3PURA

Cekdm7a from c.elegans, complex with d-2-hg
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
515
structure length
483
Chain Sequence
PKESDRCGGCGKFTLMSKKKSHHHKKNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKCVPHTGHSIRYKVVAPHRYRWYSPNEKHLGIEVGSKTWIEDFITRENTVPSPTDDEVCIVEDGYEFRREFEKLGGADNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETSPDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEANQEGSDMREQEKNIWTASQIMKAEMERWMDRELRLGPEKNAILPTDDKNKIMISVRKQIEIQTKIQNAKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 7 homolog
publication title Oncometabolite 2-hydroxyglutarate is a competitive inhibitor of alpha-ketoglutarate-dependent dioxygenases
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 148
structure length 483
sequence length 515
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3purA03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3purA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3purA01
5FV3A 5D1MB 3DQVR 2Q8CA 4AI9A 2Q8DA 4S3OC 2VPBA 2KGIA 2BAYA 1HYJA 4R7EA 4X3GA 2LXHC 5LKZA 4YATA 4XI1A 1DVPA 2M3HA 2JMJA 5FZ8A 2FSAA 4D6SA 3QZVA 2OX0A 3PUQA 4WZ0A 3MHSA 2ECJA 2MIQA 4NN2A 4FO9A 3RVHA 1MM3A 5FZMA 4AYCA 2H0DB 4CCKA 4IGQA 5A80A 2YQMA 1CHCA 2UZGA 5F3EA 4XDOA 4LKAA 4LLBA 2VP7A 3U78A 3GV4A 5FYSA 3I2DA 3RPGC 5F3CA 5IVCA 5F39A 1HYIA 4UP0A 4Y4RA 3U5MA 2XB1A 3HCTA 3PHDA 2I50A 2HYED 4YAXA 5LY1A 2LDRA 2YUCA 5H1UA 2PNXA 2LGLA 4QX8A 2XUEA 4UF0B 5EYAF 2F6NA 1MM2A 5A3TA 2L0BA 5ISLA 5IW0A 5FYTA 5A7WA 5G0FA 2OXQC 4QX7A 4R2YA 2MD7B 2L5UA 5FXXA 3SOUA 4WA6A 3ZVZB 3N9NA 1WEVA 2YT5A 4LADB 4IGPA 3OPTA 5FUPA 5CEHA 2F42A 2F6JA 4GB0A 4V3LC 3K3OA 4LIUA 4QXHA 2E6SA 5C11A 1V87A 4YBMA 2LV9A 2RI7A 5FPLA 3MHHA 1WEMA 3M63A 2MD8C 5FPUA 1WILA 3L1ZB 2XEUA 2YU4A 4L7XA 5D1KB 4LK9A 4ASKA 5FZ7A 2M85A 2Y43A 4AP4A 2JMDA 4CCGX 5F3GA 4N4FA 1Z6UA 3O37A 2L80A 2ZETC 5A1FA 2VJEA 5FP8A 5IWFA 1WEPA 2YHNA 2WWJA 3ZLIA 3N9PA 2GP3A 2FUIA 4QF3A 5FYCA 3N9LA 5FYZA 4CSWA 5G05B 5F2SA 5FPVA 5KH3A 5K4LA 5FYHA 2YSMA 3AVRA 4A4BA 5IVYA 4CCNA 2KWJA 2CT2A 3KVAA 1ZBDB 4CCJA 2MT5A 5I3LA 2AN6A 4CCMA 5DKAA 4QU1A 3KV5A 1WEWA 1N87A 1X4JA 4BHWA 2OT7A 2YURA 1VFYA 5FPBA 3N9OA 4P5OB 2YBKA 3SOWA 4UF0A 5FYBA 5H9MA 1WIMA 2EGPA 2PXJA 1E4UA 2VPEA 5LKUA 4O64A 2MNZA 5FY4A 4PTBA 2D8SA 5FPAA 3T6RA 1U6GB 4D6QA 5A1LA 3L1XA 5F32A 4QWNA 2JMIA 5G04B 3L11A 4XDPA 2MA6A 1JM7A 3O7AA 4I7DA 4Y3OA 2IDAA 5FZ0A 5FYUA 2ECTA 4S3OB 5FWJA 5B76A 3PU8A 2LGGA 4EYUA 5LWBA 5LW9A 1K2FA 5LKTA 4BISA 5D1LB 2ECGA 3KVBA 4BU2A 5FZBA 2NAAA 2E6RA 2CSZA 5LCWB 1FBVA 2EA6A 3ZYQA 2EODA 2KIZA 3M62A 5FUNA 5FP3A 2KWKA 4F52B 2MA5A 3UYJA 3VK6A 5FBJA 3LD8A 5DINA 4WZ3B 4FK5A 4YC9A 5F3IA 4N3WA 3N9MA 3PDQA 5FZEA 4EZ4A 2CKLB 2KFTA 3U5NA 3RPGB 5J3XA 5A7SA 4A0CD 4R8PK 5FZ4A 4GNEA 2KGGA 4URAA 1X4IA 4CUGA 1RMDA 2RSDA 2VJFB 3KQIA 2CSYA 3HCSA 2P5BA 5FWEA 4MVTA 2XMLA 2VPGA 2YHOA 2YW8A 3ZPOA 2YU1A 2ECVA 5FZIA 5FJHA 5TBNA 1WEEA 3LQIA 5FY7A 2VD7A 4V3KC 4A49A 4QXBA 4E4HA 3V43A 5FXWA 4UI9B 3PU3A 4MSXA 5FY1A 5IVBA 2FUUA 2LRIC 5FZ9A 3HTKC 2L75A 3ZPVE 5IVEA 3O35A 2XXZA 5FEYA 1F62A 2QIZA 5IVFA 4YBTA 2HDPA 3KNVA 4YBSA 3OPWA 2Y1NA 3IHPA 2C2LA 2G43A 2YU2A 2K1JA 1IYMA 2ECNA 3HCUA 3RTRB 2H0DA 4GNFA 5B8DA 4QXCA 2WWUA 2LXPC 4AYCB 4FIPA 5FZOB 4ZDTA 3U4SA 3AVSA 4L58A 5TDRA 4GNDA 3C6WA 4UP5A 4GNGA 5A3PA 4Q6FA 1JOCA 5FZ1A 4D6RA 5FP4A 2ECIA 5FXZA 4A4CA 1WENA 4IC3A 5IVVA 3N9QA 2Y1MA 4NUBA 5IVJA 5FYVA 5F5CA 2YREA 3PUAA 2K16A 1WEOA 2VJFA 3LRQA 2VNFA 5A7WB 4I7BA 4HONA 5KH9A 5C13A 1Z2QA 3LDBA 5FXVA 4B86C 5FZCA 3ZVYA 4LJNA 2JRJA 4AVXA 2YBPA 5F37A 2GP5A 3PTRB 2MUMA 4TN7A 5AIUA 1WFKA 3ZTGA 5ANQA 3AL5A 3EB6A 3U5PA 4GAZA 3DPLR 4BXFA 2G45A 2OQ6A 2KR4A 2KWNA 5FZDA 5LKXA 5F5AA 2LQ6A 2M1RA 4ZUXU 4B7YC 5TRBA 2KYUA 3KV6A 5F2WA 5LY2A 5FP9A 2YYRA 2YSJA 4V2VA 2VJEB 1VD4A 5FY5A 4C9ZA 5FP7A 1T1HA 2QJ0A 4DIQA 5A3NA 5FZLA 3O70A 3K2OA 5FZKA 5FZOA 3LQHA 5FB1A 3NJYA 5FYYA 1LDKC 3DXUA 3M99A 5FZFA 5B77A 2KREA 3K3NA 1WESA 3SOXA 5A3WA 5JG6A 5E6HA 2ECWA 3DXTA 1WEUA 4GJYA 2KWOA 1VYXA 2KE1A 4C8DA 2MNYA 4I7CA 5B75A 4DO0A 4WZ2A 1G25A 5A7PA 5AITA 3O34A 1LDJB 5H1TA 1WEQA 2M6MA 3PURA 5B78A 4LITA 2DX8A 3NG2A 3O36A 2OS2A 2L43A 4PPEA 3SHBA 3KV9A 1XWHA 5A7NA 4Y33A 5FY0A 4AAPA 2QICA 5FZ6A 1BORA 4YADA 1JM7B 3EB5A 4CA1A 5FY8A 2Q8EA 1WE9A 3U5OA 1Z60A 5FJKA 1WGMA 2K4DA 2LGVA 3PUSA 5FZGA 4BBQA 4FJCA 5FYMA 4LXLA 3ZNIA 5A7QA 2YQLA 4CCOA 5TABA 4TKPB 3FL2A 4EZHA 5FY9A 4GJZA 3LQJA 5KR7A 2LGKA 2W2IA 2YBSA 3KV4A 1X4UA 5A7OA 4ZQLA 4LIVA 3ZPV1 5TDWA 1FP0A 5F5IA 5FZHA 2C2VS 1VRBA 3AL6A 2CKLA 2PUYA 3ASLA 4IGOA 4W4UA 3O33A 2VPDA 2LN0A 5B79A 2OQ7A 3GL6A 4QF2A 2K17A 4V2WA 5FZAA 5FZ3A 5H1VA 5FERA 5KH7A 2G6QA 2YPDA 4AUQB 4CCLA 4IC2A 2KU3A 4HOOA 5FYIA 5FB0A 3C5KA 2XDVA 3T7LA 4GD4A 4YABA
chains in the Genus database with same CATH superfamily
