUXB 4FTEA 1UYXA 3C4XA 4OHWA 2EGMA 3GBGA 5AQRB 2GH2A 5E6HA 3W20A 2XP0A 4OGCA 1BEV2 5DAXA 3PE0A 3AA6B 1RUF3 2X10A 4AFCA 1OD5A 3ZMUB 3GCXA 5C9AB 4IV1C 4W8JA 1WZXA 2GN7A 1HV0A 4HL0A 3OUJA 2BVVA 4X66T 2VURA 4N8MA 1N87A 1W8HA 2R1BA 3PVNA 3JD72 4H63H 4Z2WA 4E8CA 2XQ9A 2PHXA 2VK9A 4JQTA 4L5GA 4OYJA 4X8PA 1CPNA 4P0AA 1K42A 1WESA 1UOFA 4XE9A 2JMKA 2JD9A 4IE0A 3ZPVE 4XJ9A 2OQ6A 3HQRA 2G1MA 1UPIA 4IV1B 3HMYA 5FYUA 1WW5A 4Z92B 1OVSA 2HWB2 1X82A 1PO13 3L9JT 1E4UA 4F6RC 4QKDA 3AP6A 4H2AA 4XF4A 3GF6A 2PHRA 1LOBA 1R092 3V0BA 4DV0T 2E9QA 4MSXA 3E5XA 4EWEA 2OLTA 5J1GA 2AE9A 4YW3A 2OX0A 3SISA 4IC3A 5B78A 5SVXA 4BBQA 1W2UA 2E31A 2J7MA 5JIAA 5DUWA 2XPJA 1MS1A 4LKEA 4IGUA 5IVFA 3FLRA 2YB7A 1AR82 5CJ5A 4DNDA 3CKDA 2YREA 1LRHA 2ENRA 1W0PA 2Q9QD 1S0IA 1UMIA 3K3OA 1JOJA 1HKDA 2XWJB 4N3WA 2RM23 2L5UA 4QM9A 2ECVA 2V73A 2YDRA 3TEYA 1AXKA 1UN1A 3SEEA 3VU7H 4JUYA 1O4TA 3JBG2 4EAHA 2XJQA 3VBRA 3H8OA 4QB2A 3BI3A 3DPRA 3C6WA 4MHUA 3HNMA 4NN2A 4NPLA 3FFQA 4OLLA 5FY5A 3PDYA 5EJZB 5IFPA 3DDTA 2JIWA 1UY0A 1XMQT 3CKHA 3HQXA 3WEZA 5IHRA 5E89A 1AF9A 5SV8A 4ZU7A 2W2UA 1QJZA 1I6ZA 3Q5XA 4JEHB 3ZR6A 3NRUA 4M0HA 5LBCA 1HB3A 3E97A 3T1YT 2TEPA 1FNYA 1ULCA 3M2MA 2HWD1 2I0MA 1IKQA 1I9RA 2CGOA 3MA9A 3OUIA 1YIFA 4ILUA 4AI2A 2QQWA 1G9AA 1HJFA 3OPCA 5H6RB 1QEXA 3WINE 4IE4A 3MZHA 1HV1A 2XHEB 2DWRA 3A23A 4A45A 5KBFA 4AVVA 1M7KA 2CV6A 5LASA 2V4AA 3BIEA 2MEV3 1F35A 4UV9B 4A2UA 3FZMB 2CXDA 1W0NA 3KCXA 3AJZA 3NJVA 4KUMB 2EHOA 3C2UA 4CDWB 1RUI3 4IEPA 3N9LA 3OD0A 4ZOLE 4CSWA 5KHIA 4YM1A 2EF6A 2RE9A 3ZTGA 5FZIA 1J83A 3AFKA 3PTRB 4MLKA 2IC1A 2LTNA 2AN6A 3I9WA 2SLIA 4CTEA 2DTYA 2V6XA 2N1GA 4P5HA 4QHBA 1YCIA 1W2AX 1FMD3 4OFGA 1O3XA 3EI0A 3KFWX 2VCAA 5F6LB 1O3TA 2ES3A 1XRUA 2C6SA 2HWC2 1UX5A 3ILNA 2VOTA 1PO22 3MW2A 5I0RA 3MIEA 2Q0AA 1HN1A 5G05B 4DUVA 5FZAA 2Z5WA 4JDNA 5DPNA 2RPAA 1BR0A 4AI3A 1NA1B 2JICA 1ND2B 1V6KA 4IE6A 1RUH2 1CVNA 4QGNA 3USUA 4K0UA 4PK6A 2BG9B 4AFBA 2CWSA 1EAH1 1VBE2 2X9YA 2WBKA 1MIVA 4N9HA 2UXCT 4ARXA 5KR7A 1OOPA 3ANWB 4JGYA 1QY4A 1CGPA 2XWBB 2IAKA 5DMYA 4LT5A 4AQFC 1UF2C 2KXPB 2YPJA 3UU4A 1UNBA 5L3DB 1WENA 1EV13 2IXKA 5FKCA 4Q4V3 5LA2A 4ZI2C 2VWAA 1HF8A 5HWXA 4RS5C 3K51A 2QJVA 3N5LA 4LHNA 4HZFA 2WQZC 3N3HA 4AL9A 3BOWA 4S2GA 1JXNA 3POFA 4OX9T 2BWCA 1XYNA 1OA2A 2HH9A 4HMZA 3C51A 1JU4A 3O1VA 1AR63 3PUIA 5DQ0A 1G6NA 2ZZJA 2TBVA 2UUCT 4BJNA 4RFT0 2YC2A 1AVBA 4Y1VA 3I3QA 3HKBE 5LMNT 3VR8A 2YUCA 3K4AA 4GAZA 5CNAA 5HEOA 4RS5B 3LPGA 1IZ3A 2GC1A 4MUVA 4WZFA 2VNGA 3E5UA 4H9OC 2VQ0A 2BKPA 1MM2A 3OPWA 3RTRB 4YW2A 3UETA 4Z2AA 1UGOA 1XSQA 1CD3G 4WZ0A 5DABA 3PHDA 4QX3A 1MNDA 5C6CA 4ZHNA 4HBNA 3VHPA 2G45A 1W8OA 3GMIA 3SH5A 2I74A 4P09A 3C98B 4COVA 3FX3A 3O1TA 1OFNA 2LT3A 3K3NA 3CX6B 4J1WA 3ZN1B 1AHSA 3LQIA 4P9GA 1BORA 2DFBA 3OPTA 3PU3A 5L2LA 2WJSA 1SLLA 1A8MA 5LRSA 3R0RA 2H89A 1CPMA 4JKLA 2E6SA 2VULA 5LKXA 3HT2A 5E16A 5IFTA 3ZXEA 4DS0A 2V7JA 1AX0A 3JCFA 3ALQA 4NHLA 1U0AA 2JDKA 1T72A 1CAUB 2ZKNA 3ME2A 2CHHA 1UZZA 5DUVA 3O7AA 1UOGA 1H1AA 2HBUA 4E2GA 2YPDA 1IS3A 2M6BA 3E6DA 5ABJC 3O0VA 2XBO2 2J1EA 2FD8A 1OF4A 4PBOA 4AYCB 5EZWA 2WFF2 4TTGA 3K4DA 4IQPA 2A6XA 4OI0A 5AITA 4UBHA 1FT9A 4GYRA 4LIUA 1T8BA 4ET7A 4F1PA 2CWYA 5C33A 4NHMA 2QQIA 4KNCA 2WA4A 3E6BA 1DCQA 4K0KT 3HA4A 4IERA 4DMWA 1HYJA 3VBSA 4KU8A 4QKFA 4DBRA 4UFJA 3BQLA 4GMP1 1N3PA 1W3VA 2YK0A 2K9ZA 5JDFA 4E4SA 3LFMA 1HQLA 3J7HA 4RHV1 2ES0A 5M4YA 2DV9A 3UKTA 4UVAB 2EIGA 4JAAA 2JXAA 