3PURA

Cekdm7a from c.elegans, complex with d-2-hg
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
515
structure length
483
Chain Sequence
PKESDRCGGCGKFTLMSKKKSHHHKKNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKCVPHTGHSIRYKVVAPHRYRWYSPNEKHLGIEVGSKTWIEDFITRENTVPSPTDDEVCIVEDGYEFRREFEKLGGADNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETSPDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEANQEGSDMREQEKNIWTASQIMKAEMERWMDRELRLGPEKNAILPTDDKNKIMISVRKQIEIQTKIQNAKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oncometabolite 2-hydroxyglutarate is a competitive inhibitor of alpha-ketoglutarate-dependent dioxygenases
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 7 homolog
total genus 148
structure length 483
sequence length 515
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3purA03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3purA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3purA01
3ZNIA 4DIQA 1CHCA 5FPAA 2F6NA 2L80A 4S3OB 4B86C 2GP5A 1DVPA 4IGOA 1FBVA 2YUCA 4CCNA 5FPUA 4LK9A 4FO9A 5H1TA 2G45A 1WGMA 1V87A 2JMDA 4L58A 3M99A 4QWNA 5FY1A 5FYMA 5FZMA 5FYHA 4TN7A 5DINA 4Y4RA 5A7WA 4CSWA 2KR4A 3GV4A 2QICA 5FPLA 3C6WA 3LQIA 1HYIA 1WEQA 5IW0A 2OQ6A 3U4SA 4D6QA 2XEUA 3RTRB 5ISLA 4GNFA 1Z6UA 5A7PA 4HONA 5FB0A 4CA1A 4AI9A 1K2FA 5KR7A 3DQVR 4BBQA 2CT2A 2FUUA 2YQMA 3PU3A 2PUYA 4CCJA 3VK6A 3RVHA 3N9QA 2YURA 3M63A 2CSZA 4YC9A 4ZDTA 4I7DA 3C5KA 5EYAF 2KE1A 2XUEA 2KWNA 4QX8A 4FIPA 4IC3A 2Q8DA 4LLBA 2K4DA 4XDPA 2LGGA 5FP8A 2F42A 3PDQA 4F52B 5C13A 4X3GA 1WEUA 2GP3A 2K1JA 5B77A 3U78A 4WZ2A 5H1UA 2VJFA 1T1HA 2G6QA 1WEVA 5FYCA 3L11A 3OPTA 5TDRA 3O35A 4YADA 5B75A 3KV5A 5LY2A 3LQHA 5F2SA 4ZUXU 3AVRA 4IC2A 3HCSA 2Q8EA 3AL6A 5FP3A 5FZIA 2ECTA 4LJNA 3ZTGA 4CCMA 5FUNA 3MHSA 