3UUXB 3RZGA 4PK5A 1ASJ2 2R071 2DCJA 1QDOA 3MO4A 2IIUA 2BG9C 4CU8A 1AR62 1HXS1 4AYCA 2W62A 5FL1A 1EYBA 1L7RA 4UFHA 4XDOA 4IV1B 2WL1A 1ZBE1 4CP9A 4E8CA 4ARYA 2PQQA 5JRCB 5LG3A 4BB3A 2JIWA 2WS3A 1XC6A 4BQ3A 4UF0B 1COV3 4L0RA 4IDQA 1VR3A 2ACXA 3O47A 3EHZA 5FO9B 1U12A 1WCRA 3CIRA 3ZVZB 2WMNA 1K45A 4ORFA 1SBDA 5FUPA 5JI7A 2XTLA 4Q4W3 2RI7A 4Z1VA 1HJFA 5L2LA 4X1YE 4YNIA 2KNDA 3CL1A 1N47A 1CR7A 4EWAA 2ZPXA 2J4GA 1WEPA 4WM7C 1WW7A 2BVVA 1R083 3ZM8A 4PLOA 4CCNA 1RUC2 4YGCA 5AQNB 2XWBB 1OA3A 1HX6A 3OPZA 3RG0A 2BG9E 2LROA 1X4JA 4WVMB 4ILCA 4EWDA 3N9OA 4LE3A 2PXJA 1VCSA 3C64A 1W9SA 2WFPA 4A7KA 1LULA 3FBZA 4BMBA 4IW3A 2YC2A 4QWNA 4CUAA 1GQEA 3ZJ1A 3R6SA 1W0BA 3VKFC 4I4TE 2VW1A 1BYHA 3KM5A 2ECTA 2O8QA 4AFCA 3PU8A 2WR9A 4LE4A 1UMIA 4AKRB 4YPJA 1LOAA 3WW1A 1BLZA 2XQ9A 2FMYA 5CVRA 5LCWB 2HWD2 2EODA 5FUNA 1N32T 4YVSA 3AYAA 5A3LA 1GZCA 3KMHA 1RGSA 1WGPA 3T08A 3C7FA 4R8PK 1IBLT 5DQWA 2KR2A 1X4IA 1DF0A 2GK9A 3P50A 1UZZA 2EAAA 2YU1A 2UXDT 2V8SV 3O1PA 3LQIA 1XE0A 3EMRA 1PGSA 2WN3A 3Q9OA 2W95A 1S2KA 1DZQA 4LO8A 3D5OA 5CA6A 1JZ5A 1NCRB 3NRXA 2OLTA 5FY1A 2GALA 3TN91 2FUUA 2VZRA 3AB3B 3ZYBA 1X33A 2MYSA 3B9IA 4F6RC 5JH7E 4L8QA 1RHI3 2JE8A 3ZYGA 1K5MB 3DPRB 1CPNA 4Q4Y2 4H9NC 1GOFA 5GLTA 1H4HA 2HPLA 1G9CA 4IEXA 2BBJA 3VKNA 1IPSA 4I43B 4A6SA 3T9KA 2VB6A 3TB0A 4IC3A 4PIYA 2VL8A 1AR63 3LBXA 2WZR1 3AEFA 4EYYR 2EIDA 1KNRA 1U5ZA 1T98A 4FPJA 3ZFFC 4A5XA 1KDMA 1GU3A 3JD72 3H8RA 1RMU2 2VAUA 3MFAA 5C8CB 3LJCA 3U5PA 2DURA 4NHXA 3INAA 5CG9A 2NWBA 4QKDA 5L73A 4IE0A 4JKKA 1OOPA 1RXGA 4CDWA 4PJYA 2A1XA 4QQ4A 3EABA 4PNIA 4JHTA 2IUBA 4KNCA 2J22A 1EAH1 4UFIA 2AYHA 1YI9A 4WZ2A 1OSGA 1H1AA 3ZYPA 2UWCA 1KDKA 3HN1A 1T7SA 3NG2A 2EVXA 4N43B 4AEKA 1D0YA 3MZKB 1UZ0A 5T5OA 5IUXA 5JXIA 4ET7A 3ZMTB 5JPMB 3AKRA 1M62A 2DVFA 3RYKA 1JUIA 3EB5A 1C5IA 5J36A 1WE9A 2LGVA 4DXSA 2E2AA 2ES3A 1NCQC 3BOWA 1HN1A 1XXNA 3D0JA 4TXWA 4X6QB 4AOCA 4CN1A 3KS7A 2LM2A 4CCOA 4B29A 3FAOA 4GJZA 3C7HA 2LSJA 4Q4X2 1VBD2 3VBFB 3N35A 3S5AA 2BWCA 4JDOA 1Z0HA 2A9UA 2RJ2A 2Y8DA 4Y5TA 5CU1A 2ORZA 4YFZA 4HFBA 3UFGA 2Y6JA 4JI4T 2MHFA 3IN9A 3RZLA 2HWD3 2VR4A 2A6ZA 1POV0 4C91A 2K48A 1SZBA 4OUMA 2I2SA 5D1MB 1QKQA 3AMPA 1TME1 2LT3A 2Q8DA 1D1AA 2VVEA 1WMFA 2W46A 1DVPA 3R0RA 3KLSA 3S4UA 5L3FB 2CEAA 2A3WA 4NE9A 4Y24A 3KGZA 2DJAA 2W5FA 1MM3A 2YQMA 2HWE2 1CAUA 2ACZA 3GJAA 2VP7A 4AQ6A 1IS4A 4RS5C 2QQNA 5L19A 4HANA 4UFKA 5LGTB 2VL0A 3W15B 3P5BA 4UP0A 3FBLA 2NZ9A 2BS3A 2XR4A 2WNVB 1O6UA 3LKJA 3OGGA 5HXVA 4JAAA 4Q4Y3 2F6NA 1H8TC 3AE1A 1MR5A 1HN0A 4PI2A 1E2AA 5I0UA 2HWB1 5LXTE 3VDDC 2WQ4A 2VTFA 4AQFC 3E1F1 1H30A 1MMNA 4AKLA 2WO2A 4CP1A 1UO9A 2BUKA 5D1KB 3W59A 5CGMA 4LK9A 2BNOA 1XNQT 1WMDA 5FO7B 3EYPA 2JDYA 4NIHA 3T3YA 2L80A 1LEDA 1WBFA 4UW5A 4YW4A 4DV2T 5FYZA 4YSFA 3WF4A 3ZMZB 5KH3A 3LDQB 2ZM6T 1RMU3 1MZEA 1I9RA 2BS2A 1MS4A 4H9PC 1Y01A 3W58A 3ZXLA 1X9TA 3VR8A 4HE8A 1GQHA 2D3PA 2OT7A 3VBRB 1YO8A 1TMF1 2CV6A 3SHRA 1ZBA1 1NWMX 2CM0A 3AXJB 3A0NA 2YDSA 5T5LA 1U6GB 1A78A 2JE9A 4H14A 1OLQA 3TYJA 2JMIA 3MLKA 1XSQA 4AHZA 2WLQA 2E9XD 5TSWA 4B7EA 3AA0B 4BOWA 5SVIB 4TYSA 2I74A 1LTEA 4O2BE 4CI1B 4XC9A 2EGMA 2WQZC 1JUHA 1RUJ2 3UFEA 4FXKB 1W6MB 3MV11 1TNFA 4YC9A 4OGCA 2J62A 4N3WA 1CZSA 4FJOA 4MGTA 1UF2C 3RPGB 3NV4A 2LSGA 2FCTA 2KGGA 4IESA 2RSDA 2F4VT 1R64A 3AFGA 3MGUA 1HW5A 5FWEA 2W39A 4Q4X3 1ULEA 2VPGA 2YHOA 1VBD3 2YW8A 1TEIA 3OPCA 1JHJA 4ILBA 3H1YA 5DQ0A 4U36A 4P0AA 1WYCA 4IV3B 4OQ8A 2YDEA 3LFMA 1ZZ7A 4K3UA 1NENA 3QUJA 2SPCA 3RZJA 5IVEA 4BIOA 3WF3A 2HEYF 4KGQA 5JSPA 2V6YA 2CMRA 1XYNA 1QDCA 4NUUA 4IEQA 3U4SA 4OULA 3TBDA 2VOWA 4NRQA 3DTOA 1AF9A 3R84B 1NT0A 2Y1MA 1TVGA 1QHDA 2Y6GA 1XNDA 3F2ZA 2PHTA 1WEOA 4XBFB 4DOUA 3WEZA 3ZXAC 4B86C 3I97A 4QX7B 4XHXA 4SLIA 4PLNA 3G06A 1WMEA 4QXHB 1UOJA 2FDJA 1F31A 5KXBA 2YUEA 3V65A 2PN5A 3S7EA 5I0SA 2OQ6A 4WBNE 2KYUA 5FP9A 3HBKA 2VJEB 4UVBB 4FP3A 2E7AA 4BMEA 2ID4A 3R4UA 3FEHA 4BQYA 1BMV1 3SOXA 3HBZA 1C4RA 4A3XA 1OT5A 1W6OB 4RYDA 5EPAA 5HI0A 2W87A 2W1UA 4XFBA 1PO11 2JMHA 3ZSJA 2BOIA 2W61A 5E1RA 1QJU3 1OLMA 5LBEA 5H1TA 3ZOIA 2Q9QB 3P4PA 2H3RA 5IK8A 1RUH1 1AR73 1REFA 4PPEA 3ETQA 4YT0A 1XWHA 2CHHA 4Y33A 4CDQC 3C7OA 1U5XA 3M3OA 4H2AA 4AIUA 1V6MA 2DU1A 1OUSA 4BA6A 4YVSC 1JMUB 2A5ZA 2CWOA 3J7HA 2YQLA 1MQTB 3OYWB 2VQ0A 5FVLA 4LFAT 1VPHA 2OPWA 2IVIB 3ILFA 1X4UA 4ZQLA 2OW4A 5C3PA 4JI0T 3LK3B 3I8TA 3SLIA 2C2VS 2WQ8A 3NWIA 2D43A 1XRUA 4BM8A 4QF2A 4P5YA 2WB5A 4V2WA 5F8PA 1RUJ3 4A97A 5FERA 4Y1UA 2NM1A 3AEEA 5BR8T 2ORXA 3C4ZA 2QQKA 2GSYA 1CIYA 3T7LA 2WU5A 3ZDSA 4LHLA 2WYFA 3TKLB 2DBNA 5DJQC 4QXBB 2BVLA 5DAQA 2QZ3A 1VRH2 4LF8T 2JMJA 1QOTA 2OX0A 5FMCA 2CWMA 2XSBA 3RVHA 5FLHA 2WCAA 3VHRA 3ACLA 2W0XA 4ADZA 2HHHT 3MLLA 1US3A 2LW8A 1Y9QA 1T2XA 3I2DA 3ILNA 1FV2A 4NO4A 2WFF1 1OFSA 1PVXA 4XZCA 4FOWA 2IVJA 5EK2A 3W5MA 1QF3A 1CZTA 2UUAT 1AZDA 1WD4A 4XUOA 4Z0OA 3POIA 3BK9A 4XXPA 1S0FA 5FBZA 5IW0A 2MD7B 4Z92B 5BV6A 2E7TA 1VJ2A 2E5VA 4IGPA 4Y22A 3KHCA 1O5LA 1YQ2A 4RFRB 3L09A 1QOSA 1AR91 4NHMA 3L1ZB 4XW3A 4IQPA 5DG2A 3BIWE 4AP4A 3AEDA 1OOPC 5FOJB 4QB2A 4CDWC 5CAZA 5BNPA 4PDWA 5A1FA 1KEYA 2XONA 2BKNA 2K9ZA 4QF3A 3MIBA 2HEWF 3DYPA 3NV2A 4GQ7A 5G05B 1E7PA 2WZPP 3JZVA 3SFDA 1WLXA 1D0HA 4A98A 5I3LA 3MPPG 4KBMB 5A3UA 4LLOA 4L9IA 4ATFA 4HFVA 3WDWA 1UUSA 4HFCA 3LA3A 1HX8A 4U2AA 4TNVA 3Q1DA 5FRAA 1RUNA 4UFJA 2A6YA 3A22A 3ZX7A 4CCDA 1IG3A 2X8KA 5FY4A 3LEGA 5HEOA 1ULCA 5M4YA 2WT2A 4HN1A 1NZCA 4Q27A 3JADA 2JKXA 3LZZA 4QXKA 2Y6FA 2ZEYA 3OKQA 2AE9A 4PI0A 3T4VA 4EN7B 2EA6A 1SQ4A 4C90A 5LHGB 4Q0SA 1GANA 