2WO7A 2WSUA 5F5QA 2Q9QB 2WNOA 1L0VA 4WV8A 3ACGA 1GICA 3ZYMA 2Y0OA 3ACIA 4IEUA 4GJZA 2JB4A 1XB9A 4P5YA 4FAHA 3RYFE 2QQMA 3T08A 1HB4A 1OLME 5FY7A 4MV2A 4YVSC 4AUQB 2YBPA 3MPPG 5DXDA 1FX5A 3AE8A 4JI7T 3WDWA 4JYAT 4FIPA 1MMDA 4RQPA 5JR9A 1WE9A 1YFYA 2KU3A 2MAWA 2X29A 4QGLA 5JI7A 4ASMB 1CJPA 1VAVA 5E0OA 3TN93 3NBXX 1QHDA 3LJCA 2FCVA 4RGAA 1YYNA 1ZNPA 2Q4SA 1PX3A 2ZGTA 5J3UA 5FP3A 4N7IA 5FUPA 2GNTA 2M6MA 1T6BX 4N4FA 2KWOA 1H4HA 3WSOA 3B9CA 4A7ZA 4YVSB 2W87A 3IB3A 5LNKA 1XU1A 1JOCA 1YI9A 1RUF1 3ABVA 4P9JA 4FP2A 4YBSA 5FPAA 2KD7A 3ZC0A 5AFUL 3POIA 3T1LA 4AVTA 4Z90A 3PIJA 1IPKA 3WDXA 3F2ZA 3IWZA 1JS9A 3UU6A 4B3RT 4H55A 1RHI1 2E7QA 3NO8A 4DNYA 5FY4A 3A7MA 2CGPA 2W08A 1VMJA 1FNZA 2X9WA 3OVUA 1TVGA 4ZZBA 5CG8A 5FEYA 3VUOA 1UCXA 1O3SA 5FYZA 3WF4A 1WCKA 2RS51 3HJRA 3HN3A 5FPUA 1IYMA 4ADZA 4PT6A 1WA4A 1X4IA 2WNUA 4AE2A 1PO11 3CJIC 3ENRA 1ND3B 5E88A 4QX0A 1S2BA 5JMOA 3KDEC 3ZC1A 4CQIA 5FP4A 4DB5A 3DYPA 1J59A 1W8UA 4QF3A 2J4GA 1PGL2 4X64T 2WU2A 1UZ0A 1X9TA 1PZ7A 2BGCA 1ULPA 4B4RA 4YSYA 4YXDA 3BPZA 5EP9A 1OUXA 1OXCA 1PNGA 3WLUA 1WEPA 2JE9A 3I2GA 2WZIA 5HEUA 3RQ0A 2BTVC 1W2TA 2W39A 5H1VA 3NAPC 4GWNA 3Q8BA 3POEA 1HB1A 4ASLA 3ZKRA 2KZ7B 4N53A 3CJIB 1UU4A 4L99A 2ARAA 4PJJA 2VQFT 1Z8UA 1CAWA 3KB5A 3JQXA 4CU9A 4X65T 1VYXA 1Z7S1 2VM9A 1CN1A 4LFBT 3HOBA 3KV6A 1V9U2 2M3HA 2YGLA 3HVDA 4E4ZA 3ZSLA 1W28A 4DR3T 5KHJA 1JYCA 4ISQA 2P5BA 1YXRA 5I8TA 3WOGA 5EXOA 3O4XE 1OEDB 3E2DA 2V7IA 1CIYA 1W6QB 4IDOA 2AREA 3KV9A 3GHMA 2JD4A 2JMDA 2MBGA 1T1HA 2CY6A 2XLGA 3QB5A 4YRDA 4QQOA 3IIIA 4HK9A 3DKWA 3RYIE 3QD6A 1SDWA 5A7SA 2WAUA 4LQRA 2XASB 2WS3A 3K75B 1U5IA 1K2FA 1MEC1 3S7IA 4HXCA 5F3CA 2P6HA 3ZFEA 3CQCB 4S2HA 3LEKA 3W9AA 4G4FA 2W9XA 3T2PA 2AENA 1JHNA 2WO2A 4XFFA 2PBIA 2BDRA 2GP5A 1I6XA 4XIOA 2UXDT 1WRDA 5C11A 1COV2 1UU6A 3PU8A 3GGLA 3LE0A 1XDPA 2XOYA 5JZGA 1S0JA 3NW4A 2VJEA 2W1UA 4JGZA 3C4WA 3IAQA 1G25A 4ILCA 3MF9A 5J7MA 3RPUA 5LKZA 4IREA 4FCAA 4QXCA 3LG7A 4BLJA 2RSDA 1CZTA 3DGTA 1CX1A 4XF3A 2VKOA 4UBGA 3RZMA 2YROA 3ETVA 3OYXA 2MEV1 2FZ1A 1IQDC 5JXIA 5BUVA 3WD5A 2A6VA 1Y3TA 3RYRA 3PHMA 3OPZA 1YJLA 3LDKA 5FY1A 1FP0A 5CFCA 2JDUA 3DXTA 3N9OA 2E9XA 3N2OA 4U2YA 2TNFA 3KMHA 1AR93 3Q1DA 4HWIB 3BUCA 3ZEFB 1XQNA 5L3CB 2VW2A 5FP7A 2LM3A 4CN6A 5FNVE 2JPFA 1X4UA 1RXFA 4EGWA 5BNOB 4IEVA 5JVVA 1DHKB 3G6JB 4W4UA 4JI8T 3P4RA 4CRQA 5DG1A 1REDA 5A7NA 5LGNB 4YVWC 4FFGA 2I45A 1SLBA 5SV5A 1ZRFA 4BYYA 2HHHT 3IDBB 4IC2A 4HFIA 4AZZA 4HANA 3OJAA 2DSMA 2AYHA 2WWJA 2JEMA 5F2WA 3EHKA 4CP9A 1UIKA 1F4HA 5B79A 4HE8A 5A6XA 2FDHA 2VUAA 4E8DA 5A32A 1UX6A 3QH7A 1NXMA 3KZ4C 2WT2A 3AZWA 1KRIA 3RPGB 3O0WA 1NQDA 1GUIA 2WNVC 2QJ0A 1QJY3 2B9VA 3CF6E 3T30A 3T0AA 2J1DG 2WSVA 5IYYA 4TWHA 4YVWB 1LHVA 4EROA 5SVIA 3M7KA 1ZA7A 2CE7A 3ZYGA 1NWMX 2DDUA 4AEKA 4GWIA 5A3MA 1JYXA 4CCCA 4ISRA 3OGSA 1C3HA 1ZBE3 3VBUC 1K5JA 4LHLA 4UV8B 3MFAA 5L7OA 2QBXA 4K7JA 5FBJA 3RYKA 2NWBA 4I3PA 4OFZA 4SBVA 5ERLA 4V2VA 3O70A 1YXWA 4I4TE 5IK5A 2WNVB 2B46X 4JDOA 2GNDA 3N7KA 4IGPA 3AEFA 1K5MA 1CHCA 4WM8B 2K9AA 2HPJA 1TMF2 1F5FA 2Y64A 4QX5A 4CCEA 1RUD3 5FR3A 1W3XA 3HNYM 2XQAA 3V65A 1W9YA 1VCTA 4LFAT 4JEUB 4BQ5A 4B1LA 4Q4X3 5FO7B 4YLZA 1L7QA 4AVXA 4BM8A 4AFDA 1NUKA 2ZA9A 2ET7A 3C7OA 3ZDVA 1BCXA 1JOPA 4DZGA 5JDNA 4IDNA 5FZDA 2VOWA 2PLV1 4EYYR 3WP5A 1W9SA 4IESA 2LHNA 5EWSA 4NHKA 2PYTA 1GZWB 3CDZB 4TN7A 1BVVA 2JDZA 3E5QA 5GZFA 1Y9MA 1YD8G 2A3YA 5FZ8A 2PXJA 4JKMA 2FDFA 2ATFA 2RS12 3AVSA 