4NN2A 5A80A 2XDVA 3K2OA 4AP4A 4YBSA 5FY4A 4A4CA 4QXHA 4IGPA 5FXWA 3ZVYA 2MNZA 5FZ8A 3HCUA 5FY9A 3U5PA 2OXQC 5H9MA 2HYED 5FZKA 2OX0A 4Y3OA 5B78A 2D8SA 5G04B 4PPEA 1VRBA 4V2VA 5A7WB 3PU8A 2G43A 4W4UA 5H1VA 1WEOA 2MD7B 5FERA 2K17A 4B7YC 2Y1NA 5FXVA 3M62A 1WEEA 5LKTA 2MIQA 4YABA 4AYCA 5FV3A 5FY7A 2L75A 1WENA 2KGGA 5FWJA 2YQLA 5FZBA 1JM7B 1WE9A 1WFKA 3PUQA 5FPBA 3AL5A 4D6RA 5FZGA 1X4IA 4XDOA 3RPGB 4GD4A 3ZPOA 3EB5A 4I7CA 5F39A 5FYIA 4NUBA 2XXZA 2ECWA 5KH3A 2C2LA 4AAPA 3DXTA 3KVBA 4PTBA 3PUSA 2BAYA 5TDWA 2JRJA 4R2YA 2LXHC 4QF2A 2LGKA 4AVXA 5A3PA 5G0FA 4QXBA 3L1XA 5FP7A 5FYUA 2OS2A 2ECVA 5A3TA 2XMLA 3NJYA 4A4BA 2WWUA 3GL6A 3MHHA 2LN0A 3N9OA 2ECJA 4R7EA 4UI9B 5A7NA 3O70A 5B79A 4UF0B 4V2WA 2VPEA 5A1FA 2XB1A 4WZ3B 4EYUA 1F62A 3IHPA 5FZCA 3N9MA 3RPGC 2HDPA 5FPVA 1WEMA 4MSXA 2YPDA 1LDJB 4YBMA 5LKZA 2P5BA 5LW9A 2MUMA 5FZ9A 5FYYA 2YBSA 4URAA 4GNDA 5FXXA 5A7SA 2M85A 3LQJA 3ZVZB 2YSJA 3U5MA 2WWJA 3ZLIA 2VD7A 3UYJA 5D1KB 5F37A 5ANQA 2ZETC 3KVAA 2YSMA 5B76A 3EB6A 5FZDA 2KWOA 1U6GB 1ZBDB 2AN6A 4FJCA 5FWEA 5FB1A 2KWJA 1JM7A 5FUPA 4N4FA 4QX7A 4FK5A 2ECNA 3SHBA 4EZ4A 2OT7A 5D1LB 1FP0A 2E6SA 2JMJA 2QIZA 5A3NA 2VJEB 5IVFA 5FJKA 2Q8CA 2VJFB 3KV4A 5FY5A 2LGLA 2M3HA 4L7XA 2MD8C 5LKXA 2KYUA 3PURA 3N9NA 3SOXA 3T7LA 1LDKC 2YU4A 5FYVA 5A7OA 5F5AA 4I7BA 3O37A 2NAAA 3O34A 3N9LA 2YHNA 4A49A 4ZQLA 2RSDA 5FZOB 2CKLA 5FYTA 2H0DA 4V3KC 5FP4A 2E6RA 3L1ZB 5G05B 4S3OC 2LDRA 1VD4A 3ZPV1 2KWKA 2L43A 4QU1A 5A3WA 3PUAA 3DXUA 4LITA 5IVEA 3HTKC 2CKLB 2CSYA 2L0BA 2LV9A 5FP9A 1N87A 5FXZA 1Z2QA 2C2VS 5KH7A 4Q6FA 1Z60A 5FJHA 4BISA 2YREA 2KGIA 4GJZA 3KNVA 5J3XA 5FYZA 4BU2A 5F5IA 1HYJA 2IDAA 3LRQA 4EZHA 4C8DA 1X4UA 2VNFA 5LKUA 1WIMA 5F2WA 2LRIC 3PHDA 5IVVA 5FZEA 4CCGX 2H0DB 5I3LA 5FY0A 2MA6A 3O7AA 1IYMA 5IWFA 2VPGA 5CEHA 5FZOA 4BHWA 2KREA 3O33A 3U5NA 