3PURA

Cekdm7a from c.elegans, complex with d-2-hg
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
515
structure length
483
Chain Sequence
b'PKESDRCGGCGKFTLMSKKKSHHHKKNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKCVPHTGHSIRYKVVAPHRYRWYSPNEKHLGIEVGSKTWIEDFITRENTVPSPTDDEVCIVEDGYEFRREFEKLGGADNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETSPDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEANQEGSDMREQEKNIWTASQIMKAEMERWMDRELRLGPEKNAILPTDDKNKIMISVRKQIEIQTKIQNAKNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 7 homolog
publication title Oncometabolite 2-hydroxyglutarate is a competitive inhibitor of alpha-ketoglutarate-dependent dioxygenases
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 148
structure length 483
sequence length 515
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3purA03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3purA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3purA01
4LXLA 4LADB 4BISA 4UF0B 3N9PA 4ZDTA 2ECVA 1MM3A 3LQHA 4AYCB 2VNFA 2YBSA 1WEPA 4MVTA 1G25A 5IVVA 2LGLA 2MA6A 2L75A 5D1MB 5FB1A 4FIPA 4PPEA 3NJYA 4CCLA 5FZ4A 3AL5A 3ZPV1 2ECJA 4QXCA 2IDAA 5FY5A 3L1ZB 4XDPA 4GAZA 5F5IA 3FL2A 2LGVA 2H0DB 1VYXA 3N9LA 2MNZA 4BHWA 4F52B 5AITA 2OXQC 1VD4A 5FUPA 2LXHC 4QF3A 1HYIA 4GJZA 2KWKA 1WE9A 2KE1A 3KV9A 3C6WA 5F3CA 2ECIA 2JMJA 3KQIA 5IVYA 5A7PA 4E4HA 3L11A 5H9MA 4S3OC 2DX8A 1T1HA 2KWNA 2VJEA 4QU1A 4AUQB 2JMDA 4CCMA 5A3NA 2M85A 1N87A 3PU3A 1WESA 4YATA 4UP0A 1IYMA 5FY0A 4YABA 3MHHA 5FZBA 2VPEA 3KNVA 4Y4RA 5FYCA 4V3LC 3KV4A 1VRBA 4YBTA 3U78A 4I7BA 5JG6A 3AL6A 3LRQA 2YYRA 5D1LB 5A7QA 5FEYA 4ZUXU 1FP0A 5LWBA 4MSXA 4IC2A 2C2VS 4C9ZA 2KGGA 3ZTGA 2F42A 2G45A 5FV3A 1WILA 3T6RA 2E6RA 5FZ7A 5C13A 3KV6A 5DKAA 4GD4A 4IGPA 3HCUA 3AVRA 5FZLA 5FPLA 2BAYA 2KWOA 2NAAA 1WEUA 2ECNA 3QZVA 3DXUA 3U5OA 4S3OB 5KH3A 4CA1A 4CCGX 2M6MA 4IC3A 1ZBDB 4EYUA 5AIUA 3HTKC 2XEUA 4N4FA 5IVCA 2EGPA 2MA5A 4QXHA 2CKLA 3GL6A 3LQJA 3VK6A 2GP5A 4QF2A 2KGIA 2FUIA 2RI7A 5FYYA 3MHSA 5KH9A 2Y43A 5FYMA 5FZOA 1WEMA 5LKXA 4IGOA 2G6QA 4XDOA 5FP9A 2OT7A 3ZPOA 2JMIA 1X4JA 4CCKA 2Q8DA 5FXVA 4FO9A 2Q8EA 3T7LA 5A3WA 3V43A 3C5KA 4L58A 5F2SA 2YSJA 1WIMA 5F3IA 1X4IA 5A7WA 2MT5A 5A80A 3PUSA 4GNEA 5FYUA 5TBNA 4PTBA 2L5UA 2Q8CA 5FZDA 3ZYQA 4HOOA 2K17A 4Y33A 4WZ3B 2E6SA 2ECTA 5IVJA 2LN0A 2AN6A 3OPTA 2LGKA 4BU2A 5LW9A 5FZAA 5FJKA 5FYBA 2LV9A 4AP4A 5B75A 5FZMA 5G04B 5FY4A 5B78A 4WZ0A 2YU1A 4HONA 5A1LA 2CT2A 3PUAA 3RPGC 5FPVA 4DIQA 3PDQA 5C11A 2PNXA 3K3OA 5FWJA 3ZLIA 5KR7A 5FXXA 5ISLA 2ZETC 4UI9B 4XI1A 5ANQA 5FZ9A 2P5BA 2VJEB 5B77A 4GB0A 4AAPA 5K4LA 5FZ1A 1WFKA 4YBSA 5FERA 2HYED 2UZGA 4CUGA 2KWJA 2HDPA 4I7DA 4LLBA 3AVSA 2G43A 2XUEA 3M99A 1JM7A 4A4BA 4CCOA 4LKAA 2XB1A 2CSZA 1MM2A 1E4UA 4IGQA 5FP3A 5FXWA 5F32A 3RPGB 3GV4A 5H1VA 5FXZA 5FP4A 5FZ8A 4X3GA 4R8PK 5TABA 4CSWA 5IVFA 2MUMA 2VP7A 2F6NA 5G0FA 4CCNA 4CCJA 5FZCA 2K4DA 2YSMA 5A7OA 5E6HA 1X4UA 4V2WA 2YQMA 2OX0A 5LY2A 4AVXA 5A3TA 3ASLA 1DVPA 2YHNA 4B86C 4R7EA 2I50A 1LDKC 3ZPVE 2YW8A 2VPDA 2MNYA 3HCSA 5IWFA 4ASKA 2VJFA 2XXZA 2CKLB 3KVBA 3OPWA 3KVAA 5F5AA 5FY9A 3O33A 4WA6A 2OQ7A 4YAXA 3L1XA 5H1TA 4LIUA 1FBVA 5FZ0A 5FZOB 1V87A 5FZHA 1WEOA 5LKZA 3RVHA 4GNFA 4I7CA 2YT5A 5TDWA 5KH7A 2YBPA 5F3GA 5FZEA 2KR4A 2FUUA 4YBMA 2YPDA 2EODA 5FYHA 4UP5A 5FZFA 2WWJA 2YHOA 5A7WB 5FZ6A 1JOCA 5FPBA 5B76A 4D6SA 1WEVA 5H1UA 4GNDA 2JRJA 1WEQA 4D6RA 4YADA 5FBJA 3U5NA 2FSAA 2EA6A 2MD7B 3SOWA 5FYTA 4BBQA 2KYUA 2Y1MA 5FY8A 3PUQA 1WENA 3N9NA 4DO0A 5FYZA 4LITA 4TN7A 5FYIA 2XDVA 2KIZA 2PUYA 5F37A 2MIQA 5LCWB 4LJNA 4YC9A 3ZNIA 2ECGA 4UF0A 4LIVA 3SHBA 4AYCA 2M3HA 4NN2A 3I2DA 3NG2A 5A7NA 4LK9A 4FJCA 4TKPB 4EZ4A 1CHCA 5FZ3A 3DXTA 5FP7A 2YUCA 2ECWA 5A1FA 3RTRB 1VFYA 3SOXA 5FZGA 4D6QA 2Y1NA 3U5MA 4BXFA 5FYSA 2H0DA 3PURA 3N9QA 1JM7B 2RSDA 4O64A 3LQIA 4Y3OA 2YQLA 3ZVYA 3U5PA 2LXPC 3M62A 4A4CA 2W2IA 3K2OA 2L43A 1Z60A 2K16A 2VPBA 2QJ0A 4AI9A 4R2YA 2GP3A 3UYJA 1XWHA 1Z2QA 4GNGA 2YBKA 5IVBA 5LY1A 4URAA 5FY1A 1U6GB 3EB5A 3O7AA 4N3WA 5I3LA 3M63A 4V2VA 3N9OA 4P5OB 5FYVA 4ZQLA 5F5CA 3N9MA 2WWUA 4V3KC 2VD7A 5FPAA 5CEHA 2QICA 4GJYA 2VJFB 3DQVR 4WZ2A 5FJHA 5IVEA 3O35A 5F39A 2F6JA 2YU4A 3IHPA 1RMDA 5TRBA 5LKTA 3KV5A 4EZHA 5B79A 2KREA 4W4UA 1F62A 5F2WA 3O37A 2LGGA 5FWEA 1BORA 3PU8A 4L7XA 4Q6FA 3O36A 4C8DA 5A3PA 3ZVZB 4A0CD 4QX8A 1WEWA 5F3EA 2YURA 2YU2A 2LQ6A 5FZIA 5FPUA 5A7SA 4FK5A 3EB6A 2OQ6A 3HCTA 2XMLA 2OS2A 5G05B 2LDRA 5DINA 5FB0A 3K3NA 3PTRB 5EYAF 2L80A 2CSYA 2MD8C 4QWNA 2L0BA 3O34A 5LKUA 2YREA 2VPGA 3PHDA 1WGMA 5D1KB 5FY7A 1LDJB 5J3XA 5B8DA 4QX7A 3U4SA 3SOUA 3DPLR 1Z6UA 2LRIC 3O70A 1WEEA 2M1RA 3LDBA 4QXBA 2PXJA 5FUNA 4B7YC 5FP8A 5FZKA 4A49A 1HYJA 3LD8A 5TDRA 2KFTA 2K1JA 2C2LA 2KU3A 5IW0A 4NUBA 1K2FA 2D8SA 2QIZA
chains in the Genus database with same CATH superfamily