2EXHA 3E22E 4XFAA 3DP7A 4YFZA 1CWPA 1AYM2 3GBFA 4Q4W3 4LF4T 1GZ9A 2ZHMA 4ARYA 3P3PA 4DV2T 4WNKA 2FMYA 2VNVA 5J2TE 4QD2A 2W61A 3INAA 3P50A 3WXPA 2JJ6A 1LJ7A 3FAOA 3AE7A 4ZI7E 2DVAA 3AKRA 1PNFA 4LADB 1KFUL 4IEQA 4X6QB 4LMKA 2H0DB 2P17A 2VC9A 2BQPA 4I2OA 1QH7A 2AUYA 2CKLA 4HKLA 3HAGA 4XILA 3AEBA 4URTA 2BEOA 4CU6A 5C8CA 1JYVA 2QCSB 3ZJ1A 5GZEA 1RVF3 4BQXA 2LSJA 2KM2A 1UIJA 2WS92 3LB9A 2ZJCA 1OUSA 1OLMA 4LE4A 4XFCA 3ORJA 2PAMA 4QX8A 2XONA 1RITA 2Y0IA 3AEGA 4L11A 3ZYJB 3ZYHA 5ADXL 1W8FA 4UW4A 4PF1A 2OXBA 2XSBA 1ASJ2 4F3JA 2HWE2 1AJKA 1HRI3 4NR1A 3P6BA 3ETUA 2R043 1UU5A 1JM7B 4LBOA 4YZ3A 3RMYA 4DV6T 2R061 3DN7A 4BIOA 5AVAA 2XG3A 2CTVA 1J1LA 5LATA 1RINA 1BQPA 4HGAA 1VIWB 1WIMA 1QWRA 4WM7A 3FZKB 2XQ6A 5AQKB 2ZKLA 2KT9A 5F8PA 4YG0A 2D40A 3BTZA 1PVC1 1GQHA 2ZLYA 4A49A 5JR2A 1JZ4A 1SLCA 4Z8XA 4NHXA 2L3LA 2JRKA 3CZUA 3AEEA 4Z82A 3MYXA 4RL7A 3ZSEA 1IKPA 4AW7A 3QB5K 3ZCJA 2RMU2 1JYTA 4CCNA 5AQJB 5FFOC 3LBXB 5JXJA 1D1CA 1ZBA3 1JMUB 2V8SV 1W04A 1HRV1 4QQLA 2YY1A 2ECJA 1Z0PA 1HW5A 1FV2A 2YFZA 3HCUA 2PMWB 3H3ZA 4PK4A 3ZT5A 2GAUA 4TXWA 2DCKA 3S0MA 2YMZA 4NPPA 1EUUA 4FOQA 5M0TA 3FL2A 1IOAA 4XYXA 5JOYA 3IPVA 2VZTA 5A33B 4W6YA 3J7NA 4A6OA 1RMDA 1YO8A 1UO9A 3THPA 2ZGQA 4HVRA 1W8TA 2BZDA 2DU0A 4Y22B 1MMAA 1SPPA 3JB4C 2PJQA 3FJSA 3HCTA 1MIWA 4TWTA 1YRZA 4PNIA 2D6LX 2W5FA 4TLFA 4BQ1A 3SXWA 5BNPC 1N3QA 4UWDA 1ZZ7A 3NNJA 3IDEA 4AGVA 5AQMB 5GZCA 4UIGA 5JCTA 3PUZF 1ZZBA 4EYUA 3KCYA 3U5OA 4A44A 3VL8A 1Y43B 1R64A 4UXNB 4S3OB 1LDKC 4ASKA 3NQHA 3WUCA 1H1MA 4CEWC 1QUUA 5FP9A 4BOWA 5ACA3 2FUIA 3FXDB 1MZ6A 1HG2A 5C3PA 1HYIA 5FQ0A 4QMAA 2HWF2 3RF1A 3VBHA 2G19A 2VCMA 4O61A 4PDWA 3GXUA 2GU9A 3UL2A 2BV4A 2X67A 1DQ1A 2HN1A 4P5OB 4LF7T 4EEBA 2AXDS 5FXWA 1DU2A 3O1JA 4Y24A 5IUQA 4BQ4A 2FHRA 4YFSA 1V6IA 4Q0PA 5ABHA 4CUBA 5IVJA 4QM8A 3JD73 2CRBA 5JDQA 5J3XA 1B35B 5F3EA 1SA0E 2FUPA 1V0AA 2C5IT 3VKMA 2NOXA 4UI9L 2XY8B 4LIVA 5C4WC 2CSZA 1SBDA 2LRLA 4J2CA 2VU9A 2ZMKA 2VKHA 5KH3A 4YW5A 1NEKA 4IGOA 4JTNA 4CU8A 3PTYA 1QSDA 3NZQA 2GNMA 4K8FA 2HWB3 4Y20B 3N7JA 2ADEA 2LV9A 3AMPA 4M1PA 5LCWB 5H9SA 3OG2A 1W06A 4OVEA 5FJKA 2XVGA 1OMIA 4XW3A 3PJQA 3PLQA 4QKBA 1DQ4A 4YGCA 4CEYA 5DQVA 4LEJA 4C1WA 2P3KA 4OI2A 4DR5T 3ZIXA 1LHWA 4W65A 3F31A 2WYFA 1HN0A 4UR9A 3CWZB 1MS3A 4XF9A 2ZX4A 4HKOA 5EJ3A 3GHNA 4E7SA 2CEAA 3VZNA 3WG3A 1E5HA 3RZJA 2VPBA 4MG2A 3ZT7A 3P4PA 1ZZ6A 2X8KA 4LR4A 2QFEA 4LF9T 1AR83 3RPQA 5LKUA 1E5SA 3TB0A 1F4AA 2VGDA 3RQUA 4JRAA 1T6GC 5LG3A 2ZMAA 3AEAA 2R0HA 4GD4A 2D3SA 3B02A 4N78D 5LY1A 4CE8A 1T2XA 3OJBA 5HXSA 5LJNA 4AI8A 4PLNA 1IAPA 5FZCA 2BS3A 5AQPB 1KXGA 4KU7A 3MDBC 2Y34A 2VR4A 3POJA 4UEMA 1U5XA 1WLCA 4LMLA 3JBG3 1S55A 4MFRA 1RGSA 4LBJA 4YADA 3PUWF 4ONUA 2LSYA 2VW1A 5DQWA 2CT2A 1R081 2EXKA 4GB33 1AXZA 4XETA 2XMLA 1POQA 1MS4A 1MNEA 1YKEB 2RS31 4RFRB 2V5YA 3MI8A 5C2TA 3OBRA 4KMCA 5LA1A 2M67A 2XKOA 1V6JA 2DFCA 1V6LA 2CWOA 4OHFA 3OOXA 3EVYA 3GJBA 4BJ0A 2ZGKA 3UFGA 5H9RA 3JB8A 1AR91 2VE1A 2J1TA 4LOTA 4ES9A 4BIFA 5KWRA 3R6NA 1NE6A 3IAPA 5H9QA 5JPNB 3VDDA 1H0BA 3AMNA 3H1YA 1BK0A 1IS6A 2BG9E 3LFIA 1YQ8A 2VL0A 1EUTA 3Q9DA 1GKBA 3ZXGA 1RUJ1 1QXPA 2F17A 4XQWA 3J8F1 3NVCA 2CCQA 1WW4A 5AC91 2JX9A 1PK6A 2VOKA 2W67A 2C5KT 1VALA 2HWD2 5AQUB 1LODA 3LDQB 3BYWA 4AQYT 1RJ7A 2ZX1A 1X4JA 1RMU3 1W6NA 1IBKT 3X1DA 1VBD3 5HBAA 4QDRA 3UTKA 5LYJE 3FE5A 4FSJA 3O1RA 4LA3A 4AAXA 4YM0A 4Q1RA 1QJY1 2ZEYA 2VQET 2VZ1A 4RR3B 5JR7B 1UY1A 3C5KA 1OH4A 3RZHA 3H42B 