1WEWA 5F32A 4AUQB 3LD8A 5FYSA 2FSAA 5LWBA 2LGVA 5FZ0A 2VP7A 5LCWB 5D1MB 2MT5A 4AYCB 2UZGA 5F3GA 4QXCA 3SOUA 2VJEA 4UP5A 5LY1A 4CCOA 2M6MA 2YHOA 3LDBA 5AIUA 2YU1A 2PNXA 5FZLA 5AITA 3OPWA 5TRBA 5FZ4A 2KIZA 3ZPVE 4GB0A 2ECGA 4GNGA 2MA5A 1E4UA 2M1RA 3DPLR 3ZYQA 5FZ7A 5TBNA 4V3LC 3PTRB 5IVBA 5B8DA 4LIVA 5FYBA 1RMDA 2ECIA 5FZ1A 2FUIA 4IGQA 4UF0A 2JMIA 4GNEA 5FBJA 2MNYA 3V43A 2VPDA 4CCKA 4CUGA 2I50A 2YT5A 4YATA 3K3OA 5A1LA 3KV9A 1XWHA 5FEYA 2KFTA 2YW8A 2EGPA 5E6HA 3SOWA 5F3IA 1G25A 4O64A 2OQ7A 5FZ3A 5A7QA 5F3EA 3N9PA 4LADB 4UP0A 3FL2A 1JOCA 3U5OA 5C11A 1WILA 5IVYA 4QF3A 4YBTA 5TABA 1MM2A 4LKAA 4CCLA 5F3CA 3NG2A 4HOOA 5JG6A 3I2DA 5K4LA 4ASKA 3HCTA 4D6SA 3KV6A 3O36A 4C9ZA 2KU3A 4BXFA 2Y1MA 3K3NA 1X4JA 2EODA 2QJ0A 2YU2A 1BORA 4WA6A 1WESA 3AVSA 4WZ0A 2EA6A 3KQIA 2YBKA 4N3WA 4LXLA 2K16A 5FZ6A 1WEPA 3ASLA 5FZAA 4YAXA 2Y43A 4GJYA 5FZFA 3T6RA 2RI7A 5F5CA 4MVTA 2F6JA 5FY8A 5IVJA 4A0CD 4R8PK 4XI1A 2W2IA 2DX8A 1VYXA 2LXPC 1VFYA 4LIUA 5FZHA 5KH9A 2LQ6A 2PXJA 2YBPA 5IVCA 5DKAA 1MM3A 2L5UA 4DO0A 4GAZA 4Y33A 2YYRA 4P5OB 3QZVA 4TKPB 4E4HA 2VPBA
chains in the Genus database with same CATH superfamily
1YNAA 4B86C 4YW1A 2RR12 2V5DA 3POWA 3U3IA 4AVBA 2XQ7A 4QM8A 4LK9A 2DUQA 3ZT6A 2VMDA 3VD5A 1MS0A 1ND3B 4PW8A 5FZMA 1NLRA 1KK7A 5FYHA 4G2AA 2XAGB 2CE7A 2ZX1A 5EYYA 2CONA 2B46X 5DZGA 1CAWB 2D40A 2VZTA 2LM2A 4D6QA 3IAQA 1I6ZA 3WD5A 1QOTA 5J98B 1MIWA 2RJKA 4SBVA 3PU3A 5A6ZA 3AZYA 1JOJA 4R52A 5IATA 2KKXA 1JYNA 2VH9A 4E8DA 4CE8A 3ZFGA 2Q0AA 4LMLA 2YN6A 2Y6FA 2DJAA 2WFF3 5B77A 4GXLA 5H1UA 3EUHA 1ZZCA 1WEVA 3H3MA 3W21A 2XAHB 1ZBE2 5A3MA 2Y26A 3N2GE 5SV5A 3FC0A 2FFWA 3ZR5A 1S55A 4B6XA 3UJQA 4YJ3E 4NOTA 1T98A 4E4ZA 1CZVA 2N9DA 4XE9A 4LKEA 2AREA 1OF3A 1YJLA 5CNAA 4B7YC 1DU3D 2DBIA 2LW8A 3WW3A 2KXPB 2J1SA 4FSJA 4LF4T 3TOJA 4AI0A 5C8YE 2KGGA 