4X8NA 1BXHA 1HX6A 1ZZ8A 2UXNB 2OXBA 3ACHA 4NAOA 4DV6T 3HKBE 4I43B 2Y48B 2WWVA 2KNDA 4DMVA 3SHRA 2BGPA 4I0BA 2MNZA 4DPNA 3D0TA 5APAA 5AITA 2JDUA 3B01A 3T30A 4RFRB 2M67A 3KV9A 3LEGA 4HVRA 2PAKA 2LS6A 4QXKA 2VJEA 2R49A 1LESA 4AHWA 1ZRFA 3HN1A 1VBC1 1OEDE 4A97A 3DN7A 2CWSA 3AYEA 5C9AC 5L3DB 3RG0A 4V3LC 3KV4A 4B3ST 4GKYA 1PO11 1QH6A 2D6OX 3Q8FA 2CMRA 1HQWA 1WGPA 1RUE3 1BVP1 3OBVE 3PUVF 2P6CA 1WILA 5IFPA 3S7EA 2AC1A 3JBG2 3I4IA 5KHIA 3HCUA 2BG9C 2VVFA 4GZ9A 5JOXA 1RJ8A 4ET7A 4QX8B 5KDMC 1Z78A 2QZ3A 1Y01A 4JGZA 2XONA 3LCPA 3VZNA 3KWVA 2LE8A 4BPZA 2CKLA 1K45A 4OUSA 3OUHA 1MEC3 1GANA 2G9GA 1WEMA 1DQ2A 2CRBA 4IGOA 2G6QA 3POSA 3RKGA 2CSGA 4OFGA 4AE2A 5HCFA 3VRBA 4Q0QA 4O65A 4ZHNA 3LFIA 3EQEA 2SBAA 4FO9A 4ILBA 4P08A 1RUJ2 4GNEA 3KBTA 2JMHA 1TMF3 4P5HA 5IVJA 2LN0A 5A32A 2LT3A 3SITA 5FZAA 2V8SV 5LEJA 2KWHA 3HN3A 2XLFA 4WM8A 3FZLB 5A1LA 4KBBA 5BV6A 2CWMA 4DIQA 3PDQA 4XC9A 1RUD2 1MIVA 1RUH3 2QGSA 2XHKA 3NW4A 4ZHQE 5BMVE 2VY0A 1LOFA 1WFDA 4NPRA 1O4TA 5AQKB 2GSYA 1KFYA 4N53C 2P6HA 1KDKA 2UZGA 1AYM3 1ND3C 4O4HE 1V9U3 2KKYA 2CYFA 1JM7A 2DFCA 2B5HA 2VQET 2CSZA 3TRSB 1MM2A 5FPZA 5H9PA 2CRWA 5FXZA 5FP4A 5LA9A 4CEYA 1HKDA 5EPAA 4LULA 5JMCA 5LK7B 2XHEB 1YI7A 3APBA 2WNEA 1V6JA 2I0MA 1CJDA 5AFBA 4LJHA 1VBB2 2JDHA 4D8MA 3RI9A 2VPDA 4UWDA 3AEAA 2HWC2 3WI3A 1FOD3 4FI9A 2W67A 4WYVA 3AZWA 5B4NA 3POIA 4QAWA 1U5ZA 5LKZA 3HBZA 2YT5A 5HEJA 3HL6A 1ULPA 2LOPA 1IG0A 2QQLA 1OXCA 5CFDA 3N2KE 3VBUC 1NAFA 3GJBA 1HN1A 2X05A 3SH3A 1S4CA 4LQRA 1S2KA 3VBRA 5H1UA 2DVGA 4RQPA 3ZXLA 4D6RA 4QDQA 3GBFA 4BBQA 3VDDA 2K0GA 3I9YA 4XJ8A 3P4QA 1W06A 1Y4WA 1WENA 3N9NA 1YCIA 2JDMA 4JI2T 3OB8A 2BVLA 4DV1T 1RUG1 2TEPA 4EIWA 3EABA 4R4ZA 2ECGA 3SHBA 5KMGP 3NG2A 3VHRA 1SUMB 4LK9A 3ZKUA 4ORFA 1XNTA 4QB2A 2FDIA 2XJSA 3O1PA 1K5MC 3FL7A 3FZFB 3VR8A 2GN7A 4UFKA 3C7GA 3PVOA 4K8FA 4QM8A 3JC6D 5JDFA 1HJGA 4TZDA 4ZU4A 3NNMA 4HWIB 5BXXA 5JOZA 4MZUA 1FAYA 4HETA 5L7OB 4XCBA 1QJY3 5J09A 2LROA 4KWKA 3EB5A 5L4HA 1C5HA 3ZXAC 2BOIA 1J3RA 4ZQLA 1PMIA 1ZHCA 4CCCA 3DQVR 4AR2A 2CDPA 4B7KA 5F39A 4WVMA 3ZYFA 2J22A 4DOUA 2D6PA 4CDQC 2WNUC 1X9PA 5FWEA 1BORA 1V6KA 4BCUA 1FJGT 1PZ9A 1XZYA 2YINA 2Z79A 2EIEA 5FRAA 5G04L 3EB6A 1HXS1 5FB0A 1US3A 2RG4A 4AEDA 4DVDA 1SLIA 3WR0A 1MZFA 4QWNA 2YREA 3ZDSA 1DQ1A 3D82A 2XJRA 5JDNA 3O70A 3AEBA 2VZOA 4K20A 2OZ6A 2WU5A 4CEWB 4O4JE 2C9AA 3LIHA 1JZ5A 2K1JA 4LUMA 3PJAA 3FLTA 2IWGB 3BOWA 3LSDA 3O0VA 4ADZA 4CI3B 4MXWA 3HI2A 1HF8A 2YBSA 1Q8VA 4RSUA 5IVVA 3W20A 3Q5XA 4CCLA 4AEKA 2X53S 2VNOA 3AEFA 4X6QB 1A3KA 5EFUA 1YD8G 3W5MA 2B39A 2JX9A 4PJNA 4YM0A 5GLWA 2XUMA 1WCDJ 4PBOA 1RHI2 5IVYA 2RS33 5ACA3 4S3OC 4C90A 4Z1VA 1AR83 4PIYA 1VRH2 4HFSA 3PU3A 4AOCA 1JOJA 3QNUA 1U12A 4MSVA 4CXYA 1IYMA 2K24A 5FZBA 2X09A 1RUI1 4Y4RA 5AQSB 4CQIA 5JWPA 2EAKA 4JBWF 2YYRA 5A7QA 5LWBA 3RQ0A 2JG8C 2CXFA 1S0CA 4RFT0 3SNMA 5DKAA 4GD4A 5FZLA 2KWOA 3ZFEC 1KJLA 1JHJA 4LKEA 4IC3A 5DQWA 5K9YA 4H7LA 3TEWA 3P4RA 5AIUA 2LM2A 3ZSJA 3MA9A 3IHRA 2H7VC 2WMOA 2B42B 4YGCA 5KHJA 3ABVA 3UU6A 5BY5A 3OVUA 3LQJA 1UY4A 3ANWA 2AE9A 1QJFA 5GKAC 1AR93 4DY5A 2WRAA 3BPSA 1X4JA 1D0HA 3FLRA 2HYXA 3P4WA 3NL1A 5F2SA 4Q25A 4BZ4A 4R8HA 3E5QA 4XHBA 2KR2A 2HYKA 3WINE 2RS12 1EAH1 5TBNA 3ZXEA 2YC2A 1D1BA 2HLEA 3FC0A 2WYFA 1DGWA 3H1WA 2UUBT 2EHOD 2HWF2 2E6SA 1CAVA 1CJPA 3AE6A 4DRVA 1QQP2 3ZFGC 1QJU2 2KT9A 1VMJA 1ZA4A 1OA3A 2OLTA 4CP9B 5FPVA 2XZEA 4I0UA 4GKKT 1R1A1 2LAUA 2E7QA 2PTFA 1UY1A 4RHV3 2JQ9A 2V6YA 3ON7A 2E32A 3ZR5A 2J1SA 5L9BA 4NRQA 3ZKYA 2BBJA 2CGOA 1TNFA 1LECA 2XBO2 1VBA2 2MAWA 3FXDB 2QVSB 1I5ZA 4YG6A 2J1UA 3B93A 3M99A 4E4ZA 2E5LT 3L39A 4Q4V2 2LM9A 4AISA 5H1VA 4XURA 5FQ0B 4AFBA 5TABA 3JBG3 3HAGA 1N47A 2W68A 2PHFA 5L3BB 3FAOA 1WLCA 1LRZA 5LY2A 3O1HA 4YVSA 1JOPA 1AUYA 1YQ4A 5IWFA 5FY9A 2XR4A 2OQ7A 2VZSA 3MIDA 1VBC3 5IUQA 2BKPA 1PM7A 1S0JA 3GZTB 3FHIB 1YI9A 4IDQA 1PO13 1TVGA 2OA2A 2WWJA 3KDSE 1ENRA 4KNCA 2E61A 1IOAA 1JNRA 1ULOA 2VZ1A 2WDVA 1OBNA 3VGIA 3I2GA 4NJ4A 2MD7B 1F35A 1LHVA 3WG1A 1W2OA 2D2SA 3M3IA 4XUPA 1LHUA 1O91A 3H3LA 4H63V 3ZN1B 5HV4A 1UYPA 3E5XA 2PQSA 1MMAA 2Y6FA 1RUD3 4Z8XA 5TSWA 2WDBA 1OVPA 2WKKA 4CP0A 5DZEA 4BDVB 2WMNA 2A6XA 1N33T 2XL7A 4OZXA 2BS2A 2ZX2A 4OHXA 1W6PB 1LVFA 2A3YA 1CN1A 4Q4W3 1HX8A 1M4WA 3MUZ1 3OGGA 3JU9A 5GZEA 4D6QA 2YC0A 4NO4A 2ZPXA 4LBKA 3N9QA 4U2AA 3U5PA 1OQDA 2P3IA 2BKNA 5EP9A 3MDPA 1ND2B 1K5JA 4QDSA 1W0NA 3ES1A 5LY1A 1DG6A 4CDWC 4IDNA 1DU3D 5JVDE 3SKVA 3IWZA 1FXZA 3MEPA 2HWC3 4YFZA 1GUIA 3NNFA 1W9TA 4JHTA 4Q4X2 1DGWX 3T2PA 5IJRA 2BEOA 3IPVA 3WV6A 2WS91 5KX5E 3WDVA 3M65A 3X1DA 4L0PA 1H30A 3BGAA 2HWB1 4DIDB 4ZI2C 3JAFA 5DXDA 2X5IB 1HX1B 1AF9A 1MQTA 4FFIA 2R16A 4NHKA 2LDRA 3SS1A 5HEHA 4GH4B 5EK3A 2L0BA 4A44A 5FO9B 5CFCC 3AP7A 2CRRA 3LDBA 2XPKA 4TN7B 3T9KA 4MYEA 4DUXA 4A49A 3NV4A 2G0UA 1HYJA 3AKPA 4K7JA 3LF7A 2C2LA 4TWFA 5JR9C 4E8CA 1OMIA 5CADA 2EF6A 5FCCA 3WF0A 3MHZA 1WEPA 2NN8A 3HT2A 4CUBA 2K46A 4ASMB 5A6QA 2M13A 5F5IA 4ISRA 2V1DB 3IBMA 2FD8A 3KMHA 4Y1ZA 5EV7A 2I6HA 3PJYA 3WUCA 1AXYA 1RVF1 1D0ZA 4FSJA 4KGGA 2XAQB 3CDZB 4FJOA 2TBVA 2JE7A 1W8UA 4K8RB 3U1XA 2ECIA 5CB7A 5DAPA 4EWDA 1O5LA 2M85A 5ABJC 1MPXA 2IC9A 1RUG3 1NG0A 5D8AA 5T52A 4R9BA 2ENRA 1DYPA 1R091 2V72A 3JCFA 1GR3A 3JCIA 3ZTGA 4DXTA 5FZ7A 5C13A 3ZYRA 2V73A 2VUCA 3EVYA 3WQ1A 3QZVA 1AR72 3ZO0B 4IDZA 2M6MA 1OLRA 1G8WA 3DPRB 4LO7A 5IVCA 2VK9A 3AZYA 1RTVA 3KBUA 4GXLA 5LP6E 4QGLA 2G4IA 3KF3A 5LG4A 3WNPA 1MACA 3MHSA 5KH9A 1BR1A 4HE8A 1ULFA 1KRIA 1H4GA 2DCJA 1AJKA 2YDQA 3BVCA 1W03A 4LKDA 4FT8A 3BK9A 