4DRRA 4ZXLA 2WA3A 4GMP0 2LGLA 3CQXC 4XFHA 2HWC3 1N3OA 1QJX1 4ERRA 3JUUA 2IWGB 1PO23 3VD3A 1P8JA 2J1SA 1K3IA 1MMNA 4DVDA 3TNPB 3ZIWA 5F7UA 2D6OX 2JENA 1NZCA 4DQAA 5BNNC 4IL4A 1JNZA 4HN9A 1SCSA 3Q8AA 4PIZA 1KEYA 1UK5A 5JRCB 2BUKA 2VVDA 1RUH3 3M62A 1FPN3 4LOSA 5AQVB 1SBFA 2C5DA 2AGSA 3ZFGA 3BQIA 1WBFA 2ZXQA 1JZ6A 1VBE3 2V7KA 3AB0A 4MVTA 4UFHA 3ZMZB 3FHIB 2YSMA 4FPOB 3CX8B 2PTMA 3AL5A 3BVCA 1WEWA 4BJMA 3K4ZA 5G04L 4ZXKA 1LOGA 4G3YC 5BNNB 2IVIB 3N4MA 3DPRC 4FAGA 2BWAA 4AHXA 4XVHA 4WYVA 4OHVA 4LBKA 4ILAA 2K0GA 4XMIA 4Z8BA 3H3AA 1Q8PA 3LIGA 3DJBA 5IK4A 3AE2A 3QC9A 3KCCA 2FD4A 5L36A 5SVYA 4EN0A 3ZXLA 1XNQT 2JG9A 1EAH2 4YPJA 3AAAB 4YM2A 1IG3A 4LLFA 4GKXA 3LK3B 2PQSA 5F6KA 4HFVA 1SMVA 5F5AA 2QKDA 2IQJA 3L2YA 4BLIA 2VUJA 3OF1A 2D98A 3AYDA 2QRXA 4COZA 1EY2A 3UUNA 4QQPA 4B7YC 3EDVA 2YURA 2P3YA 4INDA 2LRKA 1BHGA 1WLXA 5IHYA 2NZ9A 4A7KA 1L7LA 2GZWA 1SZBA 1WCQA 3QNUA 3DPRB 4HPKA 3C7GA 1MM3A 1H2KA 2LGGA 4I01A 2XVLA 2VQAA 2MPKA 4YWAA 2EGPA 1U6GB 3P4QA 4LFCT 4Q4Y1 4K1ZA 4AQ6A 2QQUA 4Q25A 5LHGB 1JOBA 2EXJA 1W39A 4KG8A 1FATA 4K3UA 4LUKA 3AECA 3RH3A 2UY8A 4JI6T 2UYBA 5FDBA 2WAOA 4NRQA 3AKPA 4XBQA 5LEJA 1VFYA 1RVF1 5A1AA 2Z4FA 2E8IA 1XSRA 1GWLA 2YC4A 3O14A 2EHOC 1DYKA 5FVKA 2VMCA 3WQ7A 5C9AA 5ABFA 2ZHNA 1HRI1 2VMFA 3Q5WA 2O0OA 3HQUA 3U5NA 1US7B 4R8HA 2ZGMA 3WG2A 4IEZA 2OZJA 5E1RA 2G9GA 5JXGA 2ARXA 3OGGA 5JH7E 3UU5A 4JI2T 3LJUX 3BTXA 4YBTA 5L4HA 1BJQA 5C3QA 5I0DA 5LXTE 5J98B 4M3CF 4RSUA 2D97A 1DG6A 5IVCA 4URAA 4PLMA 4IV1A 4KG0A 2AEYA 3LDRA 4JRLA 4WVMA 5C3RA 2D3RA 5FERA 2XBO3 5LBEA 5T5PA 3LA2A 1UYZA 4IL7A 3S7EA 2WFF3 1OVPA 2EICA 5HCBA 2EA6A 3DKQA 4BQWA 2XVKA 2OWAA 2PHTA 4XF0A 1GNZA 1F5JA 4U72A 4YW6A 2X9XA 3AEDA 2AEZA 4JKKA 2NAAA 4XC9A 1OOPC 4JGYC 5IK7A 2LAUA 3SWHA 3IIAA 2MKEA 2CXLA 3NV4A 5L3EB 2OIIA 1S4CA 1W03A 2RV9A 4CI1B 3O0XA 4Q0QA 3FEHA 4YZ1A 2WZEA 4YSFA 5FWJA 5B75A 4AKRB 5I0SA 4TNVA 4F83A 1UZVA 2ECNA 2CAVA 2KWIB 5FPZA 5BY5A 4A3ZA 1B7TA 3HD8B 1QJU1 1DIWA 1D1BA 4DOUA 3X29B 1OOPB 1MQTA 1S1AA 2X0HA 4KI5M 5JMCA 2CSYA 5T5LA 3UJQA 4LMFA 3S6PA 1JU3A 4RHV2 4EV6A 1ENQA 2VB6A 3D0SA 2Y8KA 4BHPA 3T2OA 2UWCA 4XFIA 3D4KA 1URXA 3UT5E 4AXOA 4E7ZA 2F6BA 1AUYA 3BN6A 4HWDA 3WF2A 1HXS1 4QXHB 2ZX0A 2LLYA 2BBJA 1R1ZA 1W9TA 3CEWA 5LEKA 2YC0A 4YTNA 4PJNA 3WCRA 1W2OA 4IHJE 4JI1T 4KBMB 3THDA 1SG3A 2BS4A 3DL3A 3WUDA 5I8YA 2BZBA 2VG9A 5HCFA 3PURA 3EXUA 1W8ZA 5HCHA 4P1NA 5FYBA 2IW5B 2I2SA 2X0LB 2WQ4A 4UW6A 2L0BA 4META 4AIUA 5TDWA 3RYPA 2XB6C 4XBFB 1JYNA 4NMIA 1X9PA 3FUQA 1RUNA 4I02A 3WAJA 2PUYA 2VVFA 4MYEA 2R49A 4CCLA 4UXAA 3A0KA 3GCWA 5KC6A 4U2ZA 2MTQA 3P3NA 5F2SA 1TNRA 1UUSA 2A75A 3SEPA 1OEDE 5GONE 1BMV1 3LPFA 3PVEA 4CDWA 2XPKA 3JAEA 5D8AA 2E9XD 2PAEA 5F9TA 1ZYBA 1EPWA 3DYMA 1RUF2 2W91A 3VKFC 3WVJA 1H9WA 4M4RA 4QKNA 4XUTA 2MT5A 3SCHA 1LNSA 5GALA 3UT0A 4LBQD 4P9IA 3ASLA 4XUQA 3OB8A 2ZX2A 1APNA 3CU7A 4LO5B 2K46A 4NPRA 4FBFA 3RIUA 2J22A 1RHI2 1ZBDB 4CCJA 4YZ5A 2YDQA 3TEXA 3V0AA 4UF0B 2WC2A 1FMVA 2MNZA 2ORXA 5FZ4A 3VBSC 4YY3T 3MGUA 3SHRA 3HTKC 1ZOYA 4C9ZA 2RS52 3IN9A 3VLBB 4R8PK 4RYDA 5JQGE 2YSJA 2NR4A 2D5FA 1NA1A 4PFOA 1ND2A 2RHPA 1DGLA 3K77A 1PO12 4OUEA 3LAGA 4P9XA 3EUHA 2UUAT 2VBPA 3D5OA 1AJ3A 5FPBA 1NCRC 2NLRA 2YGMA 3U78A 4AHZA 1N1SA 4YBMA 1DZQA 2RR11 1ZM1A 2BG9A 1HJGA 3IKWA 3CMLA 1VAKA 4GZ9A 2EAAA 2IFRA 2XR4A 3PUVF 1CUNA 5FZGA 1LHOA 3I2OA 3KF3A 1DZRA 1RUG3 1V9U3 3ZSSA 4C1XA 4I43B 1UMHA 2HJIA 1V6NA 5L3FB 3VBSB 3ANWA 