3M3OA 1JM7B 1H2NA 4IHJE 4N43B 1UX5A 1ZRIA 2C26A 4P0AA 1NYWA 4KH9A 2CCQA 2ZM8A 2WP9A 3GCWA 2DCJA 2V73A 2LLYA 4YLHA 2XJVA 3OBVE 2DTYA 3FN9A 1BVP1 3I2KA 4EWEA 1S0FA 4LE3A 4XQWA 3VHRA 3AFGA 3F2ZA 5L3CB 1N47A 1Y9QA 1QXJA 3OTOT 4XJWA 4YGBA 3POJA 4X6RB 2WZPP 5LJNA 4HANA 3RKOA 2QUOA 4EJRA 1LDJB 3O1RA 3CJIC 4CCCA 3H3UA 3D0JA 4AEKA 5IK8A 2V6XA 2B0OE 2WJSA 3HIFA 3R0RA 2IC1A 4CDXB 3LA7A 2VD7A 3VBSA 3RIFA 5AQQB 2V72A 5BMVE 3DL3A 2JG9B 3QH7A 1OLQA 1K45A 1PZ9A 3SH4A 3I2JA 3KDEC 2Y6KA 2KWJA 1ZBA3 1A34A 1IKPA 3TEWA 1F4AA 2XQXA 2ECNA 2FCTA 1GZ9A 4NXNT 4CP9A 4TYSA 3UQ7A 4NR1A 3CQXC 4XBNA 5JR7B 2KMFA 1YIFA 4BH9A 2L8KA 1G7YA 4GWJA 2VJFB 2UU9T 4IEZA 3U10A 5FY5A 5J37A 2M3HA 3VZNA 1GZTA 2JX9A 2KYUA 2JEMA 1NEKA 2GDFA 2W1SA 2O8QA 3RIAA 2VE1A 3MACA 2ZX3A 4FAHA 4CDXC 2W52A 3VKNA 4XAXB 3VBRB 1PX3A 4AKIA 3CWZB 3W5MA 3GGLA 3L3PA 2NTYA 2B42B 1F8VA 1WUVA 1Z2QA 2G9ZA 1Z60A 2BZBA 4BA9A 4COWA 4PLOA 1S0JA 2W1UA 2XHEB 2XQ6A 2IFRA 5AC92 2HH7A 2XH6A 2A1XA 4A4AA 5HWYA 1OA2A 1QUUA 3DWDA 4YXDA 5SVIA 4D94A 5LXTE 3LVRE 4PJYA 3E08A 1AHSA 1YFXA 4K0KT 5A33B 2ZAHA 5DN2A 1NXMA 3ZMOA 2J47A 2X0YA 1OQEA 4UP5A 2M6BA 3S4UA 4NHMA 4XBQA 3LDBA 4CA9A 4JI4T 4CPBA 4TWHA 4LORA 1KNZA 2Q9QB 5FAXA 5ABJC 4ERRA 4GWNA 3O1VA 1W06A 1OEDC 2QDRA 5FYBA 3K75B 1OA4A 3KV9A 3AEFA 1QJY1 5JAXA 4AIUA 4Q4W1 3C98B 2FZ1A 2EXKA 3C4ZA 2KD7A 4LKSA 4S2FA 4OI1A 1UWWA 1WGPA 3NG2A 2ZA9A 5JG6A 2LHNA 3LQCA 5FMNA 3SNMA 4AVCA 2VL8A 1YD8G 4IEYA 4CDQB 4LXLA 1FJGT 4LF6T 2JDMA 2PHWA 1GKBA 5LA0A 4MVTA 3THPA 2BBHA 4ASLA 2W2IA 5IVCA 3LVQE 1Z8UA 4TZDA 3FBLA 3AXEA 4HFEA 5JDGA 1Q8PA 4UWDA 1YW0A 1URXA 3WAKA 4YSZA 1M7KA 4NPMA 1VJ2A 4K9SA 5CG9A 4A3ZA 3HQRA 3Q5DA 3M2MA 2XWJB 2A3DA 5KHIA 5DINA 4BOWA 2PJQA 3GZAA 4H14A 3N7LA 2WWSA 1NY72 2CXFA 1OI6A 1S0BA 5C5TA 3EB7A 5EFUA 5C8CC 3LCPA 4HONA 3E6CC 3IT8A 3TEYA 