4PTBA 3ES4A 5CA1E 4CCEA 5BNNC 2EXIA 1RUF1 5GJ6A 1GU3A 5FZMA 4P09A 3D3AA 1JYCA 2FHRA 4E2QA 5SV8A 2F4LA 1GWKA 4X66T 1CAUB 2CM0A 3WDXA 1HRV2 3ZMVB 4ILUA 2NYYA 4ASLA 5ANQA 4JVAA 2DNXA 4MH0E 1VRH3 3JD72 3L09A 1VIWB 2GMEA 4U36A 4FPGA 1FNZA 2PA7A 3ZN5A 1XNQT 1T72A 4WBOA 3RPGB 3KDEC 2GH8A 2ES3A 4GMP3 1UKGA 2QQUA 4YG3A 3U0ZA 1N1TA 2LM3A 3N5LA 4LFAT 1HG2A 4CCNA 4DR3T 2R7EB 1NQDA 1R082 4FP2A 5E6HA 1LOAA 3PMSA 2OX0A 2CNAA 3VL8A 3NWIA 4L92A 1G9BA 3VBHA 2JJ9A 5C8YE 2WM9A 4IL9A 1MIYA 1XMQT 4META 3WNKA 2VTXJ 2ZOEB 5KH7A 1RUI3 1KGYA 5LRRA 2FUUA 1IG3A 5FYHA 2YHOA 2FJDA 1D0XA 3I9WA 2WINB 1LOEA 3RGBA 4QPIC 1W6NA 2YPJA 2JRJA 4UXNB 1ENXA 1V6NA 4FP3A 5DAWA 2FSAA 2Q8OA 1ENSA 2EHOB 5CG8A 3TNPB 1UD1A 5FAXA 2YHJA 1QIQA 2RR12 1QQP3 2JM3A 5JSPA 2JG8A 1RJ7A 5IYZE 2LRPA 3GYDA 5BPXA 1SZBA 4H63H 5F37A 3GZEA 1V6LA 2HBTA 3K51A 5JDBA 1HS7A 4DS0A 1SQ4A 5CYYA 3DUIA 2XBO3 3ELNA 5FP7A 2ECWA 3N2OA 2DCZA 5E1RA 3SOXA 3ATGA 1EAH3 5F9TA 4QX0A 3OYWA 4LBNA 3RQWA 1OQ1A 5IATA 1W0BA 1Z60A 3DGTA 3KGZA 4COFA 4AZZA 5A6XA 2WY2A 4ARXA 1VMHA 3DJBA 3WDTA 2ARBA 4XFGA 3ONLC 4IEYA 3EJKA 4X1KE 1UZ0A 5LKTA 4MGTA 3NV3A 2DURA 4L2NA 5B79A 5BNOB 3Q8BA 5IAXA 5AQUB 1Y9QA 2FBWA 4JQRA 4AI3A 1IZNB 2NLRA 4LO5B 3B5MA 2R072 2YU2A 3HCTA 1OD5A 5G05B 2OKXA 4QX1A 4OYUA 4QWNB 1H1MA 2XM2A 4Z91A 4KG8A 4EQVA 3O34A 3T2QA 2XOCA 1SBFA 2JD9A 3HNYM 2G1MA 2XQYA 3IDBB 4XE9A 3R6NA 2DTWA 5FZKA 1V00A 5HXRA 4TNWA 3R4UA 3QB5A 2VH9A 1ZX5A 5E8AA 5T55A 4WM7B 4DBQA 1M06G 3I54A 2O8QA 4MXWB 1J83A 1NCRC 4BISA 4IE0A 3LJCA 2VNFA 1T2XA 5A6ZA 4AFMA 2VGDA 3NNLA 3CNAA 2XOMA 2ZM8A 1EV12 2ECJA 3PVBB 2XJQA 5J36A 4ZOLE 3VHPA 4NHMA 2ZMNA 4NHYA 3H42B 4M3CA 4PJYA 4PQ9A 1S0BA 1QJEA 2QRXA 3MW4A 2JB4A 4H2AA 4JTNA 2YV8A 4GIWA 3ZJ1A 3KQIA 2JMJA 4HANA 4YM2A 3OD0A 4W4ZA 4DR6T 2DX8A 1XPWA 2WZR1 1D4VB 3S5QA 3NVCA 1UN1A 5LHGB 1UU6A 5HCBA 2O1QA 1NUKA 3RZKA 3ZSSA 2ZGLA 4YABA 3GCXA 4XJWA 3AP9A 5ABHA 2Q9QD 3BKZA 4YBTA 2F6BA 5CG9A 3AMNA 4YW1A 5JZGC 1QJX1 3FZKB 3BU7A 2AGSA 5CAZA 4ZUXU 1YQ3A 4LF6T 1FP0A 2JG9C 3S7IA 5E0OA 4H9QC 2UXBT 5BR8T 4NVPA 4QM9A 3WCRA 4OFZA 5KH3A 1F2NA 3GCWA 2NTXA 3HQXA 2JDNA 2DVDA 4WBBA 4J1XA 3THPA 4QX7B 1ZYBA 3EB7A 5JDGA 2Y43A 5FYMA 1LTEA 1H6XA 3VV1A 4DNYA 3LBXB 3E2DA 2JMIA 2DF7A 2W0GA 1QSDA 3C5KA 1D4M2 1A8MA 1CAXB 4MOAA 1X4IA 5A7WA 4BMEA 3PUSA 4CDXA 5K0UB 1UK5A 4OHVA 3ETUA 2WZEA 1AR61 4I09A 4XF1A 3H3UA 1SMVA 2HWB3 4OVEA 3VKHA 3D0JA 4IGUA 2VL8A 1VAKA 3UV9A 3LOBA 3DDTA 5FY4A 1CR7A 4WZ0A 4BQ5A 4YFWA 4NPPA 1OWAA 2WB5A 3I0OA 2F4PA 1FEWA 3UUXB 1YJKA 4DFSA 3B00A 1REFA 2FQPA 4IV3C 2Y34A 1W6MB 2RE9A 3J8F1 3V5UA 2BNOA 3LE0A 3AMMA 4CUGA 3KHBA 4HWCA 4LLBA 2FJBA 3WP4A 3U75A 1R1ZA 2G43A 2FJAA 2CSVA 2WA3A 4P0BA 4L11A 4AGRA 1AVBA 5JR9A 2VMEA 2Q0AA 1LULA 2A5ZA 4X3GA 4R8PK 4XFHA 4TV9E 3M8LA 5G0FA 5L3FB 4GQ7A 3G7DA 2BS4A 1X4UA 2WAOA 5KWRA 5C4WC 4PK4A 1VLNA 1BJQA 2DU0A 2I50A 3RZMA 2WO3A 4OCTA 4CN4A 3WLUA 4U31A 5AQNB 2KMFA 3M3OA 3RRCA 5FZ0A 5FZOB 5FZHA 4IV1C 1T6BX 3UGGA 4YW5A 4ZZCA 3KT4A 3AE4A 1Y43B 4W6YA 4FOWA 4ZXKA 1LJ7A 3AM2A 5B76A 3P5BA 2LSIA 2XKOA 2E9QA 2ODUA 4Y4YA 2OZJA 1HRI1 4MGQA 2ZEXA 5L3CB 1WR0A 1HXS2 1HRV3 4U74A 3ZNIA 3CQOA 2GNTA 2YEVC 3NV1A 2VJXA 4AYCA 2PFWA 2P9BA 4OI0A 4YZ4A 1PGL2 3ETQA 5A1FA 3VBFA 2J1RA 2ZGMA 3RLFF 5F5QA 5IHYA 1MZ6A 2GU9A 3UU5A 1RUF3 4LORA 2JMKA 3ZYJB 4BK4A 4PDWA 3DCQA 2BTVC 3OSDA 3S57A 4CPBA 3N4MA 1WA6X 4PF5A 1XRUA 1ULEA 3MV11 4FPCA 4Y20A 1UOFA 3AA7B 4PF1A 2BFUS 3GA8A 4HVQA 5F6LB 4XIKA 1BZWA 3H8UA 3O1OA 1AHSA 3D5OA 4AVAA 2D43A 1ZRDA 2VKJA 4L5GA 3LA3A 3MIFA 3ILRA 3SKJE 4WNKA 1UX4A 5LCYA 4XFAA 5D2AA 5I8SA 3P4SA 5LHHB 1JU4A 2MPKA 4LF9T 4B29A 4UELA 1QWRA 5FZIA 3V5SA 3I2FA 1XJAA 2QYWA 2UXCT 3LGRA 3T4HB 1DBNA 1PVC2 2YGMA 1E5RA 1QJZA 1RC6A 1LDJB 4BHPA 3O1IA 2OIIA 2HWE1 4QXBA 1XE0A 5DUUA 1XYOA 5AQOB 1DZTA 3AJZA 3AXJA 1WR6A 3AE1A 3ACLA 4CYDA 3IDCB 4OMDA 1K2FA 2DYCA 2E9XA 4UF0B 2H0BA 2CLYB 3AXEA 2LGLA 1FMVA 4FVVA 4NMIA 3IAQA 4E8DA 1UMHA 2IUWA 2RMU2 3NZPA 5HXMA 4Y5SA 2IHR1 2JRKA 3RF1A 3ZN6B 3RZLA 1ZZ9A 2H0DB 2ZMLA 4NUUA 2AREA 4Q4Y2 1CUNA 5LGNB 1MZ5A 1UMZA 5FNVE 3IDEA 2NWBA 4A41A 3L2YA 1ZV4X 2JMDA 2XB6C 3AEDA 4Y22A 4URTA 2V5YA 3USUB 2WNVB 1PX3A 1WMFA 2IVJA 2JPFA 1R1A2 1O5UA 5C5TA 4XZCA 5C6CA 1QOTA 5FFOC 4OYKA 3FEHA 1B35C 3KV6A 1YW0A 1R64A 2RM22 4QQ2A 3LDKA 1ZVFA 4CCGX 3O0WA 3MYXA 1ZZ6A 3HTKC 5KXEA 4GK0E 1XXNA 2NP9A 2XOZA 5LA0A 2JDKA 4LO4B 1PO23 4ATEA 1SACA 1VE0A 2HWD2 2EA7A 3MI8A 2YSJA 4TLFA 1WIMA 2J47A 1NY71 2WABA 1PGW1 2Z2SB 1MIWA 1JI6A 5JQGE 2BBAA 1H8TA 3C4ZA 5C3OA 2VVDA 2W3JA 3WQ7A 4CUCA 4QXCB 1MVEA 2QQWA 5LW9A 1JZ4A 2RPAA 4DMWA 4KWLA 5FYBA 1Y3TA 3S6PA 4HKLA 2ID4A 3PUAA 4H9DA 5JPNB 3MUY1 3VBSC 2KZ7B 2EVXA 2NMOA 4XI1A 2ZETC 4UI9B 4LBQD 2XQRA 3SH4A 3IIIA 3I3DA 4M01A 1C28A 2X9WA 3AC0A 1HV0A 1X7NA 2P34A 2JUNA 3FB2A 4EN8B 1TE1B 1YQ5A 2Q9QB 5FKCA 1OLME 2CHHA 1IAPA 4F8HA 3AE5A 4A7KA 1UZWA 2VCCA 4CPBD 3UESA 1V0AA 4RR3A 4YY3T 1RUC1 3PMEA 5BNPC 1WMEA 1JZ8A 3ASLA 2CAVA 1S0DA 3KQRA 4NWWA 3VKNA 1BMV2 5GZGA 4Q29A 5LGUB 1OA2A 3CK6A 2PHLA 2WZR3 1ZBE2 2Y6KA 4GNFA 2MEV2 1VR3A 4JGYA 5CFBA 1URXA 4FI5A 2WZIA 5F3GA 5FZEA 1ASJ2 1IS3A 2IFWA 1W6QB 3WZ1A 3O4XE 3FZ3A 3ZFFB 2B7YA 1N1VA 5FZ6A 4XQDA 