4JHZA 3VBFB 1S0FA 3HBZA 4FI5A 5IAVA 1UX4A 3OYWA 1OH3A 1DQ6A 1ZRRA 2VZOA 4LXLA 1JZ5A 4FPCA 4J25A 4A56A 1WFKA 2K1JA 4UP5A 1SQ4A 4LLOA 1WGMA 1LOFA 4GH4B 5LB7B 4E2SA 4Y1ZA 2MA5A 2PN5A 5FY0A 4AQSA 3TBDA 4GNDA 1NCRB 4GB31 2ORZA 4RQPC 4YTPA 2XB1A 5JR9C 1HX6A 1CIWA 3WCSA 5FWEA 1G8XA 2NMNA 1Z7S2 4KH9A 3THCA 4LF8T 3O9XA 3TRSB 4TX5A 1OPMA 5TBNA 2C9AA 3I2DA 3LVRE 3B69A 4ZDTA 3MJXA 1W6OA 1ZEEA 3O7OA 5FLIA 1D4M1 1WBLA 1G7YA 4MXWB 1COV3 1ULOA 4DXTA 1H1IA 4NUBA 5A1FA 3RHWA 2XHKA 2W95A 4MADA 5AQFB 3KDSE 4IEXA 4RQPB 4ISTA 5JR9B 5AQQB 3TYJA 4A5XA 4RGKA 5AQTB 2VKDA 2ZM8A 1OBNA 4YM3A 1MEC2 4E27A 1VPHA 5HWYA 3QLQA 1BVP1 3SCFA 3C4ZA 2O1QA 2DUQA 4H3WA 5JVDE 4AEMA 5LW9A 4WW0A 2RI7A 1YFUA 1FBVA 5F3IA 2OV9A 5CFDA 4WBBA 2XTLA 5FY9A 1PIV3 1E57A 3LOBA 1RMU1 1VBD1 1BR2A 3VB9A 3RNSA 4WA6A 1FV3A 1AR71 4FXKB 1VRBA 5DZEA 2WNUC 1GOHA 2KA3A 3BU0A 3GL6A 3HWJA 2MEV2 2PHWA 1MVQA 3OY8B 3ZXDA 4BWOA 2W3JA 1PM7A 4HSJA 4BCUA 4MBQA 1PGW1 4HT1T 4UELA 3ZSJA 3LQHA 1NT0A 4DR4T 4AYCA 5CAZA 1GV9A 4N53C 1FPN1 4NROA 2JKBA 1DQ2A 3HKDE 1NX9A 1TG7A 4P08A 3ILRA 1NYWA 4KWLA 1PMIA 3Q5EA 2J1UA 5HCMA 1O59A 3SC7X 3E1F1 3DV8A 1AL23 3AXJB 3ZFFC 1IGOA 2VJFB 1YW0A 3PJAA 2XJTA 1IBLT 3E0ZA 3CIHA 3DXUA 4HN0A 3GYDA 1IJ6A 3AP4A 2XJVA 1OSGA 2YHJA 4UW3A 4AVSA 2MOZA 3K2OA 3VZJA 3UESA 2Q9QA 1D2QA 2C4XA 3OUHA 2CBIA 3M7AA 2ZTNA 1TMF3 3MHZA 1N36T 3VD5A 2VZPA 3ZFFB 1LCLA 2ZAHA 4TWDA 3FUOA 3GALA 3PUSA 5FKYA 5DZGA 1GSLA 1QQP1 5FL1A 3C50A 2F4VT 1LHNA 2KWKA 5H9PA 4JHTA 4Q0SA 4JLEA 4Y5SA 4MHCA 4D6SA 1LKNA 5JZGC 5J96B 4TKPB 4JGZC 4NO4A 4DEQA 3TLWA 1SLTA 3CL1A 4CDXC 2VW0A 3ECQA 4IXLA 3AP5A 4NPMA 4MGTA 1W0BA 5CA6A 3ETQA 3VD9A 2LROA 2VCBA 4M4PA 2QGSA 2RS13 1CAXA 4LO6B 2K2SA 4BA9A 3GV4A 1AYM3 4YVSA 2V7MA 4CCKA 1QNWA 4IIJE 2NYYA 5CFCC 4D7TA 1PM4A 2LDRA 2E9XC 3J4UH 3TLUA 4Y5Z0 3AL6A 5JZGB 4LO4B 2VJEB 2DF7A 1CQ9A 1MACA 3U5PA 4WVZA 4CDXB 2PLV2 4FPGA 2DBNA 1ULEA 1RIRA 4YGEA 2CONA 1GOFA 3AE1A 4ISSA 5FYSA 4ZEYA 1N1YA 4X1IE 2WZR1 5ETWA 4I09A 4AFMA 1G9FA 5DINA 4NHYA 5A3PA 5AQLB 4QDSA 3MZKB 3RKGA 3SKVA 5HXHA 4F8HA 4XQDA 5CFCB 5FZ7A 4ZY9A 2E9XB 2WS93 3DQVR 3PMSA 3V64A 5B76A 1Z2QA 3IEEA 1GU3A 1CR7A 3ZYQA 4LBQB 4XFBA 1ND3A 4J1XA 4FFHA 3ZDSA 4NWVA 3T2QA 5DDJ1 1ASJ3 2VMEA 5KDMC 2HWE3 3RC8A 3KT7A 5FPLA 3SUBA 3AE5A 2Y48B 4KGQA 1JN2P 4V2WA 3N2GE 1VRH3 3A21A 4FOYA 5KXBA 4D3WA 3WQBA 3MLKA 4FTBA 3UV9A 1BBT1 2J42A 2VY0A 2H7VC 3PJAJ 1HLCA 1RUE3 1JBCA 1KNZA 5L7OC 1OFSA 3CJIA 4H7MA 2WINB 2X51A 3VDBA 1GLHA 1GZCA 3NWIA 4JBWF 1FJGT 4LF6T 1K5MC 2IZWA 1RXGA 1DF0A 4R52A 4DFSA 4CI2B 2NTYA 2XL7A 1OQDA 2R062 2D43A 3I2HA 2VOVA 1MZFA 3LEGA 4Q6FA 5C70A 3AA0B 1OEDA 2VZQA 4TWFA 4XTMA 2F4LA 1ALYA 3TNQA 1HTJF 5CU1A 1NLSA 1W9FA 3PVOA 2W62A 1PVC2 3C7FA 3MIHA 3RZZA 4LMJA 1MS8A 1A6CA 2V72A 2FFWA 3FZFB 4OK0A 1HQNA 2BYVE 3M3OA 2R30A 4FQ4A 5DUXA 4KWKA 3O33A 1ENXA 3FN9A 3OEBA 1HRV2 2RR4A 1JZ2A 1H9PA 2KR2A 2XH6A 5FYTA 3U3IA 4YZ2A 1GMMA 1GP6A 4JI4T 2LGVA 4AI9A 2IIUA 1OD3A 1BK1A 5IATA 4AXPA 2OQ7A 2BVLA 4PW8A 5GLUA 3MUZ1 1F2NA 1CJDA 1RUC3 3EQEA 4A4AA 3L3PA 2DURA 1VBB1 2BERA 1PVXA 3H1WA 3PIGA 3N7LA 2XM1A 2CWMA 4M0NA 3LEMA 3FFZA 4N90A 1KS4A 1OA3A 4TN7B 3PVBB 4OQ9A 3AXEA 3OBAA 2VUDA 3MV01 4DO0A 1LGCA 5JOZA 4FPYA 3AKTA 4YATA 3AC0A 2DX8A 3RX6A 2Y8DA 4O65A 3AX4A 4DMVA 5C8CC 4PHZA 2QDNA 3SFDA 1S0CA 5FB0A 4PAGA 3KQ4B 2HWF3 5EYXA 5K0UA 2BNOA 4QH1A 2KIZA 4DR2T 1JZ3A 4MLOA 3WDYA 3VKHA 1VD4A 5D2AA 5BNOA 5FOBB 2ODUA 1GQEA 