5KR7A 5E0OA 1WWYA 2BKPA 3Q1DA 2VK9A 4E2SA 4I7DA 1YQ5A 4LBNA 1DQ1A 4GH4B 4Q27A 2UYAA 2F6BA 3MICA 1XQNA 4H9SE 5DQVA 1M62A 1SACA 1KFXL 3N35A 5DAPA 3KV5A 2FUPA 4PHZA 3AE6A 1VBB3 1CWPA 2LS6A 1Y3TA 3AL6A 3HI2A 5FZIA 4LJNA 4C0HA 4LO4B 3S6PA 2ZX0A 1OXCA 2UUCT 1KFYA 3AP4A 5HCBA 3I2GA 3VBUA 3J7NA 1CGPA 3AAAB 3X1DA 5TSWA 2VZSA 2W47A 4EXTA 1LHVA 1MVEA 4YGDA 5C70A 5FERA 2V6YA 3THDA 2QGSA 2ZX4A 3KGZA 1VAVA 3MIDA 4HFVA 5DUUA 4H2AA 1AYN1 2DWRA 4IV1B 1JMUB 3GJBA 3POSA 3NVOA 5LBMA 5IYYA 4NUBA 2CLYB 5JSPA 4ARYA 3PUSA 4IV1C 5IK7A 5CG8A 2JG8B 3O0VA 3BALA 4QXBA 5FQ0A 1BBT2 2OS2A 3SMHA 3NJYA 3I49A 3O47A 3WDUA 4I0WB 1MMDA 1NQJA 4HWDA 4QAWA 1X50A 4E8CA 2IXJA 4PQQA 1IQAA 3I59B 2V6YB 3DJBA 2YZ4A 5DQ0A 1UZVA 2YPDA 1I1EA 4ONUA 2BQPA 3RH3A 1Q8SA 2A6XA 5CA1E 2LALA 2FDGA 3OEBA 1WLTA 1HX8A 3L9JT 1NZIA 1RUG2 4JGZA 4QH5A 5IT6A 1CX1A 3SWHA 3LPGA 5DAQA 1Q8QA 4KG8A 2Q9QA 4KBMB 1QJY3 4RA0A 3AKPA 5KMGP 3IMNA 4CDWC 3X29B 5CAZA 1EUTA 2KXLA 1FP0A 3ORJA 2FD4A 2WSVA 3FHQA 3WUCA 2YKSA 1WCSA 4TV9E 1XE8A 1LRZA 4LT5A 2OA5A 1W8FA 4CRQA 3ZXGA 2YHNA 3FZFB 1BKZA 5FZOB 2CKLA 4B8EA 2BFUS 4K20A 1SQ4A 2XQ8A 3I7DA 5JR9B 1KXGA 4QXCB 3GMIA 3SXWA 3KD4A 5ACA1 4MHUA 1FMWA 1EYBA 3DXUA 4XBFB 5IVEA 4PDWC 5JRCA 4XCBA 1APNA 4IEPA 2YREA 2ZM2A 1US3A 3AMQA 4O65A 1UUSA 1WBLA 2LRIC 3PHDA 4U7IA 3T2PA 4CP1A 2B1EA 1RUF3 4ZONA 2EIEA 2R7EB 3KHBA 2KREA 3GA8A 2W1QA 3IPVB 5JTGA 3TAYA 2OYZA 1PGSA 3Q5XA 4C90A 1FYUA 4QXCA 4LBOA 1GP6A 2H6CA 3BODA 4NUVA 4H9QC 4BQ4A 3GN5A 5A32B 2PA7A 3WXPA 4GKJT 4GNGA 1JXNA 4BXSV 3CX6B 2VQUA 3UU6A 2VZVA 3KCXA 4LLFA 3PTRB 2BFUL 2K9ZA 1SPPB 3O5SA 3SITA 1QDCA 3I54A 2MKEA 3LEMA 1D1BA 3NNFA 4YATA 4LO7A 5BNPA 4CI2B 1U4QA 1UN1A 2AXDS 3SOWA 2E9XB 4I3GA 3ZO0B 2JDAA 5F3EA 3LA2A 3FL2A 1JOCA 2QVAA 5GLUA 4QQ4A 2I59A 1I94T 3VBSC 4GH4A 5LGTB 2ZXQA 2CRWA 3V5SA 2EGMA 