5I8YA 2JQHA 1NCQA 1JOCA 3EDVA 3C2UA 3POBA 1W0AA 1NENA 1AX0A 1WLWA 3PV0F 4P9JA 2NW8A 2UWAA 3BQLA 4LBLA 2VTFA 2EIBA 1O3SA 3H37A 2ZAAA 2JB8A 4HN1A 3C4XA 1OOPC 1JUHA 3NRYA 3R4DB 3CJIB 1S0FA 3HKDE 3IBPA 1W6OA 1BR2A 2NQYA 3SCFA 2ZMAA 1YKHB 3JUUA 3ZYBA 4HSLA 4FTBA 3ST7A 2D5FA 1CX1A 5CJ5A 3DTOA 1COV1 1UGOA 3QOPA 2X10A 3UGFA 3TKLB 2VZUA 1GNZA 1YQ6A 1X33A 4YGEA 3CX7B 3O5SA 2VVNA 1SLTA 1TQ5A 3T2OA 4P5YA 1MZEA 4BJMA 1KD7A 3RIUC 4FPKA 1E57A 1JZ7A 1BK1A 3CX6B 4BH9A 1U6GB 3LK2B 5I3LA 3M63A 3NJXA 4AVBA 4DV2T 4LO6B 1LR5A 2D7FA 5FPAA 4P1NA 2IUBA 1DQ6A 2YU4A 1RVF2 3H7JA 3AKSA 3TEXA 3MACA 3J8F3 2VASA 1QOSA 4TLGA 2HEVF 1EZ3A 5T5JA 2BWAA 5F2WA 1LU1A 2XH6A 3HOBA 1UYZA 4Q6FA 4QX8A 5F3JA 3NAPC 2D6NA 2BGCA 1EYBA 2RP4A 4FPHA 5HXSA 2GDFA 2MD8C 5DDJ2 4WZXA 4DBRA 1SHZC 1W90A 4UFHA 1DIWA 1EPWA 2SLIA 3M7KA 4MHUA 3ZDVA 2KKXA 3UJQA 2RR4A 5DUWA 5JH7E 5GALA 3LAGA 4EJRA 5CVRA 1PK6B 1CPMA 4QQLA 3N35A 1WCSA 2ZACA 3ZPV1 3KF5A 1BR0A 2MHFA 3EUHA 2CXLA 2MYSA 2V09A 4M3CB 1W28A 2PHWA 2WFPA 1LGBA 1ZBA2 4QGNA 4XQWA 5FLJA 3LDRA 3DP7A 1NEKA 3EDUA 4N9HA 1HYIA 1HRI3 4GJZA 2NZ9A 5A7PA 3G06A 4JV5T 2CU5A 4HSJA 3OKQA 5FR3A 4AUQB 1O3TA 3DWDA 3RPUA 3RRDA 1D2SA 1BBT1 4RS5C 5F5WA 4QPGB 2W47A 1VRBA 2ZGQA 3MIBA 3U78A 4Z2AA 5LBMA 2J1VA 4M4RA 1OLQA 5FMBA 2XQAA 2C2VS 1A34A 2KGGA 1TME1 2G45A 1CZSA 3FBLA 1H1IA 3DV8A 3WY6A 5EK2A 4NR1A 2TNFA 2PAMA 5KXDA 2PHUA 4Q8LA 4DB5A 2AR6A 4N43A 4GWMA 4YTMA 3Q1DA 1NLSA 2AENA 5DJQC 2GK9A 1HNWT 3P50A 2CY6A 1ZRCA 2R30A 2VOTA 3E08A 5LYJE 3JUEA 1OH4A 4CCKA 3RX6A 3V0AB 1HB1A 5F3IA 3K4AA 3IMNA 2MT5A 4NPMA 4GOUA 2DU1A 2XHNA 1NA1B 1ZP0A 5AQHB 2QUOA 2RMU3 5LB7B 4X1IE 1LU2A 4ONUA 2ES0A 3C7OA 2XWBB 3OEBA 2D0TA 3HPNA 4O4IE 1H1AA 4MLOA 2XVGA 3KT7A 3VR9A 3O12A 2HWE3 1E5HA 2L9QA 5ISLA 1X82A 2W5FA 4B3RT 2ZEYA 3UQ7A 1IZ3A 3UFEA 4JGZC 4XMAA 4YBSA 4TUYE 1ACCA 1VAVA 2K48A 3J9SA 3P6BA 4LHKA 4A4BA 3ZIXA 4CCOA 5F32A 3LSVA 3WW2A 1W2AX 1ZZCA 2RM23 4U3CA 1MEC1 5L7OA 2DTYA 1ST8A 4JYAT 4F1PA 1Q8OA 3FXEB 4EB6E 1DVPA 4FQZA 1LDKC 4A98A 2QA7A 4Y1XA 3M2MA 4QXHB 4WVZA 2R042 3I2JA 4AHXA 4GYRA 3BOPA 2YGLA 1FPN3 3Q5DA 3AEGA 4WM8C 4YAXA 4N7UA 2HWD3 4K0UA 2ARXA 4P9GA 2R6GF 4DRRA 4CCDA 1JUIA 1XE7A 4LA2A 4QD2A 4OI4A 4E7ZA 1REEA 1G86A 2KA3A 3BQIA 3C64A 4PNIA 1LOFC 1V70A 3B13A 1V6OA 4LBMA 1N3QA 1RUH1 5LG3A 4H9NC 4XFIA 4LA3A 1IPJA 3HD8B 3WG2A 4DO0A 4K3UA 4MUVA 1LGCA 2VVEA 2BGOA 4CEWA 1MR5A 3K75B 1AYM1 4CEYC 2MIQA 4AHYA 1V9U1 2QZ2A 3Q5WA 4ZXEA 1I1EA 4LBQB 3POFA 3ME2A 2WS3A 5HCAA 4GIQA 1POV0 3GZUC 3AE8A 2UURA 2PHXA 4ERRA 4F8AA 5I91A 2O14A 2OV9A 4PDWB 4X65T 1PMJX 2QJ0A 4R2YA 1XU2A 1SCSA 5CFDC 2YBKA 1KITA 1E5IA 1C1FA 4OZOA 1HJFA 3VBRC 4RQPC 4SLIA 2XVLA 3ESLA 3POWA 3VDDC 2LOSA 4Z82A 4YRDA 3OD4A 2AZ5A 3ROUA 2MEV3 4ILAA 5HPOA 3HQRA 1F62A 3O37A 1ASJ3 3HJRA 3PU8A 1XBFA 1T8BA 3C98B 2WYSA 1GFF2 3RYPA 1AXKA 4MGSA 5GLZA 2HEWF 2ZBJA 3NSTA 4K1ZA 5LKUA 1RUC3 5FY7A 4QXBB 1Z6UA 3POJA 3WW1A 1YQ2A 2M1RA 3F2ZA 4E9KA 3FJSA 1GYKA 3ILFA 1A6CA 1QKQA 2WFF2 4LMKA 1VBE2 4BQ2A 4ITCA 1PHMA 3H8RA 5A3OA 5HCHA 1G25A 2R062 1OKOA 1TNRA 3AA1B 3IZOA 2DI4A 1GOGA 1NZIA 2E6VA 1PNGA 2WZ8A 3WW3A 5LA6E 3FL2A 5JDHA 2RS52 2ZKLA 4JDNA 3TN91 4CP9A 5GLUA 3ILNA 1CPNA 4AK3A 3MJXA 2FMYA 2QE3A 3X29B 4IEVA 2D3RA 1DGRN 2VB6A 4U2ZA 4E4HA 2VPVA 3L11A 5D1IA 4Y22B 2ADEA 4LTAA 1UY3A 1J59A 4A7ZA 2QQNA 1NX9A 1CONA 5JXGA 2B46X 4AEDC 3MHHA 1PIV2 2Z6EA 4KI0F 4IE4A 1WYCA 1U5PA 1QUUA 1S0GA 1X9TA 2MOZA 4X20E 4I7BA 3GGLA 3RYRA 2E7TA 2LALA 5D1LB 1IJ5A 3TAYA 4KBMB 5FEYA 3CMLA 1COV3 4YT0A 2VZRA 4J1WA 3UFGA 3HMYA 3PLQA 1W8ZA 1GZTA 1KNZA 1KDMA 1H7CA 2VXRA 1Y7BA 2EGPA 5DDJ3 2VW1A 3ZYGA 2BWCA 5C9AB 1XNKA 5LBQB 2C0SA 1UU4A 4OMCA 5FL1A 1I3HA 1ODMA 4ES9A 3RIUA 3THTA 4A45A 1MS1A 2ACXA 3WAJA 3PIJA 4LEJA 1Q5OA 3VHNA 4IDPA 2BG9B 2C5IT 1OI6A 2VOXA 5A70A 5ABFA 2VOWA 4XVHA 4GA9A 2LHNA 5L19A 3AMPA 3U10A 1AL22 2RS31 1L7QA 5ACA1 4NROA 4H55A 4EOZB 3RIFA 4KL1A 1DQ4A 5B78A 4FOVA 2WR9A 2ZGUA 1ALYA 2WJSA 2VWAA 1CAWB 2UY9A 2PELA 5B77A 3DKQA 2WA4A 2IZWA 1W6PA 2VMFA 4H9SE 1UL9A 2WLQA 2L8KA 1NOVA 3BTYA 4XPVA 3V64A 2DLRA 4E2GA 2WIIB 2YFZA 3SEPA 4JUYA 3WP3A 2VNRA 1N36T 1AYN2 1YNAA 5LA2A 1JZ6A 1ND2A 1J3PA 5IVFA 5HWXA 1IBKT 1AR91 3K46A 3WOGA 4FFHA 1HDKA 3LEMA 4DXSA 2CGNA 4F3JA 1BR4A 4N53B 4FPOB 1UIKA 5FVKA 3I97A 3RS6A 1ND3B 3MV01 1JN2P 3KVBA 4HFHA 2W92A 3B57A 5AQRB 3WQBA 1BBT3 3T0AA 5LMNT 2XAJB 1G9CA 3LWCA 3AAAB 2YBPA 4YBMA 3QACA 3E0ZA 3M70A 1OEDA 2X5IA 2V7KA 3WHTA 4AQGA 4L9IA 1TME3 4GH4A 2BOJA 4W8JA 1DHKB 2JE8A 1GBGA 2JD4A 4RHV1 3U5NA 4IL7A 2KYUA 5CGMA 3S30A 5HXHA 3M1HA 5FYZA 2VBBA 5L3GB 4DV7T 3LZZA 4TN7A 1YQ8A 2PN5A 5FYIA 3RYFE 5GZCA 4Q0SA 4K9SA 3GJAA 2BVVA 4HFVA 4CXWA 2QQPA 1VAMA 3VBUB 3CWZB 5JLVA 4WBNE 4FJCA 2VKDA 3ASIA 5HCMA 1YQCA 1CHCA 4YVSC 3JBG1 3W21A 2YUCA 2W1UA 4ATFA 5B2GB 2X67A 3HIFA 4M0NA 4RGGA 1IBMT 5DQVA 3E22E 3VN4A 2DHRA 5F7UA 4O64A 2H7OA 4YPJA 3A7MA 1XU1A 1DGLA 4JZRA 5AC92 2R6QA 4DUWA 4NHXA 4MHCA 2HH7A 4HWDA 5IVBA 1W9SA 1V9DA 5JREA 2IIUA 4AQFA 1QXJA 2PLV2 4D7TA 4P5OB 3SFDA 1MNDA 5EJZB 1IPSA 1K5MB 5FJHA 1RUJ1 1BCXA 1LOBA 2W52A 4LBJA 2UU8A 1GNHA 3T1YT 4YGDA 5C3JA 4A2UA 4PLNA 3MFAA 3ZSEA 1DCQA 2D8UA 3RFRA 4EWAA 2B76A 3D8CA 3NJZA 