5FL0A 4QT6A 4GALA 1BZWA 2XM2A 4H63V 5C3SA 2ZETC 3HR9A 1JHJA 1AXYA 2WKKA 2V7LA 3AAIA 3THTA 2C2VS 2WBLA 1D7PM 4H9QC 5C8CB 2WYSA 4NXMT 2LRPA 1UKRA 2HPLA 3DF0A 4Y3OA 1WCSA 3OGVA 2XL9A 4WM7C 2W63A 2NW7A 3AMQA 4EOZB 1J3RA 3FBZA 4UT5A 1CAVB 1ZZCA 2WU5A 2BNMA 2FDJA 2QDRA 1I94T 1W6PB 1WLTA 5JDMA 4W4ZA 1B09A 1RL3A 4YABA 5J2UE 1JNRA 2WN3A 2BBAA 2AR6A 1Q8SA 3O34A 3W59A 1RUG1 4XQ4A 2YU2A 5FJHA 4B3ST 4XEZA 2B4KA 2LHRA 4QX2A 4KQ7A 4V1Av 3MIGA 4MGYE 2AH2A 2VMDA 2D6NA 4EB6E 3NG2A 3T4HB 4XUPA 3I97A 5ANNA 2G6QA 5FK7A 4DY5A 2OUJA 2YV8A 3R6SA 3GJAA 3OTOT 1LEMA 2EODA 4N9IA 4WM8A 4AEDA 5FZOB 1GFF2 2WSSV 1DFQA 4QPGA 1QNYA 2QQOA 3ZSTA 3N7MA 2X5IA 3ZT6A 5LP6E 3O47A 3WW3A 4FOVA 2ZZQA 5DN2A 1PZ9A 2B39A 2M6IA 4YAXA 3ZYRA 3ZXJA 2L43A 1W90A 4X1KE 3BGAA 5C8YE 1W6MA 5A7WA 2RDSA 4OGEA 4DXRA 3WP4A 4ZHQE 5JDGA 5J36A 5FMCA 3DTOA 2ZM6T 4E9KA 4JC1A 5K8SA 1WEEA 2C0SA 4H9PC 4HWFA 5FYMA 3RIFA 3NRXA 1VBC1 1JZ8A 4BH9A 2XKPA 3WT3A 5E8AA 1LAJA 2D0UA 3UGFA 3IPVB 3BTYA 1NCQC 1GZWA 3WX5A 5CA1E 4MALA 1NLQA 1QMJA 1G73A 2VQTA 1ONAA 2VMGA 2NPIA 5FZ6A 5JAXA 5BYNA 2W4XA 3KNVA 4F8AA 2Y43A 5F3JA 1NG0A 5A7PA 1WMEA 2HEWF 4XUOA 1YIPA 4K40A 1XJAA 1UMZA 1SPPB 4HVOA 2PFVA 4WVVA 1PIV1 5B77A 4AKLA 1MPXA 4K20A 3CJXA 2YT5A 3WG4A 4FJOA 2P6CA 2ODVA 3RZLA 1X33A 2LQ6A 5GM0A 4MGSA 1W0AA 1R082 1NCQB 4R4XA 3T4VA 2BVMA 1KDKA 2H0DA 1YJKA 4FVVA 2JMIA 4QPIC 3U75A 2RS32 4OI4A 1D0ZA 1UOJA 3PDQA 5LA9A 2XLFA 2RDNA 2Z2SB 2M1RA 3QOFA 1QOOA 5JXHA 5H1UA 5FYHA 5LB6A 4LLBA 2JKXA 5FLJA 1AR92 4EE2A 2DL1A 5A3TA 5FMOS 5FQ0B 1Y4WA 1CESA 2HWD3 2H0BA 4LTAA 5C8WA 3WNKA 4NE9A 5FZ9A 1SUMB 1BR1A 5IVVA 4FFIA 2ZGRA 4B4QA 5AQGB 3I3EA 4QPIB 1RUJ2 5GLZA 1XWMA 1JM7A 4K1YA 3SH3A 3J8F2 3I7DA 4WVWA 4GKJT 3O5SA 2OVUA 1AL21 2A6YA 4EN8B 5AC92 1TME1 4FPEA 3RMXA 4CEYC 1XYOA 3AVRA 5ABJB 1AYN1 2ECWA 2D5UA 3AA7B 1S0BA 2E32A 4CDQC 5ABEA 3U5MA 4DV7T 2ZGSA 4XIKA 1POV0 4JQRA 3U4SA 1GOGA 2A72A 3RI9A 5GLWA 4Y1YA 2O8QA 2XJRA 4QF2A 3RZGA 2FJBA 1QJY2 4CXWA 3NNGA 4U2AA 3GZAA 5FXXA 3NV3A 2CM0A 4DPNA 4QAWA 2H7OA 5A7QA 3P7IA 4QXBA 3LBXA 4NWWA 1G86A 1ULFA 4AFAA 3AM2A 2WIIB 2XUMA 3SQOA 3I2JA 3L1XA 3P1IA 3WNNA 5LWBA 5LA0A 2M13A 1WEMA 5LZ6A 2YEVC 2N2NA 4JV5T 1QJX2 3WF0A 4FP3A 4P14A 4CDQB 4K6BA 2VVNA 5FB1A 2EA7A 1ZKEA 2C5JA 1FOD1 4H14A 4XXAA 3EDUA 1VLNA 1NENA 4XTPA 5DAPA 5I0UA 1SFYA 4A97A 3NKGA 2GH8A 1XE7A 4K21A 3OTFA 3MPBA 4CDUA 1R1A1 2DCFA 5H9MA 1F62A 2QQKA 2RG4A 4W50A 5F39A 4N43C 2I6HA 2SBAA 5KX5E 5LHHB 3DPLR 3AZYA 1LVFA 3O1UA 1EAH3 4O62A 3CQOA 2FMDA 3PUGA 3DYOA 3A7QA 1GQPA 1IPSA 4NAOA 3RS6A 1O8PA 3SOUA 2YG0A 4WZ3B 4ORFA 4PJLA 3ZKUA 1ZVFA 1D2SA 2BBVA 1C1LA 3UFEA 1QXJA 5JSPA 2BOIA 3CO2A 5FZBA 4N43B 3ZX7A 4KBBA 3DUIA 2P4EA 2BP6A 4B1MA 4L2NA 3RWNA 2XAFB 2KXLA 4G2AA 4DR6T 2Q8CA 3ZYFA 3KHCA 2I50A 3ONLC 2B9UA 2QZ2A 2R073 2ARCA 1KDMA 4I0WB 2NQYA 4NIQA 3PUAA 3CMGA 3ZYIB 5BNQA 3EHZA 1DGWA 4S2DA 4BXFA 5IK8A 2KREA 1LOEA 4IDQA 3V56A 2RJ2A 4Q4Y2 2A2FX 2HKXA 1RB8G 4CCGX 2JG8C 2I59A 2CLYC 3FLPA 4CCMA 5FPVA 2PNXA 1B35A 3ESLA 5B8DA 5LBBA 3MW4A 1VRH1 2EVXA 1W99A 1K45A 4JTOA 1RVF2 3VRAA 5IWFA 2Q8DA 2WDRA 2YQMA 3GBWA 1OQ1A 2DI4A 1LRZA 2ZOEB 1RUE1 2CNAA 1H8TC 5FO9B 3JC6D 3HIFA 5B4NA 2YYOA 4XBNA 1HRI2 2OUHA 2RM21 4NIIA 4Y20A 2JG8B 2JWPA 3H1MA 4AVCA 4GNFA 3P4WA 2Y38A 5DKAA 3VZKA 4P0BA 4HG6B 4UW5A 2XZEA 4U36A 3ZFGC 1DP0A 2QIZA 2VNRA 5D1LB 2BGOA 2CU5A 3NAPB 3J9X1 2XAGB 3K48A 4A6SA 4X8NA 3KHBA 1YQ5A 3NKTA 3E08A 5J0ZA 3H7JA 