5LJNA 1XNRT 2V4AA 4FFHA 4OI0A 3RMYA 1YKHB 5C71A 4B1LA 4D7YA 1W9TA 4H63V 3KF3A 1ONAA 4GKXA 4NVPA 3ZPOA 1H2MA 2WT0A 2AUYA 4DNYA 2B76A 2CE7A 5SVYA 4UI9B 4FOVA 1COV1 4CN4A 3EB7A 3ABVA 4HVRA 2KXLA 5IVFA 2A73B 3M3CA 2QQMA 3GF6A 2GNTA 2X05A 2IWGB 3WDUA 2R30A 1YIFA 2G0UA 3FLPA 3CPZA 4RHV3 1YFWA 1VRH3 2HWF2 5JR9A 3ENRA 3WX5A 1DU2A 2JDNA 3OBTA 3CZUA 4LKFA 4B6XA 4WW0A 1JTZX 3U0ZA 5CJ5A 2BZBA 3M7AA 4W65A 1NYWA 2ZMNA 5LBMA 1R081 3KT1A 4A6OA 4Y26A 1Q8SA 3QOPA 4I30A 1PGL1 3R6NA 4YG0A 4O61A 4JTNA 5AFUL 4MZUA 3DCQA 3RWNA 2JPFA 4LUKA 1QU0A 2QJVA 3MIGA 1X8MA 4EN8B 1YXWA 1ZZCA 4GAZA 4BDVB 2G45A 4QGLA 3CNAA 4TV9E 2J1SA 4ZUXU 4B7YC 4QMAA 4ZI2C 3KV6A 5J09A 3UUMA 2NOXA 3BU0A 2GMMA 3K2OA 3RF1A 5E88A 1IS3A 2R6GF 3RMXA 2Q1ZB 4LBLA 2D7FA 1AJKA 3PDYA 3S5QA 4A3ZA 2D5UA 5E0OA 4RFT0 3L8RA 4OI2A 1KFYA 2KWIB 1XBFA 5IJRA 2MNYA 1PGW1 5B75A 1HV0A 2VZTA 1XMOT 5J98B 3RYRA 1HX1B 1U5YA 5L47A 4GB31 1W28A 3RZMA 5LBQB 2WUHA 1VBC3 1YJLA 4LHNA 5DPNA 1JNZA 3AE7A 1J1TA 3LF7A 3MIEA 5C4WA 5IK5A 2FDGA 4LXLA 4O7XA 2QRXA 5FMDA 1A8DA 4M0NA 5C8WA 1IZ3A 3U11A 2YZ4A 3ETUA 1AJOA 5KR7A 4ZI7E 3B01A 2W2IA 5LA2A 3KV4A 3WNKA 2ZACA 3ZPV1 1UNBA 3I0OA 5F5IA 4JGZA 1FOD2 4IGOA 3O33A 2ATFA 2OQ7A 1RHI1 3VDCA 1LU2A 1Y7BA 3VZNA 1CUNA 4META 4IEVA 3NNFA 5K9YA 3D82A 5KH7A 1F35A 2X68A 1S0CA 2BBHA 2PHDA 2CAVA 1J1LA 2XJPA 5B4NA 2E9QA 3ZSSA 3C5KA 3FJSA 2XDVA 4KP3C 4CEYA 1OA2A 2D6PA 3ES4A 3WAKA 4YYOA 1CESA 1HNZT 5SVXA 3TEXA 3OBAA 4B4RA 3AXDA 3IZOA 1KS5A 1UPSA 2HYKA 2WDVA 4QD2A 2MIQA 2XH6A 4NN2A 4B3ST 3H42B 3QH6A 4WVVA 3MBWA 2JE7A 4IDNA 1MZ5A 5BPXA 1XB9A 3OUJA 5EXOA 3FHIB 1X7NA 3HCTA 3M8LA 4DPNA 1EPZA 2O8OA 3EVYA 4M01A 4XE9A 3RPUA 3I9YA 2M6BA 1R1A2 2RS52 1MZFA 2HWC2 1JN2P 2ZGRA 3OYXA 1E5IA 1O3QA 2F17A 3NNGA 5JDQA 5FR3A 1WCQA 2ADDA 2WZEA 2W47A 3LVRE 2F4PA 1RUG3 3V0AA 3J9X1 3VZMA 4FPEA 4DUZT 5CA0E 4ANJA 4XFGA 1WCKA 3X29B 2PYTA 1O3RA 4DIDB 1CN1A 4UEMA 1W3XA 4XJAA 2Y64A 2B7YA 3T1LA 3P6BA 3THDA 5FK7A 5FYCA 2D44A 4CE8A 4CDUA 4IIJE 3AVRA 4O8SA 3ORJA 4A4BA 2V26A 1K12A 4C0HA 2DYCA 3I2JA 2CT2A 4AFBA 3C8XA 1ZP0A 5DQVA 5L7OB 3VHLA 4BA9A 2E6VA 4CYDA 5AC92 2RMU2 2PHRA 3K4ZA 5C33A 1UU4A 4KBBA 1KNPA 5H9MA 2YY1A 3WP3A 4YTPA 1FPN1 2VPEA 2ENRA 3WP4A 4LO5B 3NL1A 2WDQA 3ZFGA 1CPMA 1G9BA 2ZGLA 4Y3OA 4KQ7A 4LBQB 4QQHA 4DV5T 4IEYA 5FWJA 1GWKA 1L3JA 4JI7T 5LKTA 4BISA 2Q4SA 3M62A 5J96B 4F52B 3IT8A 3UYJA 3T09A 4XABA 4KHZF 3ZDVA 4Q2FA 3N9MA 3OTOT 2JB8A 1N34T 5A7SA 1ZM1A 5DDJ3 3CVRA 3J8F1 1QJX2 5F6LB 1QQP2 1ZKEA 1VBB1 4HZFA 2PHXA 4J2CA 5B2GB 3B13A 3ZKRA 4XUTA 5FNVE 1ND2B 1J83A 1FOD3 4F83A 1OLME 3CWZB 3S6PA 3V43A 3KQRA 2P3YA 3NNMA 3JB8A 5IK7A 3KBTA 3VD7A 4Q4Y1 2XJSA 1F62A 2A2FX 3SKJE 1IG0A 2C2LA 3ZMOA 3BUCA 2ECNA 1YUDA 4QAWA 4NIAA 1X79A 5ABJB 4X64T 1RVF3 4OMCA 4FIPA 3GZTB 3WAJA 4L58A 2VUJA 5KHGA 3UV9A 4GNGA 5JRCA 3OB8A 3VZOA 5HCAA 1JOCA 4IHJE 3ELNA 2IAKA 1SHWB 3ATGA 4NHKA 2Y0OA 3V0BA 1VBE2 4CPBA 4I02A 4BQ4A 1DIWA 3ZIWA 1H9PA 4I7BA 1RMU1 2W94A 3OUIA 4LMJA 1J3PA 1YYNA 4LEJA 2GP5A 3PTRB 5BNPC 4PDWC 4TN7A 1LVFA 1LKXA 2GN3A 4HWDA 1X36A 2RS53 2HWC3 2X5IA 2XQAA 3I3QA 5GZEA 5HEGA 4JCKA 5D2AA 1UURA 2OV9A 3TEWA 1UCUA 2ZMLA 4CP0A 2C0ZA 5FKBA 4IERA 4FBFA 4FPLA 3RKOA 4ZEYA 2YV8A 3RQ0A 5AQQB 3E6BA 3M99A 3IA3A 1HRV1 1WESA 1X82A 4KWLA 5A3WA 3O1VA 3BOPA 5JG6A 4XIKA 1VYXA 2KE1A 2UUCT 1QH7A 3ME2A 2NP9A 3POSA 5AITA 5E89A 3IF8B 2DFCA 4Z2WA 1ULGA 5JZGB 3FHAA 4G9SB 1ZX5A 3O1JA 4P09A 2X53S 2DVBA 4HGAA 1S2BA 3I4IA 3UJOA 3NRUA 5AC93 5FY0A 4CU9A 1J58A 3P3PA 3M7KA 2KD7A 1UYYA 1IJ6A 5FZGA 4B7KA 4TWDA 1SBEA 5JXJA 4Y20A 3B57A 3E5XA 3BQLA 2C9AA 5FY9A 4CI3B 4AKIA 4U33A 1QSDA 1QY4A 4AFDA 4Z82A 1HJGA 2QA7A 4QDRA 3U10A 1C1FA 2IC9A 1UCXA 4A41A 4N53C 3RYCE 4W4ZA 3N2OA 3TLUA 4I0BA 4CCLA 5FB0A 2HPJA 1LHUA 1POV1 4HSJA 5ABEA 2Y60A 2YXSA 4S2FA 1AXYA 3M70A 3LEMA 2KGIA 5KXCA 2WZIA 5EIYB 1DQ5A 2EHOB 1UKGA 3RDIA 1QJX3 4YZ4A 3JC6D 1L7QA 3LSDA 5C3OA 3THCA 1QJEA 2ZCWA 3VHPA 4WZ0A 2GNBA 3OY8B 5JR9C 4MLOA 3I49A 2P3KA 4UBGA 3U78A 4AI0A 5CKQA 3U1XA 1OEDB 1XMQT 3PHDA 1N3PA 1CX1A 2QKDA 1W8WA 3WG1A 4DB5A 1MM2A 3I59A 4CXYA 5J2UE 4LF7T 1N3OA 2OXQC 2FJBA 3HVDA 5FXXA 4KWJA 1OUXA 3LWCA 3GDBA 5D21A 2F6JA 4EN9B 1POQA 1RJ8A 1WEMA 3LIHA 3TEYA 2QYWA 4JI8T 1KD7A 1WWYA 3K51A 3B5LB 1QJU1 3FHQA 4JGYA 4CVUA 1IKQA 1M7KA 4KU7A 4A2UA 1AR71 2Z5WA 5IUQA 4QKNA 3WR0A 2XVKA 3TN92 2JG8B 2XKPA 3PUYF 1E5SA 5FKYA 5IVYA 1VAKA 3AYCA 5GALA 5JIAA 4E2QA 1SCRA 2GZWA 4PLMA 2C5JA 2ZM8A 2AXDS 1PMJX 1V70A 4QH4A 4YSXA 2N9DA 5L9VA 4MX3A 2VUCA 1BK0A 3SOWA 3LIGA 2FDIA 2OYZA 3SMHA 4F1PA 2LLYA 5HPOA 2VBDA 4NN0A 4MGKE 5C9AA 4N43A 1QGLA 5C4WC 1A34A 4X66T 1W9YA 1AYN1 4K20A 3PTYA 4BIFA 3C3VA 4XDPA 5L3EB 2FDHA 4EAHA 4MGSA 4E4SA 3NRYA 5HEUA 1RUJ1 3AJZA 5LWBA 2W52A 2RM21 1YQ3A 2FFWA 2JMKA 3EDVA 2KXPB 4JGZC 3GCWA 5T55A 1URXA 1ZV4X 3APBA 4P08A 3PIGA 4OFGA 3CU7A 4PQQA 2MA5A 4XHBA 4L9BA 4AAXA 4FK5A 2YB7A 5LCYA 3E6CC 1BJQA 4E8DA 4Y1YA 2JD4A 3AYDA 4R9CA 5JOWA 3BYWA 1JYIA 4X8PA 4EEBA 2Y33A 2FDKA 2CWSA 2LHNA 2WSVA 4CEYC 1OHFA 1KFUL 2FCUA 5FKCA 1EAH2 3ZXKA 3TLTA 5FXWA 1R8IA 1PK6B 3F57A 4DMIA 5LB6A 2SBAA 2LSYA 4TNWA 4UOJA 3DL3A 4XBNA 3UESA 3C2UA 5FZOB 3VBOA 4OYKA 3IWZA 4WM7B 1VAMA 4UP5A 