3DPRA 5H9RA 1RUD1 4LE3A 2BW8A 3SOUA 4GB32 2LRIC 3Q2MA 2XQ3A 5ABGA 3CF6E 3C3VA 3UT0A 5JTGA 4L9BA 1C8NA 2VBDA 3VBOA 2VZTA 4CDQB 4C91A 4Q4W1 4JAAA 4KUMB 2WNUB 4NE9A 5JI9A 2M6BA 2KU3A 4UW5A 2DL1A 4MO3M 3CVRA 2BZDA 2B9UA 3VD4A 3LFMA 1FT9A 4UFJA 3JQWA 1V6IA 2YVRA 1LB2A 4QKDA 4WW0A 2P17A 4LPLA 1JYTA 3T3YA 3NZQA 5EHDA 4MGZE 1YKEB 5FK8A 4P9XA 2A3DA 5TAOA 1VBB1 2IVIB 2XJUA 2HWC1 1CAUA 1PVXA 4XUNA 4HGAA 2DCYA 3MGUA 2YZ4A 5JMOA 2KWKA 4CU6A 3M3EA 1MQTC 3F2EA 4CCMA 4BM8A 2CHOA 3PUHA 3FX3A 4XBFB 4DINB 2VPEA 1B09A 3R4SA 4UFMA 3O1UA 4G63A 3VZMA 3AP4A 3FZHB 1G73A 1BQPA 2BYVE 2R1BA 4MSXA 3T09A 3HBKA 1I6XA 2FUPA 1UIJA 2X51A 1QH7A 4N43B 3LG7A 4S3OB 4XCAA 1BK0A 1Z7S2 3ZM8A 2L7PA 2MA5A 1F8VA 4M00A 2WNOA 4UFIA 4IE6A 3I3BA 3WNNA 5LBEA 1AL0G 3W58A 1YYNA 4G9SB 2Q8EA 2LW8A 3ZFEB 4QHBA 5SVIB 5FMNA 3GZAA 3CHXA 3C51A 2EHOA 1UKRA 5D8AC 1C8M2 3I59B 2XG3A 2ADDA 2Q4SA 2K3WA 3ZX7A 2N1GA 5CA6A 2YU1A 4HONA 2OUHA 4XFBA 1UOGA 4R9CA 2B0OE 2QNKA 5FWJA 2A72A 4Y5Z0 4B4QA 3AE7A 2P5BA 2VKOA 2WT1A 3CKHA 1UUSA 3NRXA 4U2YA 2KWJA 2ZX1A 4NIIA 3NQHA 3ZFGB 1GICA 3CQGB 4LKSA 2JDYA 2LKHA 4Q0PA 2ZGSA 1WD3A 5G05L 2PHTA 2FJEA 4YHHT 1JNZA 2EIGA 4YLZA 1SE7A 2NMNA 1Y9GA 3WAKA 2XQ6A 3TN93 4UT5A 3KCXA 4S2GA 3UT5E 1WD4A 1OVSA 5A3TA 5LEKA 2WQZC 3VB9A 3BALA 4C1XA 3AZZA 3K8PC 4BYYA 5LCWL 3AMHA 5H6RB 3MICA 1WEOA 1OSGA 4JI3T 5BNOA 2LEHA 3UUBA 3OY8B 4UYBA 2XASB 3AEEA 4Q26A 2IXCA 2BDEA 4Z0RA 2FFWA 3IEEA 5HEOA 1CZTA 1RITA 3ZSMA 1BEV2 3OJBA 1YLLA 1IQDC 5C70A 1WEVA 1WW4A 4BOWA 4AXOA 3TBDA 5C8CB 1S2BA 1RHI1 1AL23 5JCTA 2VVSA 4HFEA 2W08A 5DMYA 3PUQA 1N3PA 3KSCA 5KC5A 2VAUA 2X29A 1VRH1 2XQXA 3ZXKA 3M3CA 3C7HA 1JS9A 3VZOA 2XLAA 4JQTA 1ULGA 1VBD2 1PNFA 5I0RA 5J1XA 1LOCA 4WM7A 2WBKA 4E4DX 1HFAA 2NW9A 3IM0A 4GMP1 3FUQA 4IHJE 1DU2A 3S4UA 2Z5WA 5FIXA 2Q5TA 5L2LA 1W05A 4HWHA 3VBHC 1AJ3A 3UKVA 4LF7T 1CX4A 5ANNA 2G19A 4BQYA 4OHFA 1FIOA 2VCAA 1YRZA 4M4PA 4QHZA 3WXPA 3V0BB 2K16A 4LR4A 5I93A 4WVWA 4BXSV 4MALA 1XNCA 1J1TA 2YXSA 2N9DA 4HEAA 3ZYMA 1SFNA 1WLTA 3KINB 3J7NA 2XY8B 3NKTA 2VD7A 3GF6A 1POV1 4Z2WA 3INAA 2P37A 1GOFA 4DUYT 3PUIA 2RS11 3EHZA 3S5AA 1NLQA 3RJRA 4EZHA 3PE0A 2HWF1 4HFCA 2KSRA 2D6KA 3AYAA 3VDAA 3MZHA 2VU9A 2CONA 4EEBA 1JBCA 1QQP1 2JDZA 1ZRIA 4YVWA 4CDWB 3SWHA 2CDOA 1OQEA 4P00B 3R0RA 1FMD2 2J1EA 1DQ0A 4KQ7A 1NE6A 4GWIA 3PHDA 1WGMA 3IAPA 4QX7A 3EHKA 5FUNA 3LBXA 2XBO1 1VBA1 1YC61 5TDRA 3NWKA 1RMU2 2WDRA 4JRAA 5FO8B 1JYXA 1CAXA 4Q1PA 1G9AA 4Q4V1 5K0UA 4XACA 4AI2A 4KP3C 5LA1A 4PPEA 3NJYA 4O8SA 4UIGA 3E6DA 4UBGA 5CFCB 4K1YA 4YSXA 3UKTA 4ZS2A 2IDOB 1QNYA 4BHWA 5JPMB 2H89A 3GN5B 1PM4A 1AX2A 5AQLB 2KE1A 5JIUA 1DDLA 1UZYA 5J7MA 2XAGB 4W6XA 4AI6A 4JCKA 3MZKB 1W6MA 1Z8UA 1ZM1A 5HCJA 5FBZA 4NHLA 3GALA 1H6YA 3HNMA 3PUGA 3RZJA 3DF0A 5JG6A 2XQ4A 5HXEA 1XNDA 2ETEA 3LRQA 4NXMT 1SLBA 1ODNA 4B4PA 1RUE2 4UV9B 3T08A 5SVXA 2RDQA 4ANJA 3USSA 1J58A 1CZVA 1D7PM 1OH3A 3FLPA 3U5OA 2D9DA 4AXPA 1W3VA 1HNZT 1FX5A 5IFTA 3BTAA 5ABJB 2VQFT 4Z8BA 3OTFA 2UYAA 2V4VA 4DEVA 2IXLA 2GP5A 1X8EA 1IKQA 3LIGA 5FZOA 2FCTA 3T0BA 2D6LX 3ZPOA 2W94A 1QMJA 3UUMA 2VXJA 1RUJ3 3ZYKA 1SHWB 3UULA 3WP6A 4GYSA 5ABFB 4FXKB 3Q8CA 4AEMA 5E89A 4PI2A 4XUOA 5JDQA 4WZ3B 1CQ9A 3RHWA 1TMF2 1GKBA 2BBVA 1OF4A 1MS9A 5DG2A 4BQXA 4CI1B 3A7QA 1JYWA 2JDPA 2YUEA 1JYVA 4OGEA 4YW7A 4Q4X1 3WDYA 4E27A 1S94A 5K4LA 2WUHA 3UTKA 4LMJA 5BNNB 3ZMUB 1DQ5A 4Q27A 1AYM2 2YDEA 5J1GA 1E4UA 1V9U2 2J4GA 4JLEA 1SBEA 2V7IA 1NYWA 4I0WB 1GWMA 1X79A 2D3SA 3N7MA 2QVAA 2VKHA 2W39A 2W66A 1VBB3 2JQQA 5JOWA 5JR7B 2CV6A 1HR0T 4CDXC 5J2UE 2UYBA 3ZT5A 4P9WA 4K21A 4XETA 2MNYA 4B3NA 3HKEE 5FREA 4ZXLA 4PQQA 5HBAA 5EWSA 3PVEA 2F4VT 4ZS3A 2R0HA 1BKZA 1V87A 3OOXA 1FOD2 1WMDA 1XSQA 3A21A 4PIZA 4I7CA 4XFCA 1OEDB 3WQ0A 1O3XA 5GLTA 3B94A 4COUA 4Z90A 2IXIA 3SH5A 1OKQA 2KD7A 5ABEA 2V5DA 2XSBA 1N32T 4GULA 2Y60A 4CZSA 2DCKA 1OT5A 2W9XA 2IAKA 3GNEA 3OBRA 2BJSA 3I2OA 1Q43A 4ARYA 1SLLA 3U07A 2AEZA 1QEXA 4L8QA 4QPWA 2VECA 4UF0A 2YY1A 1SFPA 4YJ3E 2ZCWA 3KS7A 2EXJA 2M3HA 2DVAA 4QPIB 4AKRB 3WSOA 3MXZA 3AA0B 1UOBA 4O7XA 3DXTA 3KCCA 3AE2A 4HXCA 3E6BA 5T50A 3MDBC 4PK5A 3RTRB 4FFFA 1AR71 3OGJA 3ZN6A 2ZMKA 2Y1NA 2ZM6T 2H0DA 4PCRA 3GBWA 2WSSV 2BFUL 2BU9A 2RDNA 1H2KA 3DECA 4YZ2A 3AX4A 1L7LA 2Y38A 1ZEEA 3N3HA 5L47A 1QJY2 2UXXB 4V3KC 3USUA 2IXHA 2YFUA 2WNVA 3O7OA 4ZZBA 4JKMA 1UYXA 2ZS6B 3M7AA 5AFEA 5F6KA 4QQPA 4AVTA 3RYCE 4HLTA 2VW0A 1F4HA 1W2UA 5E16A 3O36A 5A3PA 1NLRA 5F8PA 5FPUA 4FK5A 1HB4A 4HZFA 2XMLA 2VOVA 3ACFA 4PT6A 4MGKE 3DL3A 3PTRB 4CXXA 1RL3A 4HKWA 3BI3A 5IAVA 1HRV1 4HT1T 2VOKA 3AFKA 4AGGA 3NMBA 2RDSA 5FUIA 3U4SA 3VBFC 4UI9L 3VBOB 3CIHA 3RH3A 1VBD3 3LD8A 1OC1A 3IIAA 4I2OA 2CPTA 1YFUA 3HQUA 2H3RA 4DR7T 5IW0A 4XBNA 4PDWC 4LADB 2KINB 3LQHA 2W1WA 4DY3A 4AI8A 2BPA2 4I01A 4H9RC 2V4AA 4FOQA 1NQJA 3T2TA 1GP5A 4QXCA 5FY5A 1SEFA 4GAZA 5A3MA 1R081 1O4ZA 3CQXC 4R9DA 2WSVA 1K12A 3ZMNA 2YDSA 3C7FA 3N9LA 4E4SA 1VYXA 4X64T 5I0TA 2X9XA 3RNSA 3LJUX 1RHI3 1STMA 3S0MA 1VD4A 4S2HA 2EIDA 1NCRB 4BA9A 4QHOA 1MS3A 2YOEA 4DNDA 2WSUA 3WX5A 1U4QA 1NKGA 1W8WA 3POEA 1AR82 2AXDS 1LKNA 3KNVA 3OGSA 4N9IA 4BIFA 2Q9QA 4XJAA 2JE9A 2BERA 2VMIA 5JDLA 2LSGA 2FBEA 1WCKA 3ZMTB 3LEKA 4XBQA 4XMIA 1D0GA 2RR11 