4P02B 2K3WA 1QDCA 1H8TB 2LRIC 1ZREA 1HNWT 1AX1A 2XAHB 4HTEA 2P3JA 3LSVA 3O1OA 4AKHA 5J09A 3L1ZB 4PIYA 3QOPA 3WQ0A 4BDVB 5EK2A 1SBEA 3H50A 3I54A 4QH4A 3TLTA 3L8RA 1OLRA 5HV0A 4GQ7A 1RTVA 2AACA 5DG2A 1IZNB 3HKEE 3S5AA 2JG9C 3FHNA 4L58A 2WT0A 4HLTA 5L3BB 4BHWA 3OCPA 3FMGA 1WMDA 4ILBA 4GMP3 2Y6GA 4OCTA 2YDSA 3O35A 1WILA 5DAVA 4DR7T 2VBBA 5I0TA 5L9RA 3M99A 2LGKA 1D0GA 1RUC1 4RHV3 3QBQA 3SHBA 4L7XA 4AKGA 3J7Yq 2ZX3A 1KNPA 4OMDA 3POYA 2CL2A 4LORA 2VL8A 3KWVA 2YU1A 3ZN6B 3L39A 2Z69A 5BXXA 1OA4A 2C1FA 3OGJA 3MHSA 3W15B 2HYXA 4U3CA 3LK2B 2CMRA 1QH6A 2X53S 5FO8B 1HQWA 2YXSA 4FI9A 3RGLA 2WQ8A 3OD4A 1ZHCA 2KKYA 2C2LA 3HL6A 2EXUA 1RUI1 3ZYKA 4EN9B 1QJU2 3IF8B 4B6XA 2MHFA 3UU8A 1VBA3 5HEHA 3VKLA 1MMGA 3CVRA 4XABA 4QHZA 4D69A 4A98A 3NKZA 4EZHA 2BFUL 4B7EA 4GXLA 5C9AC 3MUY1 4Y1XA 1K12A 1ZRIA 1YKHB 1EZ3A 1FMD1 1HXS2 3FANA 4YSZA 3PUQA 2A3WA 3WQ1A 2W66A 3LK42 5LJMA 2A3DA 3PMEA 3WAKA 3Q8EA 3FB2A 4CPBD 4OHXA 4GKYA 5DUUA 1GBGA 3QZVA 1UURA 3U10A 3V43A 2Z79A 4CUAA 4X3GA 2X66A 3GA8A 4Q1PA 2OYZA 3AXDA 4I7DA 3G7DA 3HBKA 3B13A 2KLQA 1GYKA 3BU7A 5J48A 3ROUA 5ABFB 3O37A 5FIXA 1O4YA 2XQ3A 4OZXA 3VDAA 4RR3A 3M3EA 2LUWA 2LSIA 2VPDA 2JE8A 4CA1A 4XCBA 4C8DA 5JIUA 5ANQA 4GJYA 1Q56A 3MACA 2VO5A 1RHI3 2W1WA 2H6BA 4HETA 2VBDA 3RRCA 3W21A 4AKIA 1BMV2 5CA0E 1EV11 4DXSA 4AOCA 1LOCA 4Q4V1 1T7SA 5KXJA 2LXHC 2RS53 4B7KA 3C7HA 3SMHA 5G05L 2W0GA 4OI1A 3LIHA 5FMBA 1T98A 5LHIB 3FLTA 4PI0A 3T6RA 5JRCA 1HX8A 4WVMB 2XJPA 2UU9T 3I59B 2IUBA 4LPLA 4YW1A 4R7EA 2YDEA 4QXKA 1AR61 2XOZA 1YQ3A 1ODMA 5C3JA 3VBUB 2UWBA 3BB6A 5HXVA 1C1FA 2ARBA 3U07A 4NJ4A 1SEFA 1C8M3 2NP0A 4OULA 4D6RA 3K8PC 3ES4A 5EZYE 5JWPA 3AB3B 1MQTC 5BNNA 1BKZA 2BPA2 3EO6A 4UP0A 2LN0A 1YEWA 1XOYA 1UAIA 3FHQA 1ZZ8A 1FAYA 1C4RA 2LSKA 4EN7B 2P37A 2CRWA 1PX4A 3LDBA 5A3OA 5HEJA 3GNEA 3ZKYA 2RR12 3I3DA 2X9HA 4BK5A 4UFIA 5LBFA 1H2NA 1Z7S3 3NNFA 1GP5A 2XUEA 2OA2A 3ITQA 3LQJA 1XNTA 3C3VA 3FC0A 5FY8A 1F9KA 1MQTB 5FZ1A 3IMMA 2OZ6A 3WP3A 4CP0A 2VOXA 1LKXA 5CFBA 4Q0UA 1GNYA 1XZYA 4QWNB 4LK7A 1NY71 5FZ3A 1IPJA 2FUUA 3BKZA 4GB32 1IS4A 1W9RA 4B29A 3J26N 3D3AA 1Z6UA 2DVGA 3QUJA 1XMOT 5HXCA 2VTFA 5B2GB 4GULA 1MEC3 2KMFA 2WLQA 4JDMA 3PLWA 4FPJA 2BOJA 3GN5B 5FK8A 2LOSA 1ST8A 4XHXA 1H2LA 1WMXA 3S4UA 1OURA 2DVDA 3OKQA 2YBKA 4AVBA 4Y5TA 1D4M2 2D93A 3IDAA 4LKAA 2JQHA 4WZ2A 1UZYA 1DGRN 1Q43A 2K4DA 3AP7A 3FL7A 4CDWC 3ONXA 1NOVA 2P3IA 5D8AC 4YW4A 5IYZE 3F95A 2Q1MA 4R2YA 3JC6C 5HXEA 4HN1A 5K9YA 5IVBA 3TLVA 2HBTA 5AQSB 5A70A 4YARA 1S94A 2QVSB 2MD8C 2X05A 1WKYA 3WZ1A 2H6CA 1H6YA 2LE8A 3RIUC 3V5UA 1J3PA 3GZTB 1W0OA 1O6UA 2XHNA 4IE7A 4DXZA 3I0QA 3VD7A 4KWJA 5LA6E 2E2AA 3MHHA 2WAAA 2DJAA 4CA9A 2E6VA 2K24A 2V6YB 4H9NC 1F15A 5D8AB 5JSRA 2DUPA 1MZ5A 1RMU2 4R9AA 3ZYBA 5LK5A 1QOSA 1S2KA 1VBD2 2LW8A 2E7TA 5HI0A 5F5CA 2JDNA 5A3NA 1NA1C 1AR72 5DAQA 3EB7A 4GB0A 1ND2C 1QJFA 2XEUA 2LXPC 4FK5A 4TV8E 3SKJE 1M06G 4U33A 3RRDA 2PTFA 4C90A 1JYWA 3WW2A 2GMPA 2BG9C 2JDAA 2RDQA 5C5UA 2GN3A 3ZJ2A 2XAJB 3NMBA 4A4BA 5JOXA 2VPEA 1HG5A 4V3KC 3ST7A 3W5MA 3V0AB 4GIWA 2GC0A 4Z0OA 3ZR5A 2QICA 1L7RA 1PGW2 4LKDA 2LKGA 3BK9A 4W6WA 2DCTA 4MOAA 4BQYA 3D8CA 1DYOA 1DCSA 4M3CB 3RVHA 3VBOA 5B4XA 3TN91 3UQ7A 2WCAA 3MLJA 4I3GA 1LOFC 4LO8A 1FPN2 1WLWA 1H2MA 3FHAA 2PFWA 1IQAA 2B7YA 2DLRA 1UY4A 2WO3A 3UUBA 4EN6B 5AQOB 3B5LB 3ZYLA 3SFEA 4CI3B 5IVEA 2F6JA 3ZVYA 2QNKA 3O1MA 2L7PA 4CUGA 3OYWB 2VJXA 1C57A 3LQCA 3J9SA 2K17A 4CZSA 4I50E 1BYHA 