1XYPA 3GBGA 2XUMA 3KGLA 3C7GA 4XIOA 4IEPA 5LATA 5C5UA 1N3QA 2CHOA 1RUE1 3ACIA 4IDOA 2Y6HA 4NROA 1I6XA 2VMCA 4COVA 3H8OA 1BVP1 2VOVA 3PVBB 5LB7B 5LBFA 3ZVYA 1ZREA 2LOPA 2X0HA 2B46X 2DHRA 3AE6A 3AE9A 5LK5A 5HEHA 2VH9A 4A7ZA 3PV0F 2X9WA 4CDUC 1Z78A 2E61A 4P9XA 1TME2 5LY2A 5L4HA 2CNAA 3MIHA 2MBGA 3FX3A 2V7LA 3JQWA 5B77A 4X8NA 2IXHA 3HR0A 4UELA 1CAWB 3B9CA 2CXLA 1NQJA 4DBQA 4JI3T 3VBRA 4KH9A 3RGLA 4I55E 1YD8G 1AXKA 3VKMA 3O34A 3ZFGC 1UY3A 1U5IA 1MIVA 3KT7A 1BKZA 1D2SA 3KV9A 1AX1A 2W1WA 5EYYA 5A7NA 2QICA 5FZ6A 1BORA 4XF9A 4CA1A 3C98B 3AC0A 3I3EA 3U5OA 5A33A 1FMD2 4XF4A 1HLCA 2HWB2 5LBBA 4PIZA 3ZNIA 1WA6X 1W8TA 4MXWA 1W8OA 2I59A 3FWEA 1W6NA 3LCPA 4P1NA 2FHRA 2BQPA 2Y26A 4FPKA 4LIVA 2XJQA 2ZGUA 3ZMSB 4XFAA 4IREA 2XQ6A 2D5FA 2VZUA 1I94T 4YFSA 4YW6A 3VKHA 4R4XA 2VG9A 1CJDA 4YW7A 3VD3A 2VVSA 5LG4A 2XB6C 2KU3A 2XJVA 4RHV1 2Y48B 4I0WB 1VRH1 4P9YA 2JD9A 2LM9A 1V6NA 4TLFA 4YY3T 2VPBA 5I8YA 1W3VA 1ZBA2 2UWBA 3T30A 4WZCA 1SE7A 3G6JB 3ZFFB 4AEMA 4HTEA 4D6SA 4DR4T 2D93A 4H9DA 3I2FA 2VTXA 3T8OA 2NMNA 1EAH3 1UOGA 4QH5A 1OVPA 1H1MA 1CHCA 1OD3A 3WT3A 3VHNA 4QQPA 3KBUA 2WY2A 4XZUG 2CSVA 4NAOA 4YFWA 4YAXA 5H1UA 1W99A 4QX8A 4QH1A 3WQ7A 4DV7T 2A70A 3USUB 4HG6B 1ULFA 2DBIA 4GWNA 4QX7A 4KG0A 1W8UA 2X5IC 4HWCA 5L36A 1WEVA 4YW3A 4ZU7A 1JW6A 4QXHA 1UY1A 1F2NA 5L3CB 2OZ6A 2XEUA 1KRIA 3VBUB 1YNAA 3FZKB 4L99A 3BTZA 2VJEA 5IWFA 2BEOA 4QX1A 4YM1A 4NJ4A 2N1GA 1NCQB 1VBC1 5F2SA 2VZPA 5A32A 4M3CF 4FQ4A 4AVCA 5GM0A 1BCXA 3AKPA 2DL1A 1XNTA 2WBKA 4CCMA 1OPOA 1AYM3 3QCWA 1N87A 1RYYA 1UIJA 1F9KA 5J48A 3CMLA 5FYBA 2Q9QA 2D3SA 4BXSV 5TAOA 2A6VA 3WD5A 1N36T 4QGNA 3FUQA 3Q5WA 4A45A 2XGXA 1ULPA 3POEA 1LB2A 4BJMA 4B3TT 3BPZA 1LOGA 3FN9A 3M1HA 5JDGA 3H50A 1JU4A 1QXJA 1UX5A 4ZPIA 1XDPA 4IXLA 1NG0A 4EYUA 1D4VB 1MQTA 3OYWA 4RQPB 4M00A 2ODVA 3SOLA 2MTQA 2BV4A 3A7MA 1HB3A 2LALA 2FBEA 1V00A 3VL9A 1FMD3 2VE1A 4RS5B 2VZSA 3UKVA 5JR2A 4CUGA 2KM2A 2WRAA 4HL0A 3WP6A 5FMOL 4PJLA 2GC3A 4LLFA 1S0JA 2C4XA 1SMVA 3SEEA 1A8MA 5C8YE 2YEVC 4V3KC 1IBKT 4QXBA 3QACA 4OHWA 1KJRA 1APNA 1PO12 3AFKA 2CTVA 1DGWA 2ARCA 3VDDB 2XG3A 3NSTA 2WAAA 4QX2A 3PUIA 1JBCA 3K1SA 2XXZA 3HEIA 3UJQA 2WNUA 5DUWA 2QIZA 1RUH2 1GP4A 3OOXA 2G43A 2OA5A 1XSRA 1RUG1 3H37A 3RWKX 1W9FA 3ZCJA 3J4UH 3PMSA 3AVSA 1VE0A 3WXPA 4GNDA 1N1YA 1G9FA 1UQXA 3CMGA 2RJKA 1NY71 4FTBA 5FP4A 3V5SA 1B35A 3R4DB 2BKOA 2YINA 1FX5A 3AK0A 5JDBA 1WRDA 1S55A 5JIUA 4LT5A 4QPWA 1D0GA 1FJGT 3E2DA 5DUXA 1SACA 4GWMA 3OEAA 2VJFA 1S0EA 4LMFA 5LOVE 2ERFA 4HWIB 1NXD1 3OVUA 4AQGA 1PHMA 1BEV2 3L2YA 4JGYC 2JIGA 4MGQA 2MUMA 3MDBC 3L9JT 2J42A 3J7LA 3ACFA 3EB6A 4F8HA 2CPTA 3O0VA 2QUOA 2X0YA 4YGDA 5HCJA 5FZDA 4NIIA 5LK7B 2OIIA 2QQIA 4Y5Z0 1WW4A 1PZ7A 4PK6A 3WW2A 3T2TA 1YQ5A 3IM0A 5HXRA 3TOJA 2NLRA 5C3JA 3A4UA 5AFBA 2E8IA 1H1IA 1LHOA 2DUQA 5C9AC 4N43C 3EAMA 3AE4A 4YLHA 4K21A 3KFWX 2V7IA 3TNPB 1WR0A 5B78A 5D8AA 2WFF2 4HWHA 4DUYT 4AAPA 5DDJ1 3A8YC 3P4RA 4GIQA 3RPQA 4NIDA 3AMMA 2WINB 3A5XA 3WQ1A 4GMP0 5SV5A 3FZFB 4WM8A 4YTMA 2QQOA 5JXGA 2BPA2 2OUJA 2BU9A 3AKSA 3PJAJ 2XPJA 1FOD1 1MVQA 2Y34A 4EV6A 4CP9B 3W9AA 4HKOA 1RUI3 3PMEA 4UAPA 1E5HA 5DAXA 1FP0A 5JREA 4UV8B 2P57A 2LKHA 1RVF1 2XQ5A 1ODMA 5FMOS 4G3YC 1XQNA 2B9UA 4XUNA 2Y0IA 2QTWB 1JH5A 1HFAA 1S1AA 1C3HA 1O3SA 2D3RA 4QU2A 4DUVA 4DXTA 1VP6A 3VBOC 3WHTA 2CGPA 2D6KA 2AREA 1X9BA 4GWIA 5A6XA 5KC5A 4PBOA 4XEZA 3Q8AA 2UZGA 2B8MA 4FI5A 4UFLA 1GZWB 1PO13 1GFF2 1DGLA 2RS51 1W9RA 2HWC1 1HYIA 1OI6A 3BB6A 1HRI3 4Y1XA 2W4XA 4EV0A 3L39A 2JDZA 4HN9A 2GH2A 2R49A 2YG0A 1M06G 1XDOA 3IMMA 3CDZB 1DG6A 5C5TA 1YFUA 2DCZA 5LEKA 3RRCA 4XQWA 5JLVA 5KX5E 2A72A 3NQHA 2XM1A 2ZOEB 1VMHA 3HQUA 4L7XA 4MHRA 3VUOA 2M85A 3WQBA 4I01A 4FTSA 2NP0A 4CDQB 2C6SA 3RZKA 1BEV3 2H0BA 5FPVA 3LQCA 4EOZB 3AE3A 3VBRC 3T1MA 3S57A 3TNQA 2D5HA 2JG9B 1QXPA 3LB9A 3P4WA 2D6MA 4BZ4A 5DKAA 5CFBA 3O9XA 4BQ1A 2KKYA 3PUVF 2VMHA 2VQAA 3T1YT 4OCTA 2ZEZA 4BQXA 3RX6A 2XAHB 3VN4A 3L2HA 3MZHA 5F32A 4JDNA 4O2AE 4QPGC 4AHXA 4C0BA 1O8PA 3OYZA 2IDAA 1W90A 1GYKA 3MIDA 2JQQA 3GM8A 2LRKA 3SWHA 3IHRA 4L97A 3JBG1 4PHZA 2XJ7A 2YC4A 1FBVA 2VQUA 5DZEA 2FJAA 1J3RA 5IK4A 1QJX1 5ADXL 5F3IA 5H9QA 3MIFA 1C1LA 5HYAA 3PJQA 2VMFA 2VVDA 2VJXA 4AEDA 5CIRA 4HFHA 1QOOA 3HAGA 1XOYA 4GMP3 4CUBA 3O1UA 3WCRA 3H1MA 4XCBA 2ZAAA 1WEEA 2BZDA 2VUAA 1D1BA 4ISRA 4HVQA 1MNEA 3N2KE 1PGW2 4W8JA 5IVBA 3WW4A 5FZ9A 1GR3A 3BCWA 4GB32 1ZRDA 1XWMA 2Y6KA 2ZGPA 3AE5A 1DGWX 3VU7H 4K1YA 1OOPB 4O62A 2MOZA 4W6XA 3ZN1B 2VCCA 1UGOA 4CDWB 3DJBA 5L9RA 5GZCA 5ETWA 2J1EA 4X1IE 3PJAA 1UZVA 2BVMA 2PFWA 3QNUA 2KA3A 5IVVA 3LEKA 4YVWA 5FYVA 4IEOA 3ONXA 4I3PA 1QJZA 4JC1A 3BODA 2CBIA 4ITCA 3I9WA 2VNFA 5JDLA 4Y1VA 1VIWB 1C8NA 5BNNB 4LJNA 1RHI2 3JCFA 4P02B 4AVXA 1Q8QA 2XOZA 3SS1A 2GC2A 4O9EA 5BNQA 1QWRA 2B5HA 4ZKTB 3GN5A 3U14A 1OBNA 4AR2A 4AK3A 2KR4A 2KWNA 4GK5E 3FBYA 1V6OA 4LMKA 2DTYA 3IKWA 3VB9A 3FZ3A 5FY5A 2KT9A 2QJ0A 2CLYC 3ZEFB 2NW9A 1T6BX 5FZLA 2VGDA 5A3NA 3IEEA 2GN7A 5FB1A 2C9KA 1LAJA 2HH7A 5JDNA 2J1UA 5L7OA 2DSMA 2Q9QC 3DEMA 2LM3A 2ZXQA 5CISA 4XMAA 5GZDA 2ECWA 3UK9A 5DAPA 1HQWA 5AQOB 5KDMC 1LNSA 5FMBA 1OQDA 4PT6A 2W9XA 3UQ4A 4GYSA 4KBZA 2CL2A 4YM3A 3O36A 5T3NA 2L43A 1MQTC 5CYYA 3E0ZA 5EWSA 