4QPYA 1O7FA 2BAYA 2E9XC 5IUXA 4CA1A 4IW3A 4W65A 3OBAA 4YTPA 1CIYA 1FMD3 4N4FA 5DG1A 3WF1A 1CIWA 3F95A 4LF8T 2VUDA 2WO7A 5IWAT 2V7JA 3GL6A 1UF2C 5CIRA 5FKBA 2XGXA 1JTZX 5FYYA 5JZGB 3CZUA 4XAAA 4COWA 1RMU3 2JG9B 4TXWA 1AR92 2Q8DA 1POV3 3CX8B 4EGWA 3T7LA 4LUKA 2ZM2A 2RS13 1W6QA 1LHOA 1SDDB 3ZFFA 2VR4A 3W59A 2HWF3 1UCUA 4IETA 1ZKEA 3ZYQA 4XTPA 4ISTA 1IS6A 2DV9A 4H9OC 4BQ4A 2AN6A 1ENQA 1QJU3 2VNGA 2YC4A 2D5UA 2VMCA 4INDA 3AAIA 2LV9A 3M3ZB 5B75A 3ACGA 3FHQA 3RWKX 4PJJA 4EAHA 4GKXA 2YDRA 3OF1A 4AKGA 1WW7A 3CJIA 4YSZA 4YGBA 4DV4T 1XDOA 2WAUA 5FXXA 5KR7A 2ZEZA 5DAQA 5I0DA 4RHV2 1VBA3 3LDYA 2L9LA 4NIHA 4LHLA 2CHNA 2R071 1KK7A 3UU3A 2HDPA 5JRCB 2WC2A 4Q4V3 3I49A 4YJ2E 2XLGA 3QH7A 4AEJA 5AVAA 2C4XA 4N8MA 5AQIB 1GP4A 4XBLA 2JIWA 2WBLA 4CSWA 4K0KT 2MUMA 1DF0A 3RJ2X 4A5XA 3RYKA 4CCJA 5FZCA 3BIWE 2YSMA 1PO21 4BK5A 2P2KA 2ZAHA 3DYOA 3FHAA 4IV3B 1H8TC 2EXHA 2A71A 3WP5A 2CXDA 2RJ2A 5IK8A 5L4EA 2D98A 5FMOS 4AW7A 4I30A 4WZFA 5F5AA 4F6RC 2UWBA 3K48A 4O9GA 4YYOA 4M1PA 1EV11 4AF9A 3MLLA 5TDWA 5C3SA 1VBC2 4IEWA 2KR4A 1IPKA 1Z0PA 3IA3A 3L3PA 1PO12 5D21A 4PLMA 5C4WB 4V1PA 3RZHA 4Z0OA 4GNDA 4YW2A 4P0AA 1MS4A 5GONE 4TWTA 3H0OA 2BBHA 4COYA 3PIGA 4IV1B 1SBDA 4ISQA 4OGCA 5CISA 1GZCA 4LBOA 5LCWB 4Q2FA 4RR3C 3ZMSB 2Z4FA 3LK3B 3I2HA 3FHNA 2VNVA 3HR9A 1PK6A 4TKPB 1C1LA 2ZHLA 4OI2A 2ZM0A 5AQPB 4DUVA 3B5LB 2O8OA 3IF8B 4Q4W2 2VZVA 3GBGA 2LKGA 2DUQA 1J5WA 4PFOA 4TNVA 1EUUA 4JGYC 3VZLA 5FLHA 4AI9A 1UY0A 4LO8A 2GP3A 3E97A 2RHPA 1Z2QA 2IXKA 4OUEA 4A7YA 4URAA 2C26A 4IQPA 1NCQC 2ERFA 4Q4X3 1DGRA 3Q9OA 1YFYA 1D4M1 1F4AA 3Q5EA 2PBIA 4KHZF 4Q8KA 4QPGA 2A9UA 1O59A 3ZR6A 2YROA 3VD7A 5J37A 3KV5A 4B4RA 2KREA 1LEDA 4XIOA 4YVWB 1W2NA 1FNYA 3AECA 3ZVZB 2P1BA 1EP0A 4A0CD 1WEWA 3IT8A 4LF4T 2K5BB 4NOTA 1I9RA 5JUVA 5K3QA 4JC1A 1X9BA 3JADA 1N34T 1QLBA 4TV8E 3H8XA 4HWFA 1YHFA 3V0AA 2FDJA 4JX0A 4QX3A 3UU8A 3J7LA 1JYIA 2ECVA 1MM3A 1FV2A 2X0LB 5LXTE 1NE4A 2R32A 3B7MA 2MA6A 1NA1A 2N7GA 1VP6A 1MNEA 4AHZA 2IDAA 4XDPA 2W4XA 3O1VA 2CE7A 3WNOA 1KFUL 1QNWA 2C5DA 1F15A 1LCLA 4I50E 4F52B 2VE1A 4OULA 1O8SA 4PHZA 3RMXA 4LKFA 3D6EA 3RYHE 2YN6A 3TYJA 3A4UA 4LF5T 2A6YA 3OBTA 3MW3A 4BB3A 3AE9A 3FM8C 4MADA 4YFSA 1WESA 1C57A 2PJQA 4WVVA 1RIRA 3QC9A 3H8OA 1RUG2 5A33B 1DZRA 1WW5A 3FBYA 1WBFA 1HG5A 5FV3A 1AR73 4BLIA 1UURA 3H7YA 2NAAA 4AQYT 1M7KA 2E33A 1KXGA 3H9AA 3BQKA 5KXCA 4IT4A 1SLAA 3EAMA 1O6UA 2RV9A 4FFGA 2I59A 3I3EA 4QXHA 2Y8KA 1GSLA 2FUIA 2J62A 4XDOA 2HPLA 1PGL1 4QU2A 2H88A 2VZPA 4CDUA 1VMFA 3NKZA 1B35B 2XJPA 2ORXA 3M3QA 4EN6B 4YWAA 3SUBA 2A6VA 3J4UH 2YKSA 3OPTA 4AIUA 2B1EA 1U5XA 1VB4A 3C7EA 1UPIA 4LT5A 2JXAA 2TUNA 1JZ2A 3VKOA 4EN9B 5C11A 4MGYE 3K3OA 4PAGA 2Y6LA 2I45A 3JD73 4B7EA 1K42A 5JAXA 1PZ8A 3RDIA 4LBQA 4N43C 5AVPA 3WVJA 1KEXA 2GNMA 3BTZA 2GN3A 3D0SA 2D0UA 5FTTC 3JZVA 1AX1A 3AVSA 3T1HT 1HQLA 3QLQA 4ZI3C 1LAJA 3O14A 1WBLA 2XB1A 3CQCB 5FP3A 1R8IA 2E63A 4CE8A 1PVC1 3VBSB 3A8YC 1R083 2Q1FA 3LA2A 3CEWA 3KZ4C 1KEYA 3I3QA 1POQA 4UW3A 1OPOA 1W0OA 1XYPA 3AZVA 1CD3G 4ASKA 4UW4A 3ZIWA 3FFZA 1GZWB 2E26A 2J1DG 4HKAA 2RMU1 3Q8AA 4FAHA 4U7YA 5IHRA 3AA6B 2OPKA 2YPDA 1RUI2 2XTLA 5BNPB 5LK5A 4Q4Y1 3O47A 1Y64B 3C50A 2RR13 3TLUA 3NV2A 5CNAA 3P3PA 4DV3T 2P4EA 1HNXT 1AJOA 3O9XA 2VL0A 3MW2A 3A0NA 3VKLA 2Y6XA 2KIZA 4RA0A 4O4LE 1DFQA 1XYNA 5AQVB 5L7OC 5H9QA 4ZZ8A 3K77A 4FTEA 2LSKA 2E51A 3GHNA 3I2DA 4OUMA 2I07B 4EROA 2RM21 1ZRRA 5JI7A 2LSJA 5FZGA 2LTNA 2XAFB 3PURA 4BJNA 1QF3A 4N7IA 5IK7A 1OOPB 4Y3OA 4O2AE 3CPZA 1EAH2 1RB8G 3QD6A 4AFAA 2C5KT 4LNVA 3K2OA 4C0HA 2RJLA 1C4RA 1PMHX 3PUYF 1FPN1 3UYJA 1XWHA 3L2HA 4I0AA 2ODVA 2E31A 4HK8A 2O0OA 3KLSA 4CA9A 5BYNA 2Y0IA 2HWD1 4V2VA 2GMMA 5EJ3A 2WZPP 1OUSA 1JHNA 5F5CA 4XHXA 1RYYA 2VJFB 3MIEA 3OPZA 5C8CC 5KXBA 3IHPA 3V65A 2UU9T 4TYSA 4BJ0A 1WA4A 2D97A 4CEWC 2BDRA 2XQ9A 4IDOA 2R073 4DUZT 2FCVA 5HEGA 3ZXGA 2ZGOA 5KHKA 2YURA 4DR5T 1UU5A 4HPKB 1F5FA 4PLOA 3AB3B 2Y64A 4O2BE 2OS2A 2YG0A 5JXHA 3EI0A 5EYAF 4MX3A 1SG3A 3ZMZB 1OLMA 3OEAA 5C9AA 5J96B 2KXPB 4HFBA 3ZSKA 4XQ4A 4CU9A 1LVKA 2VZQA 3EYPA 1H2MA 1W0PA 2PXJA 1A78A 2QQJA 1E5SA 2UUAT 2KFTA 2ATFA 2AYHA 4KMCA 1T98A 2BG9A 4ZDTA 2HN1A 3NAPB 4EEDA 1EV13 5HYAA 3O1JA 2PHDA 5D1MB 3MIHA 1UWWA 3RC8A 5C3QA 5GLVA 4CUAA 3ZMOA 2V5CA 1OF3A 1SPPB 2LGVA 4B1MA 1OHFA 2A75A 1GQGA 2OXQC 1BMV1 1HTJF 4EN0A 1LHNA 3KM5A 2WO1A 2VCMA 4HN9A 4QB1A 5F3CA 1CAWA 2QQMA 1ZBE1 2L3LA 3CBNA 4UOJA 4IIJE 2MEV1 4QU1A 4QB6A 5A3NA 1YIPA 4JI0T 1ASJ1 2XM1A 4UP0A 4KG0A 1KFXL 1MMNA 4PIXA 5JOYA 2J1TA 4UV8B 2FDHA 1W8HA 2BZBA 3UQ4A 3J9X1 3JB8A 2W1QA 1I6ZA 3NNGA 4HBNA 4ZZ5A 3ZOIA 5C33A 4JDOA 3ITQA 4EYUA 2ZA9A 2XEUA 2DCFA 2Y6GA 4N53A 2DVFA 2ZZJA 1X36A 1ND3A 4AQ2A 1XQNA 1EUTA 4RS5B 4I3PA 4Z92B 2FD4A 3VK6A 2KGIA 1RGSA 2AUYA 3BTXA 1ULCA 1D4M3 2WCAA 3QBQA 1J5ET 1RXFA 5FXVA 3C8XA 1XSRA 2RVAA 4KI5M 4I3GA 4DMIA 3CZJA 5JDMA 2IC6A 1KS5A 1LRHA 1DP0A 2HPJA 3WHUA 2VC9A 2WS92 4XAXB 2ZJCA 4GWJA 3SRZA 2LJLA 5JVVA 4E7SA 3DKWA 4BU2A 4L99A 3IMMA 2HWB2 1W09A 4P9YA 2B8MA 5AQMB 5FDBA 2CT2A 2WQYA 4LE4A 2XJTA 4XILA 1KNPA 3CIRA 2WDQA 1G6NA 2E5VA 4P02B 2MBGA 4JI6T 4JI7T 3ZVXA 3VBUA 4EXTA 2D6MA 2VJEB 3FBZA 4Y1YA 4IEQA 5FERA 1VCSA 1XDPA 1ZZ7A 5EYXA 3RMYA 1Q8PA 