2F4PA 3EYPA 2VNOA 3NRYA 2D9DA 4IE5A 5KHKA 3AKQA 3POWA 3T8OA 4QXHA 1YUDA 4MGQA 1HNZT 2P57A 2CPTA 1HB2A 5A6YA 2VZ3A 2R6QA 3JU9A 1JUIA 2R071 1W6OB 3HR0A 5BNPB 1LDJB 2XAQB 2IUWA 4IV3A 4GWJA 1BEV3 2VNFA 1QQP2 2V5CA 5CFDC 1LB2A 3CHXA 3VRBA 3VL9A 3IA3A 4P9LA 2MNYA 1YI7A 5JSOA 3S30A 4XDQA 3T7LA 1FIOA 2VKJA 3PUXF 1W09A 3RWKX 1XNDA 2A3XA 2PLV3 4YGBA 4A41A 1HNXT 4NAMA 3VZMA 3JADA 1A3KA 1LGNA 3ZO0B 4CEWB 2A7AA 4BK4A 1X36A 2JIJA 3U37A 3WNPA 2B42B 2EHOD 4XZUG 2HEVF 2UURA 1QJEA 5KH7A 2OA5A 4ZI3D 2XSAA 4FTSA 2HN2A 5CFDB 2W92A 3UQ4A 3L09A 3PUYF 3TAYA 3O1HA 2IC9A 5FXVA 1WCDJ 1W8NA 3AZVA 5A3WA 5LG4A 4TUYE 3I4IA 3H7YA 4ATFA 3Q8FA 2R32A 3U14A 1R093 5CVRA 3AYCA 4R4ZA 5I91A 1WYCA 2G9FA 1LOAA 1R8IA 2WZR2 5C4WB 3VK6A 4A42A 4TV9E 4KP3C 1KS5A 2YFUA 2DBIA 4P9YA 2R1DA 2W1SA 4UF0A 1KEXA 4NUVA 2KKXA 2EIBA 5C3OA 2WABA 4XXPA 5APAA 1Y64B 1AZDA 1Y9GA 2YKSA 1MVEA 2QQNA 1KFXL 2UXXB 3K46A 4MHRA 4L9BA 3QH6A 3BQKA 3E6CC 3UULA 3M3ZB 2PAKA 4WZXA 1G8WA 5DDJ2 4RA0A 3MIDA 3MIBA 1XXNA 3M3QA 3JZVA 5D1MB 2K5BB 3LSEA 2GMMA 5IJRA 3BALA 3NV2A 2Q9QC 3POGA 4L0PA 3LVQE 2HLEA 2GC3A 2IFWA 2N7GA 1UL9A 5HYAA 2R063 1VP6A 2E5LT 1E5RA 3VBFA 3VHLA 3I3BA 3POBA 4LHSA 1BBT2 5JDHA 3RGBA 4XJZA 2E63A 1XNBA 2LSGA 2UXNB 1IS5A 3L11A 4GH4A 3W58A 4D8MA 3BODA 1NCRA 1PVC3 1OC1A 2LM9A 4CVUA 3U1XA 3GZEA 2GDFA 3VHNA 4H9RC 2IMLA 4L9IA 5FYIA 3WNLA 5FKBA 5H1TA 2FJAA 1AL0G 2LALA 2JMHA 2WN2A 1FMWA 5FYYA 1EYBA 4XHBA 5IAXA 2LEHA 1N32T 3P4SA 1HRV3 1VBA1 2VXRA 1ZRDA 3ZYPA 4MXWA 1D4VB 3RG0A 1HS7A 3ZCIA 1OKQA 2L80A 4B3NA 1X50A 1V6MA 4LUMA 1O3RA 4AR2A 3AKSA 2LM2A 3SS1A 1U4QA 4ZS2A 3B5MA 1Q5OA 3TWIA 3WG1A 1XWHA 4PCRA 2VASA 1WW6A 1DDLA 4XOGA 1PZ8A 2XQ7A 1A78A 2BW8A 2LJLA 4YW7A 4LKFA 4AG4A 3NJZA 4BMBA 4DIQA 4AI0A 4HFCA 1X9BA 2ACZA 1CAXB 3R84B 1KK7A 1REEA 5JOWA 2ZGOA 3U0ZA 4ZZ8A 5KXCA 4HSLA 4NIDA 1VBB2 2EIDA 4Q0VA 4QU2A 3NL1A 2GMEA 4MZUA 4QQ2A 3MFCA 3GWHA 1ND3C 4IT4A 1EPZA 2IHR1 1U5PA 4UI9B 4XACA 3ZXAC 3ZXFA 2WDVA 3OY8A 1ZBE1 4MXVA 5BPXA 4AEJA 2GNBA 2ZS6B 4ITCA 1QXRA 2MYSA 3FXEB 2A5ZA 5CIRA 2ECIA 4RD7A 2QQJA 4IW3A 5EPAA 3UNPA 1J3QA 2VD7A 1SFNA 4MSVA 4FPFA 1VMHA 2ADDA 2WM9A 3VR9A 1QGLA 2Z42A 5T50A 4DUZT 1RUD1 3R4UA 3V0BB 4G9SB 3KS7A 2NM1A 4LBMA 5LOVE 1D0HA 3A0NA 1WEQA 4XZCA 4WZCA 1U5YA 4Q4X1 1D0XA 1QDOA 2OS2A 3AXJA 2Y6XA 1C8M1 1IHMA 1YQ6A 3VV1A 4XAEA 2VJFA 2JECA 1O7FA 1OEDC 3ZMSB 4UYBA 3VBRC 3AE3A 2ET1A 1UWWA 3JQWA 3WY6A 2ZCWA 5J37A 4EV0A 4H9SE 2QA7A 1TEIA 2MPFA 1MIYA 2E6RA 2GC2A 2VXJA 4YG3A 4UFLA 4MH0E 3KBUA 3DCQA 4Q4W1 4EXTA 1RUG2 5EIYB 2ACXA 5LK7B 2YINA 4YNIA 3ZFFA 4YJ2E 4C0HA 1WA6X 3UKNA 3Q2MA 4UVCB 3VBRB 4DV5T 1LESA 1RYYA 2WZ8A 3EAMA 2KYUA 1W2NA 4QX7A 2ZM0A 5A3UA 3HCSA 2C0ZA 3KGLA 3LDYA 3B01A 4MO3M 3HN1A 4JV4A 4NVPA 3EJKA 2ZBJA 1QKQA 4YTMA 1US2A 5LBMA 4FPLA 3MEPA 2PHLA 2EALA 5FZ0A 1WLDA 2QYWA 2D7FA 2JUNA 4DINB 1LECA 5L47A 2VPGA 4ZI3C 1UOBA 4YGDA 4PI2A 3CQGB 2WQYA 1HCIA 5CISA 1Y7BA 3I2IA 4CCOA 5BV6A 4K8RB 5FCCA 4AQGA 1VBC2 1V9DA 5K0UC 4F7ZA 3KF5A 4CDXA 4HKWA 2X68A 2R041 4GIQA 3W5NA 1R083 2D6PA 3C7EA 1YQCA 4A0CD 5BNOC 5FAXA 4IGQA 4X1YE 5F37A 2Y6KA 3H8XA 4WBOA 2RS33 1WR0A 1ENSA 3T09A 5FZMA 2EHOB 4AP4A 3OBTA 4D94A 3WDUA 4HWHA 2G9ZA 2NMOA 5CKNA 4AI1A 1PIV2 2KWNA 2PHFA 2VVSA 3J7MA 1ULGA 2UZGA 2VCCA 4YHJA 1KD7A 4ZU5A 1OXZA 5K0UB 2CSGA 2W52A 4LBQA 1STMA 4B4PA 2HEYF 4XURA 3QCWA 3RPGC 1ZBA1 4HKAA 2VMHA 3MKDA 3LZZA 2Q1FA 3EBRA 1D1AA 1RUJ3 2DNXA 4HFBA 4I30A 4HFDA 3J8F3