2XLFA 4LBQA 4FI9A 4EIWA 3AMHA 3PUSA 3LPFA 3LSVA 5FYMA 3URFA 1W0PA 3MF9A 4HKLA 3NVOA 1C57A 2IXIA 4EWEA 1CAUB 4BK5A 4ZS3A 2DCFA 4YJ3E 2LRPA 3O14A 2P4EA 4XUQA 2BYVE 1UY4A 4WZFA 1S0DA 5IAXA 2J1TA 3CO2A 1OF3A 1PO22 2VPDA 1PNGA 2M13A 5JTGA 2QQJA 2W92A 2VQFT 4YSZA 4UIGA 1ND2A 4PJJA 3TLWA 5KC6A 2R0FA 2WNUC 5J2TE 2ZBJA 3CKDA 2VZ1A 2DFBA 2L3LA 2B42B 3P4SA 1HNWT 2RS31 1QUUA 1FPN2 3F2EA 2M3HA 2JJ9A 1JI6A 3FJUB 1VAVA 1K3IA 2WKKA 4LK7A 3N4MA 1GSLA 4HKAA 4GULA 5ABJA 1ALYA 2NTXA 4GIWA 1B35C 2DCKA 1AX2A 2ZHMA 2EXUA 2PLV2 5K0UC 4UW3A 4NRPA 2I50A 2O1QA 4GB33 1SA0E 1PNFA 3ZVXA 2PNXA 3QC9A 2BP6A 2LGLA 2VK9A 1MS3A 5H9SA 4H63H 4LFCT 3RIUC 2J1AA 3LDYA 1BR1A 2JECA 1QH6A 4R2YA 1Z7S1 5CKMA 4YRDA 1BVVA 3DGTA 5CEHA 4GB0A 2JRKA 3J8F2 2XPKA 1VBB2 5CG8A 3AKTA 1WILA 4LA3A 4Q8KA 1DZTA 3T2QA 3Q9DA 2G9ZA 2EXHA 3SCHA 3ZLIA 3E6DA 4BLJA 1LENA 2BOJA 4IE7A 2YSMA 1D0ZA 3UT0A 4YGEA 1DCQA 2PAMA 3AEBA 1HR0T 5F6KA 2G19A 3VBSC 3LG7A 1MMAA 4YZ3A 1W06A 4QU1A 5D8AC 2R061 1VFYA 2VY0A 4CN6A 3OTFA 4E27A 2OZJA 1XNKA 3MXZA 4J1XA 1Q8PA 2D97A 2ZAHA 4NR1A 2Q8OA 3WHUA 1G86A 3AJYA 4JI2T 4LO4B 5DUVA 5G04B 1BZWA 4WM8C 3L11A 5F1RA 4ZU4A 1LHNA 3WDTA 2IMLA 2V6YB 3S0MA 5AVAA 5F3JA 4S2GA 2LKGA 4B3RT 1AX0A 2NAAA 2R041 4FXGB 5JOZA 4FFFA 4E2GA 1Y9MA 3N7LA 4X62T 1JOPA 3GHMA 4R9DA 5IHYA 3WSOA 1MZ6A 3WY6A 5IWAT 3D0TA 3GZEA 3B00A 4EZ4A 4XFHA 2CKLB 3U5NA 5D1IA 5L3DB 2IXCA 4CDXB 2D6LX 5A6YA 1SLBA 2A3DA 2P5BA 2CXFA 2D40A 4LF6T 3IMNA 3RIAA 2XAFB 2F4LA 5FZIA 2LSIA 1HRV2 3ZN6A 2R7EB 2VD7A 4XBQA 2ZEWA 1YLLA 4RA0A 4OQ9A 1T72A 1PO23 3PU3A 2B4KA 2YK0A 1UXXX 4RL7A 4GZ9A 2YROA 3GZUC 3HTKC 3M3QA 4AWDA 1IOAA 3I2HA 4YBSA 4BYYA 2K1JA 1YFYA 2XJUA 2JWPA 4PIXA 4CEWA 2XVGA 4BPZA 5F7UA 4TZ4C 1K42A 1OEDA 3I2GA 5A1AA 1L0VA 5J37A 4HEAA 4Q6FA 1FPN3 2OKXA 5BMVE 4E7SA 5CNAA 5FCCA 5DUUA 5HWXA 3HT2A 4CCEA 3MLJA 2K16A 4XAEA 2FUPA 2PLV3 4PF1A 2FQPA 4IGUA 3LDBA 3PVOA 4Q26A 3VDAA 4CTEA 5CFCB 1ENSA 2XP0A 1NX9A 1AYM1 1C28A 2RG4A 1JU3A 3OD0A 2YDQA 3WF1A 4BXFA 2W2UA 2A3XA 3NKGA 4W50A 3RKGA 5A3MA 5FMNA 4P0BA 2VVFA 5E8AA 2JG8A 1S35A 3PVNA 1UAIA 4YM2A 4XF1A 3J8F3 4AHWA 2VMGA 1VBB3 3DXUA 4LA2A 4AGRA 4Q0VA 2LOSA 1Z8UA 3GMIA 2IXJA 4DS0A 2KWOA 1QIQA 3ANWA 1OQ1A 4XYXA 1J5ET 1UN1A 1E1HB 2ARXA 2E32A 4IL9A 1SUMB 4CU6A 1FMD1 4IEUA 3F31A 2R1DA 5F5QA 5HCBA 4U74A 4W6YA 4CPBD 2RR4A 3I54A 3MW3A 4PJNA 2AEZA 1OLRA 3GHNA 1GZ9A 2CDPA 3UUNA 3LGRA 2VQET 4TKPB 2N7GA 4JTOA 5AQJB 4AI1A 1OF4A 4TSVA 3R05A 1YHFA 1QJU2 3H3UA 4L0PA 3ZKUA 4AEDC 2QQLA 1C8M2 3JC6C 1AR72 1KFXL 2VC9A 2K17A 5ABFA 2E51A 1CWPA 2G6QA 2C5DA 3LFIA 4UWDA 3BIEA 1HTJF 1JYCA 3H9AA 5A6QA 3C4WA 3A21A 3IAPA 5EV7A 4YABA 1PK6A 1IKPA 2BAYA 1I5PA 1W2UA 2G1MA 5LKZA 4Z90A 4XI1A 4ARXA 3TLSA 1GNZA 4QKFA 1CHUA 3JAEA 5BNPB 2LSKA 4PDWB 2XQYA 1ZOYA 1HRV3 4FPHA 2RHPA 2ARAA 1AYN2 2H0DB 4WBOA 1H9WA 4CCKA 1ND3A 4QXCB 1LOBA 3ROUA 4YVWC 4LKAA 3AZZA 3KQ4B 2Z79A 3SRZA 4MBQA 2RM22 2IZWA 2DUPA 4AQYT 3H7YA 3ZJ2A 2ZJCA 1HS7A 1J5WA 1OKOA 3UNPA 3M4FA 2WWSA 2HLEA 4XBLA 1DP0A 4TUYE 4LBMA 4RGAA 4L5GA 1LODA 5JOXA 3O0XA 2ET7A 5DN2A 5AQKB 2X10A 5BYNA 3FLTA 1NXMA 4KGGA 1V87A 1EZ3A 4GOUA 3OBVE 2MD8C 2BGOA 4Y1ZA 3IDAA 1ZRFA 2JDHA 1KS4A 2JDKA 3ESLA 2D0UA 3O37A 3LA7A 4FT8A 2ZETC 2NPIA 2RJLA 3WUDA 5L7OC 3LOIA 4NMIA 3IBMA 5DMYA 1CIWA 1DQ1A 4AVAA 4COWA 3KVAA 1DBNA 4V1Av 2YVRA 1POV3 4H9QC 1GQPA 1D2QA 2QFEA 4XAAA 2YBKA 1J1JA 4ISSA 3UU8A 4ES8A 3MHZA 1HDKA 1RUI1 3ZN4A 4N53B 2MNZA 5EK4A 3L1XA 1RUE2 3VRAA 3ZFEB 2UY8A 4CA9A 2UU8A 4EQVA 4JKMA 2V5DA 2VMDA 3M3IA 4NPPA 3KD4A 5D1LB 4I50E 3QH7A 1DDLA 3J26N 5B4XA 1L7LA 5CKNA 3T0BA 5JR9B 3NKTA 2XWJB 3LD8A 3NW4A 1ZNPA 4LBJA 1UZYA 5FZEA 2MPFA 5LHIB 1MNDA 1ND2C 3RC3A 1UX7A 1RMDA 1W6QA 2ZABA 2I6HA 4MVTA 2ZZQA 4XJUA 4IDPA 3PUGA 3JB4C 2H6BA 4EB6E 5FJHA 2QE3A 1C8M3 1HRI1 3VHOA 4I0UA 3FL7A 4A49A 3VBHB 1FXZA 1LGBA 1JNRA 5CFDA 5DG1A 4Q0QA 4K0KT 4AKGA 4DUWA 3E5QA 3P4QA 2PAEA 3KNVA 3IHPA 1Y4WA 1IYMA 3RTRB 2UWAA 2ARBA 1W0AA 2LXPC 3IIAA 1NA1B 4QPIA 3U3IA 5ANNA 2DUOA 1US2A 2UU9T 3T4HB 3QD6A 3ZT6A 5FXZA 5BXXA 2B0OE 2PBIA 3WNNA 3N9QA 2GH8A 5HXMA 5F5CA 1AYN3 3T2OA 1EV12 1NAEA 1BEV1 3USUA 4X20E 2E5LT 2P6HA 1G8XA 1W9WA 3UKNA 3QB5K 1U4QA 3N36A 3AZWA 2WABA 2RM23 1G73A 1YQCA 4GH4B 1O3TA 1HB1A 3ITQA 5C4WB 3MICA 3VBUA 3GNEA 2X9YA 5BUVA 4RHV2 5F5AA 2Y38A 3WCSA 4MXVA 4XQDA 4C9ZA 1UXZA 2K0GA 4HWFA 4M3CB 4DINB 3NJYA 4O4JE 4JGZB 4YGBA 4DMWA 3CJIA 3H8UA 2B39A 1U0AA 1LCLA 1ENRA 2HEVF 4GJYA 3MF6A 5JMOA 5CA1E 2X51A 2G4IA 3AAEB 3GALA 1YKEB 1SPPB 4AG4A 4CEYB 3KSCA 1CAVA 3D4KA 5I0RA 2XAGB 2WU2A 5GLVA 4Q25A 2H88A 1JM7B 2BW8A 3NJXA 4EE2A 1Z60A 3UKTA 4URTA 4RQPA 4GMP1 1HQLA 1MMDA 5KHJA 4DY3A 5EP9A 1GOGA 1JZ7A 4TZDA 1W2NA 4U2ZA 5LCWL 1RUE3 1S4CA 4YM0A 3JXSA 3FZMB 2LRLA 4XCAA 3PIJA 2RPAA 4ZOLE 2P17A 2ZKNA 3PLQA 1ZA7A 3ZSKA 4OHVA 2MEV3 1VBC2 4FP2A 4F3JA 4OZXA 4ZONA 5FYIA 5FUIA 1N33T 1SLAA 3V0AB 4WV8A 3FC0A 3J7MA 4Q1RA 3O1OA 2XJTA 4AI9A 4S3OC 2OXBA 4QX0A 3VDDA 2NQYA 2PTFA 4Q4V2 1HYJA 2V7JA 4CEWC 4G4FA 4Q29A 4DR1T 1PZ9A 3HR9A 5GLWA 1OEDC 4HKWA 4BJNA 4YHHT 1DLLA 4FO9A 1GP5A 4DRVA 2ET1A 1ZRRA 4XOGA 5A80A 3AAIA 4DR2T 2YMZA 2K24A 1WW6A 5F3CA 2VOXA 2EALA 3AP7A 2NMOA 3O1HA 4YLZA 3HWJA 1WYBA 2XQ7A 