3I7DA 2ZGTA 5LGTB 4F7ZA 4HFIA 3ZT6A 1NWMX 1NXD1 4OHZA 4Y26A 5A3UA 4I55E 2GC2A 2XP0A 2LHRA 5DDJ1 3FWEA 4NIDA 5FZ8A 4MXVA 2VP7A 5LATA 1RUOA 2ILMA 2OW4A 3K1SA 1RXGA 5A7OA 2ZX0A 2P3KA 2HH9A 4JGZB 4B86C 4UEMA 2CBIA 1HB2A 3LEIA 1K5MA 2CKLB 2ORZA 4B6XA 1H0BA 1YXRA 3FUOA 3CJXA 5M4YA 5H1TA 1UQXA 2H0VA 1FATA 4TSVA 1GMMA 3KFWX 3SISA 4YM3A 4FOYA 2CBJA 4BWOA 2XAHB 2A6ZA 4JI1T 1GLHA 3ETPA 2IW5B 2HBUA 1ZBA1 1K3IA 4UP5A 4QH5A 1JODA 4R4XA 4JTOA 1VCTA 4YZ5A 1R092 2JKBA 4A6OA 2EAAA 3RZGA 4YADA 3QH6A 2IFRA 3FJUB 3MPBA 2D5HA 4QDRA 5A32B 1DZQA 4AG4A 2ARAA 4HG6B 4WM8B 5EYYA 2NOXA 4KU8A 2A70A 1HXS3 3H3MA 4CDQA 1W8OA 4COVA 2WNUA 3L8RA 1ND2C 4HKOA 3G6JB 3RYIE 4DXZA 3PTYA 2JIGA 3BCWA 4JRLA 3AXDA 4IUGA 1L0VA 2WL1A 4N90A 4ZY9A 5FZ3A 1S55A 1IHMA 2QDNA 4EWEA 1VFYA 3AAEB 3WEZA 1JM7B 3L9JT 5J48A 1C5IA 4KU7A 2FDFA 2HEYF 3ZVYA 3I2KA 2V7MA 4KH9A 3VKMA 2MTQA 4MG2A 4CEYB 4KBZA 5KBFA 1RUF2 5KHHA 3BUCA 1OEDC 3JB4C 5I0UA 2X5IC 2XQ8A 4PJLA 4CN1A 3SQOA 5FMCA 4XXAA 4GH4C 3A5XA 4XEZA 1MS0A 3FFQA 4QX2A 1LHWA 2RJKA 3O35A 3OJAA 2F6JA 2HHHT 4HMZA 2ZHMA 4E2SA 5C71A 3LOIA 5AFUL 4XJZA 4BE3A 1I5PA 5EZYE 4IE7A 4G2AA 5C7GA 2MKEA 3VKFC 3RPQA 4JKKA 4QKBA 4L7XA 1EPZA 4IEZA 5F3EA 5CFDB 2XOYA 2BP6A 3ETVA 1PVC3 1QGLA 3VBRB 5AQFB 1P8JA 3QK6A 3AZXA 2K9ZA 4RQPB 5H9SA 4XW3A 1QXPA 2Q30A 3LSEA 3VDDB 3CLPA 3LPGA 4TWHA 4XUTA 1KNRA 5FPXA 2YB7A 3AYDA 3RWNA 1HN0A 2ZHKA 2W0XA 4D0QA 3GXUA 3JC6C 4BA6A 4EV6A 1EY2A 2D8SA 2QIZA 3ZFEA 3N9PA 1WRDA 2WWSA 3WF3A 5FVLA 5SVIA 5FK7A 4NIQA 4AQFC 4DV0T 4NXNT 2L75A 2LRLA 2D44A 2NR4A 3AL5A 3THCA 3KHCA 2VG9A 5CKQA 3I59A 3L1ZB 1XE8A 4Q4Y3 1WLDA 1O3QA 3TLWA 3WD5A 2R041 5FUPA 2LXHC 4QF3A 2XJ7A 5CZKA 3AE3A 1LENA 2GC3A 3AMQA 4F83A 1WE9A 2A7AA 2FCUA 1A8DA 1N3OA 4UR9A 4EV0A 3J7HA 1T1HA 3SC7X 4FPYA 3T1MA 3AJYA 3SFEA 4AVVA 3DPRC 2UWCA 3UK9A 3NJVA 1R1A3 1ZREA 3POGA 5DABA 1IKPA 4IERA 4WVMB 5B4XA 5L3EB 3ZFGA 5EJ1B 2G9ZA 2D3PA 4U7IA 3AL6A 3BU0A 3VBOC 3HR0A 5EZWA 4IC2A 3T6RA 1KS4A 2E2AA 1UAIA 5ERLA 4CU8A 3ZYPA 1JXNA 3TWIA 3HA4A 3GWHA 5T5LA 1UO9A 5J98B 2B9VA 4KX6A 3MKDA 2V6XA 4NUVA 1W3XA 4AEDB 4QKNA 3WCSA 4AKHA 4QF2A 1TEIA 4B8EA 4CDUB 5LKXA 2OT7A 4O62A 1PO22 3OY8A 4YSYA 5A3WA 2JEMA 4CVUA 1W9YA 2CWYA 1SLCA 4MFRA 3VDCA 5CBLA 1XB9A 4O9EA 2Q8CA 5L9VA 1H9PA 5C8CA 2ZGRA 5FL0A 3QCWA 2C0ZA 3QB5K 4UAPA 1PGSA 4RYDA 5G04B 2GNBA 3ZYLA 4DEQA 2N2NA 1V6MA 2A73B 5HI0A 4P14A 3RPGC 4MBQA 2WT2A 2E53A 4TWDA 1VOMA 2DVBA 2GMPA 3WNXA 2WZHA 3I0QA 2BUKA 1UCXA 2LSYA 3OGVA 2H6CA 5FZ9A 1IJ6A 3H1MA 4AAPA 2GZWA 4A6SA 1WFKA 4ZEYA 2CAUA 4AI0A 1L3JA 3O1SA 4CU7A 5A1AA 4IL4A 1U5IA 3VZJA 1M62A 3B3QE 5HXCA 2BV4A 3WW4A 3BIEA 2X0YA 4QQ4A 4MHRA 3V0BA 1IGOA 3U37A 1F9KA 1GP6A 3VKGA 1F31A 4HK9A 3WDUA 1SDWA 1H2NA 3U3IA 2YQMA 1QDCA 1XWMA 4XF3A 3UU4A 3FBMA 4L0RA 2F17A 3ZPVE 2A6WA 3O1RA 2E7AA 2WFF1 2EHOC 3PL0A 1VBE1 1ZBE3 3OPWA 3RC3A 3ANWB 1IS5A 1MS5A 4LIUA 2R061 3PDYA 3ZN4A 3RVHA 3LVRE 2CGPA 2EXKA 2ARCA 2WZR2 5GM0A 2H6BA 3ZJ2A 4M3CE 5J0ZA 3EMRA 1QU0A 2EODA 2RS51 1HIXA 3CKDA 3T8OA 2DUPA 3O0XA 4CDWA 1BLZA 3TLTA 4R9AA 1BYHA 2WS93 4D6SA 1QJX2 2ZKNA 3WUDA 2JKXA 3ACIA 2ZABA 3JXSA 2YYOA 3SOWA 2CTVA 1CAVB 3A23A 2Y1MA 2CA5A 3ZXDA 2ZGNA 3W15B 3IB3A 2C6SA 2BRTA 1PIV1 2DWGA 3U14A 3Q8EA 2GH2A 2ZGPA 2PUYA 4LHSA 4PW8A 2V6YB 3NVOA 1YWKA 1X50A 3Q9DA 2IC1A 3VD3A 2NW7A 5C2TA 1UNBA 1AZDA 4EZ4A 4ZKTB 2QQIA 4QGMA 3UGHA 3K4DA 4XXPA 2RA1A 2DFBA 2IMLA 5CFCA 2FZ2A 3H50A 1S0EA 2Y0OA 4G4FA 5FOJB 3IN9A 4X6RB 2Q1MA 3D4KA 4XF0A 5BNOC 2LXPC 4EN7B 3GN5A 4A4CA 2W2IA 1W39A 1AR62 2QDRA 3N2GE 4ZPIA 4AI1A 3R05A 4LMLA 3OGRA 4GNGA 5FY1A 4KWUA 4UFLA 2NP0A 4YVSB 2X0HA 1MVQA 1RVF3 4SBVA 3B02A 3NO8A 5CEHA 5EIYB 3MBWA 2JENA 5J2TE 3ZXFA 1US2A 5CA0E 3T0DA 3I1AA 5TRBA 5KHGA 3PJQA 1AL21 2LGGA 3J8F2 4WM7C 5ETWA 3TNQA 2DBIA 5DPNA 4C8DA 5DUXA 2X9YA 5A7SA 1WW6A 2OQ6A 1R093 5ABJA 1UOJA 3VHOA 1JZ3A 2HKXA 2L80A 1BHGA 3KT1A 1GZ9A 5D1KB 2ACZA 2VPGA 3UNPA 2IQJA 4G3YC 2V7LA 3LK42 4YLHA 4XABA 5T3NA 5LASA 4PBPA 3PUZF 3SOLA 4AVSA 3VD9A 2AH2A 3J7Yq 5LMUT 1JH5A 5LHIB 1Q8QA 3ABZA 3KB5A 4AAXA 4IREA 4ZI7E 2XL9A 1AYN1 1WUVA 1QXRA 1MS8A 4B1LA 1B7TA 3N36A 3HNBM 2LRKA 1ZBA3 5BUVA 2J42A 1DLCA 4CP2A 5LRSA 2K2SA 1GNYA 2BKOA 2B45X 4QKFA 5AQJB 2DUOA 4D94A 4Q0UA 4K40A 2WT0A 3NKGA 4IEOA 4RGKA 2VQAA 1J3QA 3C6WA 2QQOA 5CKMA 4YVWC 2GC0A 2PMWB 2KWNA 1HRI2 5JXIA 3W5NA 2R1DA 1WCRA 5HXVA 4HFDA 1GQEA 5BNNA 5I8TA 1JMUB 4RGAA 5C5UA 1KJRA 2VM9A 3KGLA 4BIOA 3IPVB 4JI8T 3EBRA 4H9PC 3UETA 3WNMA 4UVBB 2C9KA 2W1SA 2F42A 5I0SA 2A3WA 3LDQB 5DQ0A 1JOBA 5CKNA 3DXUA 3CL1A 1MQTB 5K0UC 2JDAA 4LFCT 1QOOA 2FZ1A 4U72A 1FI2A 2VZ3A 4AVCA 4MLKA 5LBCA 4YZ1A 4YXDA 3VHLA 1W8NA 3ZCIA 5AQQB 3EXUA 4Q1RA 3VL9A 5FP9A 1REDA 1JW6A 1ULDA 3KQ4B 3RRWA 3FZMB 3ZKRA 5FYUA 4A3ZA 3ZSLA 4OQ9A 3TLSA 2WN3A 3CU7A 5AC91 2PQQA 3KCYA 3PUXF 2LGKA 3F57A 2FMDA 1D1AA 5HV0A 2YMZA 2PLV1 2DCTA 1MMDA 5EQUA 4ZI2D 3PHMA 2PNXA 5LB6A 1ZNPA 1HQNA 3POYA 3ZLIA 4LOTA 4QPIA 4RL7A 4GB0A 2HWE2 4A42A 4RN5A 2WQ4A 3VU7H 5D8AB 1WLXA 1S35A 2GNDA 1MBMA 4I7DA 2X8KA 3IDAA 1SFYA 2XUEA 3IKWA 3J7MA 4IGQA 3P7IA 4LMFA 3GV4A 4PFPA 3LB9A 4M3CF 4GB31 2F6NA 2I2SA 3RGLA 2K4DA 4W50A 4J2CA 5DN2A 4Y1UA 2XKPA 4AVXA 2WAAA 2D40A 2R043 2YW8A 