2E7QA 1UZWA 5KXEA 1QJFA 1WFDA 1QJY2 5AQVB 3JCIA 4YG6A 5H9PA 3BQIA 2IFWA 5AQPB 1WLCA 4HK9A 4GK0E 4LIUA 2JQHA 3S7IA 2ZA9A 1PMHX 5ERLA 3M63A 5FPUA 2YKSA 3O7OA 4ASKA 1EV13 2E31A 4E4ZA 2JMDA 4GKJT 3RJ2X 4N4FA 4JQTA 5A6ZA 4AL9A 4M1PA 5FP8A 3K75B 2CRRA 1EPWA 4TV8E 2ZHKA 4IL4A 1Y64B 3AMNA 3J9SA 1P8JA 2KSRA 3RFRA 1LGCA 3BGAA 2E53A 1S0GA 1UX6A 4H3WA 2ZM0A 2Z6EA 4PK4A 1RUG2 5F5WA 1Y43B 1OEDE 2VNGA 3PVEA 2VURA 4HVOA 2QBXA 2FDFA 3CQOA 2EGPA 3NAPB 1NY72 1E4UA 2WA3A 1IZNB 1F8VA 4PTBA 5FPAA 4D69A 4XETA 4JKLA 4TTGA 4QGMA 2ZGTA 1ST8A 3WNPA 1WMXA 2J1DG 3Q8FA 3FXDB 3MJXA 2CWYA 1F4HA 3CJXA 2LEHA 2EF6A 4P9IA 3KVBA 2JQKA 4BU2A 4OGEA 1SFPA 3SKVA 5LASA 2YN6A 4BQ5A 5C3QA 1JXNA 3V0BB 2BNNA 3CBNA 2KFTA 3J7Yq 1MIWA 3ZYLA 3NWKA 4YXDA 3CHXA 1PK6C 1SDDB 1ENQA 2MAWA 4DR6T 5APAA 4LKDA 3CQCB 4FAHA 3VKGA 4TN7B 2X5IB 1S0IA 2UXNB 1ND3C 2XBO3 1VMJA 1STMA 4NRMA 5LMUT 4JVAA 4U2YA 4N7UA 3LDRA 3R4SA 2Q9QD 5ABHA 5CZKA 5DDJ2 2FZ1A 2W91A 1GZWA 4LBNA 4WZXA 1XU1A 4Q4V3 2W63A 2M6IA 4NXMT 5IT6A 4KX6A 4BQ2A 2KZ7B 4H9SE 2XHNA 3N7MA 2RDRA 2E9XB 1MS0A 1PVC1 3CKHA 1ZZ9A 3ZXDA 1RJ7A 3ZMVB 1GKBA 5FOBB 5I91A 3B93A 4U72A 5C13A 5KH9A 5FXVA 1XJAA 1IAPA 1OH3A 3HMYA 5HEJA 2XOCA 4A44A 4X6RB 5C70A 1RVF2 4AVVA 3DF0A 1QJY3 4M4PA 4EN6B 1JZ2A 4GALA 3C51A 2YPJA 4CDQA 1E57A 2WS91 4Y20B 2RDSA 5F2WA 1CQ9A 4V2VA 3POYA 1W2OA 3H3AA 5C7GA 2W66A 3S30A 5FZKA 4MALA 5HAXA 2JG9A 2KREA 3O1MA 5HBAA 1GWLA 2CONA 3ZCIA 5E6HA 4RR3B 4LR4A 2XQXA 1WCDJ 3O1SA 3NMBA 2DWRA 3VR9A 3UGGA 4LITA 4AW7A 2C1FA 3EXUA 3I2OA 4F8AA 4H7MA 3PE0A 2XZEA 2PHLA 4JZRA 4ILUA 3H1WA 2Q5TA 4IEWA 3EUHA 4KHPT 3KT4A 5FY8A 5AFEA 3VLBB 3AP4A 1LECA 1B7TA 1R1ZA 4EN0A 1A3KA 5A7QA 4L11A 1ASJ3 3LSEA 3WG3A 4BHPA 5GLZA 1PO21 5JDFA 1NLSA 2UUBT 3KCYA 3K4AA 5HV0A 2UY9A 3CK6A 4LBOA 3I2IA 2OUHA 2UXBT 1GV9A 2NW8A 2I0MA 3I59B 2XASB 1BBT1 3U37A 2AR6A 4IE5A 4PAGA 4Z0RA 4FCAA 5CFDC 4AUQB 4C1XA 4DXRA 1BQPA 3RLFF 5FV3A 3VD5A 2K2SA 2V7MA 3RQWA 1K5JA 1BR4A 3WP5A 1XZYA 1IBMT 2VCMA 1W6PA 2FJDA 4YATA 4MGIE 5FPZA 5GKAC 4BQWA 4JGYB 3VGIA 4QPIC 5JI9A 2PTMA 2WMOA 1FIOA 3GBFA 2PLV1 3WINE 2ECJA 3RYPA 4KUMB 2R0HA 3K77A 1SG3A 4GYRA 5J1GA 2EXJA 4OHYA 4YG3A 4LLBA 5FYSA 4G2AA 1HV1A 3NBXX 1N1SA 3HT1A 2K3WA 2XB1A 5BY5A 5LY1A 3W20A 1D0XA 2EICA 3JBG2 4NHYA 1ZHCA 4MGZE 3RYFE 2XSAA 1RUC3 5JVDE 5G0FA 5C9AB 4NPLA 3MW2A 4TLGA 5BNNA 2L5UA 3SOUA 3P8CD 3VBUC 4LADB 4J6GA 4YJ2E 4X65T 2OA2A 5T54A 4YBMA 4UV9B 4TWHA 3MV01 4IT4A 2VOTA 4X5TA 2PHUA 3CJIC 5FIXA 4XFCA 5KMGP 2R32A 2D9DA 3KWVA 4MLKA 3TEZA 1OMIA 2BBVA 2DWKA 1SEFA 1J84A 5C6CA 1ZZBA 4IV1A 2DTWA 1ZBDB 3NVCA 2AN6A 1V6JA 4NAMA 2ZKLA 4B1MA 1CGPA 4E4DX 4QM9A 4ZZ5A 3KV5A 4UF0A 3AZVA 2CHNA 4MGYE 5LKUA 4Y4YA 4RQPC 1NEKA 3OF1A 3E08A 4JQRA 4I7DA 4R52A 5FZ0A 4P14A 5EHDA 3HKEE 2PG8A 4LQRA 2QNKA 3ZC1A 5FZBA 4S2DA 3VBOB 2CSZA 4NOTA 2ZZJA 3VV1A 4G63A 5FK8A 5JR7B 2ETEA 2KWKA 2D8UA 4WZ3B 5JUVA 4S2HA 1LOFA 3DKQA 2UYAA 1TQ5A 3PDQA 3G7DA 4B3MT 1AL21 3OGVA 5J3XA 5T50A 1SDWA 1SLLA 3RS6A 2H6CA 4WVMA 5I8SA 4XF0A 4OUEA 3NJVA 3V64A 1UYZA 4IE4A 1KXGA 4YTNA 4EROA 2HBUA 3GCXA 1GP6A 4O9GA 1ZRIA 2J1RA 3OJAA 3IDBB 2W0GA 2LRIC 4YSYA 3ZN0B 1W0NA 3WQ0A 5K8SA 2HDPA 3OPWA 2YU2A 5EFUA 2IC1A 3F95A 2RVAA 4UFMA 3JD73 1H4GA 4GNFA 2WWUA 1LOEA 4ZDTA 1XNAA 2AZ5A 4Z2AA 5TDRA 4XTMA 4QT6A 3H8XA 4PQ9A 5CB4E 3O1RA 2XM2A 5LJMA 1H2KA 1MS5A 4D6RA 3POGA 3M2MA 3Q8CA 1D1CA 2L8KA 2VZOA 3PUZF 1VMFA 5DZGA 3LRQA 4MOAA 5A7WB 4HONA 4FOQA 1PMIA 4XMIA 2WP9A 4ZY9A 2QVAA 5F37A 4D7SA 3JUEA 5EZYE 4HPKB 1NCRA 3JBG3 5A33B 2WAUA 2YC0A 3DPLR 1F5FA 2QQPA 4QPGB 4MXWB 4DEVA 5TRBA 1W6NB 1YQ8A 4Q1PA 1K5MA 3DPRA 4CXXA 4DIQA 4FAGA 2RS32 5G05L 1FNYA 1NE4A 2ZX0A 4FFGA 4COFA 2Z2SB 3A23A 3O4XE 1IJ5A 1XE7A 4CRQA 3IB3A 2BWAA 4QDQA 2IFRA 3NV3A 3GGLA 1FYUA 1IPJA 2JB4A 3DECA 1JODA 1HKDA 4XPVA 5K3QA 1I1EA 3EO6A 3SC7X 2DU0A 1RUD2 5AQHB 5C8CA 3LDKA 1Z7S2 2D0TA 4IL7A 3U07A 3FZLB 2AC1A 4HXCA 4WNKA 2A71A 1C8M1 3FL2A 4XJZA 3CQGB 1WUVA 3LVQE 3POJA 3W21A 1RTVA 1O8SA 1AR81 1VRBA 4KL1A 2CKLA 4QX8B 2EXKA 4ISTA 4CDXA 5BNOB 4NWWA 1W03A 2FMDA 3DP7A 4OI4A 2HWE3 3O12A 2XL9A 2QQWA 3WF0A 1V6KA 3AEGA 2WWVA 1I3HA 3KINB 3AP9A 1IS6A 2YGMA 3LK42 2FZ2A 2MPKA 4K6BA 4OZOA 3ON7A 5CADA 3KHBA 2AENA 2XHKA 4GD4A 3C50A 2JDMA 3B69A 1RL3A 4D3WA 2R062 2H89A 3SISA 1VLNA 2W1QA 4UI9L 4R7EA 4X3GA 4JEHB 3AZYA 4OMDA 1S94A 2AH2A 4XQ4A 3QZVA 3MHSA 2IC6A 5FLIA 5CBLA 4EGWA 1ACCA 1V9U2 5FZMA 4OK0A 2CXDA 5F3EA 3RI5A 5A32B 2XY8B 1FV3A 4COUA 2CGNA 2PAKA 3DKWA 5JXHA 2BG9B 3WI3A 3VBFA 1OC1A 1R092 5F39A 3HOBA 3B7MA 2CLYB 3U5MA 4AKHA 4LBQD 2QVSB 1NOVA 4X1KE 5FPXA 1Y3TA 2R042 1DGRN 2JQ9A 2LAUA 2A75A 5A3TA 5K7PA 5SV8A 5FLJA 3IDCB 4QHBA 1VBA1 1RITA 5CFCA 3ZXFA 5KHHA 2C24A 3SEPA 5ACA1 4V3LC 1DQ2A 3ZR6A 2IQJA 3SH5A 4LHSA 3FMGA 4GKYA 3N5LA 2GC1A 2XKOA 3HA4A 3VZLA 2XOYA 5AQSB 2JG9C 3T0DA 1XNBA 3N9PA 2O0OA 2FUIA 5T52A 1G8WA 1WA4A 3W5NA 1DCSA 4ONUA 2KINB 5FYHA 1JYNA 4Q8LA 2KWJA 2BRTA 3H0OA 4AXPA 1FMVA 1LU1A 4AVTA 2W68A 2V5YA 1VALA 1E5RA 3MUZ1 2WNVA 1ZZ8A 5HV4A 2RDNA 2YURA 1Y9GA 4P5OB 1VCTA 4MYEA 3UU4A 3NZQA 2RS33 2YHJA 1RUF1 5AQGB 3X1DA 2QQUA 4MG2A 3N2GE 4JUYA 5IYZE 3NZPA 2GNDA 2L9LA 4GWJA 3LE0A 5HXHA 2MEV1 1HB2A 2WNUB 4K8FA 3EHKA 4QQLA 1UYPA 1LESA 2Q1MA 4FSJA 2R1BA 2HN1A 1O59A 3MPBA 4NPRA 4I0AA 1AYM2 5I8TA 1NE6A 3UULA 1KNZA 5DINA 1B35B 1RUD3 1W8FA 1Z7S3 5K0UB 3SH4A 5LZ6A 3ABZA 1RINA 5LA1A 2CDOA 4URAA 3D3AA 2VJFB 1DFQA 3KQIA 3LK2B 3HCSA 1VB2A 3MI8A 2Q1FA 2BFUL 3HN3A 1YFXA 1LHVA 3UT5E 1T6GC 4XAXB 4ZHQE 4KMCA 2EIGA 3AXJA 1NKGA 2A3YA 1Z0PA 4YW2A 3M3EA 3TLVA 2WO1A 2L75A 2JKBA 5JCTA 1S2EA 4U7YA 4JV4A 2BVBA 1MEC1 2PHFA 2VKOA 3HI2A 4LF5T 3ECQA 5SVIA 4BCUA 2H0DA 4O4HE 5B8DA 1GZTA 4QXCA 4ZI3C 5HXCA 2R063 5I0TA 3SCFA 3QBQA 2VZQA 3WUCA 1CAXB 2RR12 4LKSA 2XAQB 2D98A 2FCVA 1W6MA 1EV11 2VM9A 4BAYB 4ZXKA 5BNNC 2WLPA 5EZWA 2HN2A 2RDQA 3IPVB 2YREA 1JYTA 1V9U3 3VBSB 5HCMA 3L3PA 5D8AB 2L9QA 1W0OA 1R093 5FZCA 1UMZA 4P9WA 1PM7A 3LOBA 3ILRA 4HK8A 4AI2A 4IV3A 4CXWA 2R043 2D6NA 5ANQA 1O4YA 5A70A 2JENA 2RS11 2EXIA 2ZMAA 4DMVA 2RA1A 4WM8B 3HNBM 3KZ4C 4TX5A 1WLDA 1YC61 4IV1C 5LHHB 5LYJE 3UUBA 5L9BA 3ZMNA 2YSJA 2C5KT 5HWYA 3I0QA 3P1IA 3JAFA 2ZGMA 4DV3T 2W08A 2HH9A 1OXZA 3WDVA 3WF2A 2OWAA 1LDKC 2EHOD 5JDMA 3BTAA 3RI8A 2K46A 1G9DA 5AQUB 1MS8A 4FTEA 3DXTA 1WKYA 4AHYA 5A3OA 4M4RA 1HNXT 5KXDA 1HIXA 5A7PA 1JOJA 1WEQA 3BKZA 3PURA 3O0WA 4N53A 5HXEA 3AE2A 2DX8A 3RI9A 1V9DA 4U3CA 3SHBA 4R8HA 2WYSA 3ZFEA 1YJKA 1XYOA 2Q0AA 4YADA 3CZJA 4BWOA 2P37A 1WGMA 2FJEA 2H0VA 5J0ZA 1KK7A 3MFCA 5AQRB 1LOFC 3Q5DA 4Q4W1 1NUKA 5TABA 2B9VA 4O65A 4N7IA 2ZX3A 1GBGA 1WD3A 1WLWA 2ZMKA 2TUNA 5AQTB 3U75A 4DV6T 4AF9A 4XVHA 4PFOA 4P9GA 2DVGA 2XBO1 3AP5A 1NLQA 4ASLA 5B79A 2C26A 3ZC0A 4AE2A 1W6OA 3SXWA 5H1VA 3OD4A 2W1SA 2E26A 2BFUS 3SFEA 5FDBA 4HOOA 4Q4V1 4LO6B 3VBHA 4PBPA 3RNSA 1UIKA 2WQYA 5LA9A 1BXHA 1GQGA 4B3NA 1W2AX 4BE3A 4OUSA 4P00B 1RUI2 2FSAA 1YRZA 4INDA 3PUQA 4P9LA 2P9BA 1H6YA 5FTTC 1NA1A 3VD9A 3P3NA 3OG2A 2LJLA 3D8CA 2FD4A 3H3MA 1LR5A 1QJY1 2VASA 4XZPA 2HYED 1Q8OA 2YUCA 2XUEA 5EYAF 3EI0A 3UU3A 3MYXA 1WLTA 1V6IA 3ZYRA 1NCRC 2RR13 4XURA 2VULA 2A6WA 1UD1A 2F42A 4YW1A 3K3OA 4GH4A 1RUOA 2F6BA 4HSLA 1H8TB 4YWAA 3ZYIB 2YU4A 4XDQA 1YWKA 3WDXA 1K5MC 1W04A 2Y43A 3DPRC 1YXRA 2WZHA 4A42A 2PQSA 1Z6UA 4GXLA 4LOSA 1HCIA 1HRI2 4M0HA 5I0DA 5C2TA 2IDOB 1GWMA 1REEA 3HPNA 4CSWA 4KWKA 4M3CA 2ZX1A 2I45A 4YZ2A 2VU9A 3N7JA 3OGJA 2MT5A 4NHLA 1PX4A 4Z07A 2ZGQA 4AEDB 4BHWA 1AL0G 3Q2MA 3CQXC 1ASJ1 1MACA 5FQ0B 1SPPA 4XILA 3BI3A 3LAGA 2ZX4A 4UXNB 1BR0A 5IFPA 4LMLA 5C8CC 4WBBA 4H9RC 4D6QA 3K4DA 1AR61 3VZKA 3RRWA 2ZGOA 1JM7A 3QOFA 1UY2A 5FYUA 5FO8B 4IE6A 2UURA 3PL0A 4QHOA 2LGGA 3VKOA 3HL6A 1MIYA 2VVNA 1H2LA 3HNMA 4RSUA 1Q3EA 3ZYQA 2KIZA 1RB8G 2KLQA 4YHJA 4CDXC 1X9PA 2X66A 2VZ3A 1KITA 3VK6A 2P34A 3H7HA 4FPYA 2H7OA 2Z69A 2JUNA 4LULA 2VBBA 4HFSA 1M4WA 3Q5XA 2V1DB 4YVWB 4LF4T 4B4PA 4E2SA 3AECA 4ISQA 4TWFA 4Z8BA 2XAJB 4A4AA 4H7LA 4QHZA 3RH3A 5L3BB 4LOTA 3UGHA 1ZYBA 2HWF3 3QK6A 1GOHA 3WZ1A 2IUWA 2WN2A 1PX3A 2CCQA 3GN5B 1C5HA 1WCSA 3ZPVE 3MEPA 3HD8B 4QQ2A 1RUC1 3BPSA 5FL0A 1OA4A 1OXCA 3O1TA 3VBFC 4JRLA 5HCFA 4AZZA 1JYXA 3WW3A 4AYCB 1SCSA 3AA1B 1V0AA 2BKPA 3HKCE 3C6WA 2WA4A 1SLCA 2EIEA 4JI6T 3I2KA 2ECIA 1SFYA 2WDRA 4LNVA 2ES0A 1N1VA 4K0UA 5CFCC 5GZFA 1OFNA 4A7YA 1QXRA 3I3DA 1Z2QA 3ZYKA 2NR4A 3ZT5A 2Y6XA 1FATA 2AACA 2BTVC 3P7IA 1VB4A 4BLIA 3PNAA 1WFKA 2KWHA 3UETA 4Z8XA 2WIIB 2HWD1 3BTXA 4KU8A 3ZSEA 2DVAA 3AEAA 3K48A 5IHRA 5JSOA 2VPVA 5FP7A 4KI0F 1UK5A 2WNVC 4ZS2A 1H7CA 1BHGA 2WO3A 2V72A 4PW8A 3ALQA 1AXZA 1ODNA 5AQMB 2OVUA 4JEUB 1MS9A 4R9AA 4DXZA 4RN5A 3UL2A 3K8PC 4AISA 1W39A 4DQAA 1DQ0A 1WEUA 4C8DA 3C7EA 4DO0A 1YQ6A 3RYHE 2JDPA 3NAPA 2M6MA 1BK1A 1A6CA 2CYFA 4I3GA 4FVVA 3PUWF 1QNYA 1AHSA 1OURA 3KF5A 4N9HA 1HQNA 3T0AA 4QWNB 2GMEA 3WNMA 2P2KA 2V7KA 3DYOA 5FJKA 5IFTA 2WNEA 1Q43A 1D4M2 2V5CA 4COZA 1OVSA 1CZVA 2CAUA 1CJPA 3IIIA 4EZHA 1IGOA 4XF3A 3GWHA 5AQIB 2LS6A 4K1ZA 4C1WA 4YVSB 4HFDA 2PELA 3ASLA 4ZHNA 2XLAA 1KF6A 3PJYA 4JLEA 1SFNA 3JD71 1LHWA 4UVAB 4UR9A 3WNLA 2WAOA 1LRHA 5J7MA 2XVLA 4AFAA 5AQFB 2GC0A 3MDPA 5LRRA 1R1A3 2GAUA 1PIV2 3VL8A 3BQKA 3AXEA 3ZKYA 2P6CA 1W09A 4FPCA 2XLGA 4EJRA 4AQSA 2LXHC 1EP0A 2ZHLA 1XU2A 3HNYM 1U5PA 1OWAA 5EK3A 2X67A 4HT1T 5IAVA 4NUVA 2R072 3AA6B 5KWRA 2WBLA 2BERA 3FE5A 3OGSA 1I5ZA 3RPGC 1HXS2 5IVCA 4K9SA 4JBWF 2E9XA 3NNJA 1ZBE2 4AYUA 4XXAA 4DV0T 3CX7B 2IW5B 2XL7A 4GKKT 1ULOA 2L0BA 5ISLA 4IV3C 3LBXB 3ZR5A 4Y5SA 4WA6A 1G6NA 2G9FA 3OPTA 2JX9A 1DLCA 3AM2A 2RMU3 3ASIA 5FPLA 1TE1B 3SCGA 3ETPA 4Q4X1 2W00A 1VBD1 3D0SA 4YZ1A 4CCGX 1CD3G 4LF9T 4K7JA 1T8BA 2AGSA 3CIHA 2A6XA 3EJKA 1RIRA 4J25A 4F7ZA 2QCSB 2VKJA 4L92A 2WWJA 3N9LA 3GZAA 4K40A 4LORA 1TG7A 3H7JA 2WM9A 2JICA 4CCJA 4JX0A 2XQ8A 5FAXA 1LRZA 4RR3A 3Q8BA 4OHXA 3EQEA 5FPBA 3UTKA 2BGCA 2GDFA 5KXJA 2W3JA 3ZFEC 3ZN6B 3KCXA 4OX9T 1YIPA 4KI5M 3AMQA 3HIFA 2P1BA 4QPYA 1PVC2 4AXOA 1KGYA 1QQP3 2IXLA 2MA6A 1NZIA 2ADEA 2HWE1 3A0KA 3B94A 4S3OB 2YYOA 4XFFA 4DZGA 5LW9A 4CEWB 3MA9A 3IDEA 3K46A 3ZYMA 2E33A 3AB0A 4N90A 3ZSMA 5FP3A 2PFVA 3ZSLA 3SH3A 5FBJA 2WS92 2LTNA 3ZO0B 2CU5A 1D4M3 2WJSA 4A0CD 3ZYJB 3FFQA 5FZ4A 1F5JA 2BJSA 3VBHC 2CSYA 5HXSA 3B02A 1W8NA 1YCIA 4I2OA 3WG2A 5EJZB 2GMPA 4EEDA 4I09A 2K5BB 5TBNA 1X8EA 3ZT7A 5FY7A 1VBE3 4JRAA 3Q5EA 2GU9A 4E4HA 4NIQA 2TEPA 5KHKA 3WV6A 1W2TA 4IUGA 3PLWA 1NA1C 1UX4A 1W8HA 2NYYA 3EBRA 2K9AA 3O35A 1EUTA 