1OD3A 1IBLT 1HLCA 1APNA 2CL2A 3OUIA 3O33A 3AKRA 4R52A 4D7YA 1FPN2 4QQOA 4ISSA 5F1RA 3K3QC 3ZC1A 1Q8SA 3BODA 5FZFA 1HW5A 3P1IA 5M0TA 4AGVA 4KMQA 1OXZA 2OYZA 2VURA 1WEQA 1YUDA 5FYTA 4H7MA 3BN6A 3MFCA 5JSRA 2Y33A 1KF6A 3RI8A 3R6SA 1WMXA 4GALA 1IQAA 2OWAA 2P3JA 1G9FA 3R84B 2EGMA 1U0AA 2NM1A 4ILCA 5GZFA 5DAVA 1H9WA 1YFWA 5GZDA 5IYYA 5A3LA 1H2LA 2BVBA 5JIAA 3ALQA 2WP9A 4EYYR 2W2UA 2X68A 4OK0A 4OQ8A 3GHMA 4YG0A 4BXFA 1NY72 5FYSA 1Z7S1 1PGW2 5LJNA 2D93A 1XOYA 1O4YA 3MLJA 3ZC0A 2L43A 4A4AA 4YZ3A 4UVCB 1NCRA 1LKXA 5JXJA 2A1XA 4N3WA 3QUJA 3NNJA 3I8TA 2WU2A 2BG9E 4A56A 3V56A 3TEYA 2QICA 4WZ2A 4GJYA 4CI2B 3VBHB 2C1FA 4UBHA 4TTGA 1W8FA 5DUVA 3M4FA 2C24A 2XQ5A 4L97A 4AFCA 3P3NA 2ZHNA 3LPFA 5EK4A 1C8M1 1VALA 3MF9A 3HVDA 3K4ZA 4MV2A 4LK7A 4NRPA 2CLYC 1GQPA 3A22A 5DINA 1W6NB 4CRQA 1PZ7A 1QJX3 3WT3A 5A6YA 2BS3A 3B9CA 4PI0A 1HB3A 4B3TT 1G8XA 5IK4A 3VLBB 1RUNA 3DPLR 2WLPA 1WEEA 5JZGA 2JG8B 1RUC2 5EXOA 2G9FA 1BVVA 2JG9A 2BNNA 3DYPA 2WFF3 4MGIE 4YW4A 1VBE3 3ZN0B 4D3WA 2E9XD 1CGPA 4I02A 3JQXA 4LXLA 2R063 4AWDA 4DQAA 1YJLA 4MVTA 4LLOA 1UXXX 4AL9A 4BLJA 2HJIA 2RS53 5IK5A 4FXGB 1WWYA 4W6WA 5ADXL 2WNVC 4TX5A 3OYWB 1LGNA 2VMGA 1NXMA 4LOSA 5L36A 2J7MA 1FV3A 1AR63 3VRAA 2E8IA 2Y6JA 4B3MT 3PNAA 1DCSA 2QBXA 3HT1A 5H9MA 4Y24A 5SV5A 2CWOA 1PIV3 3ZCJA 1N87A 2NTYA 1WCQA 2VTXA 2VCBA 2LLYA 4CZZB 3RIAA 1VJ2A 5FYCA 5JRCA 2MNGA 3ONJA 1BEV1 1WZXA 4KHPT 3VUOA 1UYYA 4C0BA 4XAEA 3ZYIB 4C9ZA 1YIFA 1GQHA 2UUCT 1COV2 4IGPA 5FPLA 1UZVA 1VB2A 1WEUA 2ECNA 4BQWA 2UY8A 1QHDA 4IV3A 2VQUA 5L9RA 1S1AA 1VBD1 4JHZA 2P57A 4TZ4C 3RSJA 4I4TE 2I74A 3WG4A 5HAXA 2RI7A 5LZ6A 2SPCA 2M6IA 4DXRA 4BAYB 3WNLA 3LKJA 2VUAA 4FQ4A 4L58A 1ZA7A 4Z07A 3RZZA 2A3XA 5C4WA 1OFNA 2L5UA 5FLIA 4HOOA 2K17A 1O3RA 4Y33A 2JICA 3LVQE 4JEUB 2ZTNA 4YHJA 3E1F1 2VO5A 3UKNA 1E2AA 4AYUA 3N7LA 4QMAA 2Q9QC 1LODA 5FOBB 2AACA 4NN0A 4IV1A 3T1LA 4J25A 3WF4A 1CWPA 3AKQA 3SCHA 3LQCA 3I2IA 3E6CC 1E7PA 5SVYA 1C3HA 3PUWF 1HCIA 4PK6A 4BMBA 4S2DA 2ZEWA 4AQ6A 4H14A 2Y8DA 4D69A 1JU3A 5FZ1A 2JIJA 1PX4A 1QY4A 2YK0A 2R0FA 3OUJA 1XNBA 4C1WA 1AYN3 2Y26A 5FMOL 2AEYA 3OYXA 3OTOT 4P9IA 3H3ZA 1XMOT 2ZGKA 4BQ1A 1FMD1 5FXWA 2IXJA 1N1SA 4IESA 1SCRA 4JEHB 1OPMA 5DZFA 1DYKA 3PLWA 1ZOYA 1I94T 3ZFFC 2K9AA 1ZZBA 2MPFA 4V2WA 1XNRT 1RMU1 2YHNA 3HCSA 1Z0HA 2W91A 1ONAA 2XXZA 1OUXA 2EICA 3UJOA 3I3MA 1OURA 1UMIA 4WA6A 2QFEA 2PYTA 3OPCA 4UW6A 1L7RA 4YW6A 3QOFA 5AQGB 3EO6A 4H3WA 1GOHA 1QJU1 1T6GC 3AB0A 4NIGA 1BBT2 3CJIC 4IEUA 5A7WB 5LOVE 5KXJA 4CDXB 2CEAA 5AQTB 1DLLA 4BQ3A 4LHNA 2LUWA 3WG3A 3ZXJA 3C4WA 3WF2A 1D1CA 2EA6A 1TME2 4OHYA 1N1YA 5J3UA 2WO2A 3AYCA 1HV1A 1CESA 3ONXA 2QTWB 3MO4A 1UW8A 3NRUA 3FANA 2HN2A 1UXZA 4FPJA 3BB6A 4LJNA 4YC9A 4LIVA 5CB4E 3AP6A 3MF6A 4NN2A 4Q0VA 5A7NA 3NBXX 4UVAB 1RUE1 2JECA 5CU1A 2RDRA 4JV4A 1YFXA 4OI1A 2DDUA 4O61A 1O8PA 1W9WA 2ZLYA 3PJAJ 1G7YA 2RSDA 4AFDA 3RI5A 5AC93 2DJAA 5JR9B 2ZZQA 2DBNA 4AQSA 1X8MA 4YTNA 1J1LA 4YW3A 2DWKA 3ZPYA 2PLV3 3ZSTA 2QQVA 4ZU7A 1W04A 4U33A 5FYVA 3ZYHA 3LA7A 5HWYA 3GM8A 4FPEA 2WWUA 5DZGA 2EXUA 2W61A 5IVEA 4HL0A 4WV8A 1YEWA 4LLFA 5A33A 5LBBA 4RD7A 2XJVA 4W4UA 3HEIA 1TMF1 1GWLA 3WDWA 3U4XA 3RKOA 4ZU5A 2LQ6A 1D2QA 2JJ6A 3F31A 3BPZA 3URFA 1XC6A 1PK6C 4GMP0 2W46A 4GB33 2VBPA 5JSOA 4NPLA 1U5YA 5B8DA 3DYMA 4DR1T 1MEC2 2VQ0A 4FPLA 1G9DA 4B7YC 5FP8A 2KXLA 5C3RA 1W9RA 1B35A 4GWNA 2X9HA 4IEXA 2KM2A 4NUBA 3TLVA 3MLKA 1MMGA 4AYCB 2W62A 2VULA 2W63A 4OHWA 5FB1A 4XDQA 4FIPA 5FZ4A 4NIAA 2QJVA 2GALA 5L73A 4X62T 4QPGC 1TG7A 2W95A 3VBFB 4KWJA 4CP1A 2FDGA 2PAEA 4DZGA 2CCQA 1WYBA 3ORJA 1US7B 5T54A 1J84A 5E88A 2UXDT 1CHUA 1RUH2 2VMHA 4V1Av 4XOGA 2ZX4A 1FOD1 3J26N 5K8SA 4YATA 4Y20B 2A2FX 5T5OA 5FY0A 2VL4A 4JKLA 2GAUA 1GV9A 3UL2A 2DSMA 3OG2A 3H7HA 2KWIB 4AKIA 4ZONA 3FN9A 4OLLA 4X8PA 3E5UA 3VBSA 4KGQA 3UUNA 3B9IA 1VPHA 2E6RA 1JYNA 1IS4A 3AVRA 1Z7S3 4P9LA 5LJMA 1ZBDB 4JI4T 2Q1ZB 1NA1C 4N78D 2JQKA 4ZI3D 1Q3EA 2EALA 1CVNA 1GZWA 3ZEFB 1UZZA 3AXJB 5KC6A 4OYJA 1W2TA 4K6BA 3V43A 4FCAA 3SXWA 2B4KA 5BNPA 2E9XB 1LNSA 5A80A 3GDBA 3VDBA 3AFGA 5FZDA 1C8M3 2XVKA 4NWVA 2ECTA 1WCUA 4YNIA 2WN2A 1F5JA 4YARA 5FJKA 4AKLA 4AP4A 5T5PA 2GC1A 1QJY1 5LNKA 4AQTA 1S2EA 3PVNA 1KQRA 2J1AA 4XF9A 2W87A 4GK5E 2OA5A 1UX6A 1UY2A 2BQPA 4XTMA 3HWJA 2QQKA 4OX9T 1RINA 3TOJA 2HYED 3JAEA 4XFFA 5K7PA 4IEPA 1UX7A 4LKAA 1OOPA 4UXAA 4QQHA 3VD5A 2ZX3A 3P8CD 4Q5OA 4CDUC 2XQ7A 2VW2A 5C8WA 4NAMA 3AK0A 5FQ0A 1YO8A 3SEEA 1YXWA 2FDKA 5JR2A 3DEMA 4XJ9A 1S0IA 4R7EA 2PFVA 2PTMA 2WQ8A 3TN92 4QT6A 2Z42A 4XZPA 2OVUA 2VJFA 1T7SA 3KVAA 3OCPA 4QH1A 2P3YA 3L1XA 3SCGA 1FBVA 5FMDA 4GKJT 1E1HB 2XSAA 1H4HA 4DR4T 3O1MA 1DYOA 1AXZA 3THDA 1BEV3 2PG8A 4X5TA 4J6GA 4HPKA 1LEMA 2DWRA 4YM1A 5FPBA 1H8TB 2Z69A 5FO7B 4FPFA 5FBJA 4PJMA 5IT6A 3JD71 4HVOA 5FY8A 4CTEA 1Y9MA 3ENRA 4DV5T 3MIGA 4LITA 1WKYA 4HTEA 3SLIA 3ECQA 1AR81 1SA0E 2XDVA 4ES8A 1J1JA 3AP5A 2VUJA 4HN0A 1LOGA 4D7SA 3NAPA 4FBFA 3W9AA 2BNMA 4LFBT 3OBZA 2BVMA 3H3AA 1NZCA 2OUJA 3TEZA 3TB0A 4DR2T 2OPWA 4Y5TA 1SPPA 1QDOA 3U5MA 2V26A 3OYZA 4XUQA 4XZUG 5DAXA 3LQIA 1FYUA 3H1YA 3KD4A 2NPIA 2YQLA 3MK7C 4M0HA 1H8VA 4JI5T 3M62A 2PHRA 1W99A 3B69A 1D0YA 3P4PA 2VPBA 4QH4A 1TZOA 4RR3B 5FKYA 2W00A 3HKCE