5FEYA 2XQRA 4J1WA 4MADA 2VECA 3HCUA 5DABA 4QB6A 3FLRA 1ZZ6A 4HBNA 1DHKB 2VXRA 1PIV3 2SLIA 4PF5A 1JZ8A 1ZEEA 2YOEA 3AYEA 3RIFA 2QDNA 3I3MA 4AI8A 5FZ1A 2NTYA 5EJ1B 4GA9A 1JS9A 3ANWB 4NUBA 1FNZA 5JAXA 2R073 4ATEA 3MK7C 3PUAA 3T1HT 4GH4C 1GUIA 4OFZA 2QQVA 1F4AA 3MKDA 5DXDA 1HXS3 4AQTA 1HF8A 1LVKA 5H6QB 3JUUA 2VTXJ 2JRJA 4PFPA 4BJ0A 1BBT2 2WZR2 3HKBE 1UOBA 3WNOA 4JI5T 1ZBE3 3QLQA 3LPGA 3ZTGA 3Q8EA 1PM4A 1UMHA 4BK4A 2VW0A 2Y8KA 3RZZA 3SITA 3OCPA 3CEWA 4DVDA 2GNMA 4N8MA 3VKLA 1DYKA 4RGGA 2VOKA 1OQEA 4XTPA 4AGGA 4ZXEA 1DYPA 4CZZB 3MW4A 3ZXEA 3HQXA 3B5MA 4XFIA 5H9RA 2PA7A 3E97A 4CU7A 5ABFB 4XJWA 1TNRA 2MNGA 4PCRA 1XNCA 4U7IA 4MSVA 1LDJB 2UXXB 2VW2A 3LJUX 3E22E 1EUUA 1G9AA 3BVCA 1RUD1 3RSJA 5GZGA 4OYUA 2DNXA 3A7QA 4DY5A 4B8EA 4EXTA 3NJZA 2DWGA 4NWVA 3NO8A 4WYVA 2R16A 1ND3B 2BDRA 2M67A 3AX4A 2LGKA 2X29A 1PVC3 4ASMB 5A7OA 2BGPA 3DV8A 4M3CE 3FM8C 3O1IA 2PUYA 2LN0A 1AUYA 3UU6A 3I7DA 2VZVA 2G9GA 2ZGNA 4LKEA 3TRSB 1O7FA 3UQ7A 4O4LE 1ZRCA 2TBVA 5JZGA 2WS93 3GA8A 1SLTA 1LJ7A 4FPGA 4DUXA 3DQVR 4COYA 5IYYA 3J7NA 4DFSA 2WSUA 3RJRA 2X0LB 1V9U1 5JOYA 2VQTA 2EIBA 3ONLC 1R091 2CRWA 4QM8A 1KEXA 4LFBT 2WDBA 3HJRA 4JYAT 4D94A 3GV4A 1FAYA 5JWPA 4YARA 1WBLA 1GICA 4AGVA 4HETA 3TN93 4HLTA 4FOYA 1UU6A 3NKZA 4UXAA 5A7WA 2KKXA 3FFZA 4QDSA 3OSDA 4QB1A 3N9NA 1AL22 2B45X 3AP6A 4AI3A 1FEWA 3DN7A 3GXUA 4HPKA 5C11A 4RGKA 3ZN5A 2LV9A 1RC6A 2PJQA 4OHFA 3CF6E 2C5IT 2DCYA 2EHOA 4QPGA 1JYVA 4W6WA 4AEJA 5EQUA 2CA5A 5HCHA 2ZEXA 1X50A 2GP3A 2VL4A 5JPNB 3OY8A 2JEMA 4CI2B 2I07B 1JYWA 4DR5T 4KWUA 1DGRA 1BBT3 2WZR3 5K4LA 4YW5A 1CX4A 4QX5A 2VMEA 3WDYA 3NAPC 4OLLA 3PHMA 1W6QB 1XE8A 3THPA 3OJBA 3KDEC 1H8VA 4ZXLA 2UXCT 1YI7A 3DWDA 1DYOA 4O64A 3ZYFA 3T6RA 1TMF2 5CFDB 3AKQA 2FD8A 1CONA 2UYBA 3ZXGA 3ZYHA 1WW5A 4ZI3D 1IQDC 2NW7A 2W67A 1UW8A 1MPXA 5T5PA 3DYMA 5FREA 1O3XA 1HG2A 4D0QA 4ZZ8A 3AE8A 1K2FA 2ECGA 4H9OC 2E6RA 4QPIB 5JMCA 5F9TA 2ZTNA 2V09A 5LGUB 1LGNA 1OPMA 1J3QA 4MFRA 4JV5T 1AJ3A 3WNXA 3BTYA 5LA6E 5ABGA 5BNOA 2VNVA 4O4IE 2DDUA 2BBAA 4HMZA 2J1VA 2DVDA 1YQ4A 4JI1T 3K3QC 1O5UA 2ECVA 4D8MA 3OGRA 3KCCA 2QGSA 2XQ4A 4NXNT 3TWIA 4MSXA 1QMJA 1IHMA 2DCTA 1DQ6A 1UPIA 4YZ5A 1IPKA 2J7MA 2RR11 4Q0UA 1KJLA 2E9XC 4JHZA 3CJIB 2BG9A 2VNRA 3ONJA 2XQ3A 5JDHA 1SLIA 1TME3 1UYXA 1KQRA 1IS5A 3ACHA 4DR3T 4A4CA 4Q5OA 2V4VA 4CUCA 3FUOA 5C3SA 5IVJA 2JDUA 2CGOA 4MH0E 3TAYA 4Q0PA 1ZVFA 2CY6A 1JHNA 5EYXA 1V6LA 5LNKA 2LUWA 3O5SA 4LTAA 2KMFA 1AR82 1CAVB 2ZHNA 2L7PA 1JZ6A 1JZ4A 1JOBA 1D7PM 3UU5A 4Y22B 3M65A 1ENXA 5AIUA 3EDUA 4AVBA 4XJ8A 5L4EA 5AQLB 1MMGA 5FFOC 1QLBA 3BALA 5LKXA 2LQ6A 2YGLA 4LHKA 3PUHA 2YYRA 2WSSV 1AL23 3FHNA 3VZJA 2VKDA 1H2NA 1LOCA 4KMQA 4UVCB 4V1PA 3OBZA 1N1TA 5H6RB 3CX6B 4OYJA 4AVSA 4RR3C 5FZOA 4MHUA 3LQHA 2ODUA 2HWB3 2Y6LA 3RYIE 4WM7A 5FZFA 2XJRA 3DUIA 2ZGKA 3ZXJA 1B09A 1MS1A 1YW0A 3ZIXA 3CX8B 2B1EA 4FPOB 1BMV2 4R9BA 3RQUA 4NPMA 5LA0A 1SHZC 3ETVA 5GONE 3MUY1 4WVZA 3ACGA 3I1AA 3BN6A 3M3ZB 4QQOA 3LA2A 4ZI2D 3OEBA 1UL9A 3ZSTA 4XUPA 2CBJA 1GLHA 4NIGA 5LGNB 4CQIA 2IXKA 4CZSA 2JDAA 4AQ2A 2VCAA 1RXFA 2Q8EA 2BDEA 2MKEA 2K4DA 2HBTA 1XPWA 1VBA2 2HWF1 2CRBA 4FFIA 5ACA2 4DBRA 2WZ8A 4AI6A 1O4ZA 1WCUA 3FANA 1DU3D 1TMF3 1NLRA 1ZBA3 2ZX2A 3IAQA 2VKHA 2PMWB 1JZ3A 2YDRA 1W05A 5K0UA 4UW4A 2VBPA 3ZPYA 4DRRA 1FI2A 3ES1A 3N7KA 1CAWA 2P3IA 4P9JA 2Z4FA 2XHEB 5I93A 4FQZA 5FZ3A 4N78D 5EJ3A 3NNLA 2P3JA 2J47A 4N9IA 3RIUA 3LEIA 3OBRA 4AFMA 2Q8CA 2V73A 1GMMA 1RUF2 5FZ8A 2JM3A 3FB2A 5LMNT 4HFIA 1J59A 5T5JA 2YFZA 2ZGSA 1FMWA 4LPLA 4IGQA 2MEV2 1UU5A 1CAXA 4UW6A 4B4QA 4MV2A 4QX3A 2N2NA 4ILAA 1VOMA 4ZZBA 4Y4RA 1DZRA 1HB4A 2CSGA 2V6XA 3I3BA 2LDRA 3IPVA 5KHIA 4DV1T 4OVEA 3VBSA 4JDMA 1MBMA 1O4TA 3SQOA 2AEYA 5FYTA 3RRDA 3RHWA 4CCCA 5GLUA 4DEQA 3U4XA 1OD5A 2YT5A 3THTA 4LK6A 3USSA 5J1XA 2E6SA 1GNYA 1UY0A 4RD7A 3MHHA 1ZA4A 3DDTA 4LJHA 5IATA 4K8RB 4ZU5A 5FZ7A 3T2PA 5F3GA 4ZZCA 5ABJC 3POBA 2HJIA 1Q8VA 2TNFA 3ZFFA 1AR92 2C0SA 1AR83 2YHNA 2ZM2A 1SBFA 4BH9A 2Z42A 5C3RA 2PHWA 2O14A 1MEC2 2RV9A 4OI1A 2QDRA 3C4XA 4HFEA 5J3UA 2OPKA 5JSRA 2VCBA 1WEWA 3FXEB 2E63A 5LBCA 2DF7A 1LKNA 2VO5A 1WIMA 2WNOA 1EY2A 3GBWA 2D8SA 3N3HA 5A1LA 2DV9A 4DV4T 5LRSA 4CP2A 3O7AA 2YFUA 5E16A 1F15A 2NN8A 2HYXA 4TWTA 5B76A 4SBVA 3D6EA 5DZFA 2EA7A 4QKBA 3KDSE 1YEWA 2XOMA 3CLPA 4LBKA 1R1A1 1QEXA 2RS12 5LP6E 3WLUA 1NCQA 1RUH3 3POFA 3VDBA 5FVKA 1VBA3 2VUDA 5ACA3 5JZGC 4GNEA 4IDZA 1S0BA 4XACA 5AVPA 5CB7A 3VD4A 2XMLA 4IEZA 5L3GB 4L2NA 5LEJA 2D6OX 2X09A 2VXJA 1BR2A 1NAFA 5JQGE 5JVVA 2RE9A 2DLRA 3WG4A 2X9XA 3QB5A 3WOGA 3H3LA 3JU9A 4YBTA 2Y1NA 1COV2 1ULDA 5AC91 2LHRA 3GJBA 2Q30A 2RMU1 3HKDE 3V56A 3H3ZA 4H55A 4Z91A 4UYBA 1I6ZA 4DR7T 2JJ6A 5A3PA 4E9KA 1RUF3 3ZMUB 3MACA 1WENA 3AA7B 4Q4W2 2ILMA 2HKXA 4RS5A 3FZHB 2BNMA 2WC2A 3UGFA 1UKRA 3OUHA 3AAAB 3V5UA 1MVEA 2JXAA 2XBO2 4UBHA 1O91A 2IHR1 2EHOC 1H8TA 2YBPA 3RZHA 5KBFA 4KG8A 1R082 1W8ZA 1UOFA 3AL5A 1PGL2 4MHCA 4U31A 4FPFA 4DNDA 4AQFA 2WFF3 1Q56A 4MO3M 2JIJA 2M1RA 1OKQA 2R6QA 5DAWA 3POWA 4HN0A 1VD4A 2VWAA 1T1HA 3RGBA 4XJ9A 1NQDA 2VMIA 2QZ2A 1TZOA 3O70A 4MUVA 2RP4A 2H7VC 1QQP1 4CDUB 1G7YA 5FYYA 3WVJA 3AZXA 3K3NA 5M0TA 2WO7A 2BS4A 2WT1A 2ZLYA 1AR93 3E5UA 4LO7A 2X9HA 3JQXA 4LUMA