5K4LA 5T5LA 4TLFA 4HWIB 3KV6A 2PQQA 3ONXA 4Q4Y2 4NIQA 3MZKB 1X7NA 2BNMA 1OBNA 2KT9A 4HFDA 1RB8G 4O4HE 5HCHA 1D1AA 3T2QA 3BTYA 4MGZE 1RUJ3 1CAVB 4YSFA 3BB6A 3O0WA 4QPYA 1Y9MA 1W28A 1VFYA 4O4IE 2LUWA 2ES0A 2AC1A 3VBOA 2RJ2A 2L5UA 2CSVA 2GN7A 4MH0E 2X9HA 3ZT5A 4DFSA 2FCVA 2CRBA 4K0UA 4P9JA 4NE9A 1BHGA 1HDKA 5FPUA 4LPLA 2PHLA 4PFPA 3MO4A 3ZFFA 1O3TA 4A2UA 4TN7A 3SFEA 2IDOB 2CMRA 2HWF1 5T5PA 1DBNA 3A23A 3AP7A 4XJAA 1W6OA 5IW0A 1HYIA 2R043 4AQTA 5L2LA 1DYOA 1BLZA 1OHFA 2PTFA 2H6BA 2YQMA 4HPKA 1QJU2 3VD3A 1O7FA 1UIJA 2XUEA 4OULA 4B3NA 2CGNA 2PLV3 2JQQA 2DCTA 4LQRA 4K1YA 3LE0A 4I0BA 4OVEA 2K1JA 3FZMB 2W61A 5ABFA 1PZ7A 3T1HT 3OPTA 1GOHA 2F17A 4NXMT 4QX2A 1GNYA 2VNGA 1IPKA 1GNHA 1UX6A 1E5HA 4XIKA 4PI0A 5L9VA 4R8HA 3TBDA 1Z0PA 5DMYA 3JUEA 5HXRA 2ZGKA 2V1DB 4BWOA 3OB8A 4QKDA 3MW4A 3POFA 4KMCA 5ABGA 3S0MA 5BNPB 5B2GB 1W2NA 3ZYIB 2JQ9A 3NNLA 4JLEA 3GJAA 1EPWA 5C8CB 3N2KE 5K0UA 1U5ZA 5CB7A 4H9PC 3JADA 3NMBA 3TEXA 3R6SA 4NMIA 2W0GA 1FT9A 4AGVA 1GLHA 1W8WA 2EIBA 2DVDA 3ZKRA 1UYYA 2V7KA 4YARA 2C2LA 2WC2A 4GALA 3ZM8A 1EP0A 1QOOA 3MYXA 1G9BA 3CJIA 4ZZ5A 4UOJA 1VBC2 3OY8B 4RR3A 5JSRA 1QGLA 3T2OA 4A4BA 4QPGC 2WWUA 4R9BA 1H4GA 3R84B 3RG0A 4XJ9A 3MLLA 2K5BB 4CVUA 4EYUA 2E7TA 3J8F1 1WD4A 2VJXA 1MS9A 5D8AC 3R4DB 1W05A 4LEJA 2Q1FA 4BIFA 4GWMA 3RZJA 5D2AA 3IIAA 3VKFC 4EN8B 2YSJA 2ENRA 2V5CA 1IS5A 5ANQA 4I0UA 1JBCA 2IQJA 4TWDA 1ZBDB 1ZNPA 1WLDA 2JD4A 2WFF1 1H9PA 1QQP3 4YW2A 3ILFA 1DZQA 3BYWA 2WQZC 4IEWA 3TYJA 1Z78A 3MI8A 3LFMA 2VCCA 4NVPA 4A49A 2ZGUA 1MNDA 1H8VA 4EEBA 3E0ZA 2WZIA 3GDBA 2WNUB 2IIUA 1RJ7A 3AKQA 5DJQC 2NN8A 1RUH2 4DR7T 5FXZA 5HI0A 1LTEA 1SDDB 5DAXA 1HYJA 5IK5A 2WFPA 4K3UA 4IREA 2ZEZA 2H0DB 3SUBA 3CK6A 1YYNA 4DY3A 3HA4A 4B3MT 2YGMA 4ILUA 4XFHA 2YHJA 3AMPA 1VBE3 1VRH3 1H4HA 3KT4A 3V0BA 3USSA 2UWAA 2B76A 2D6LX 1JH5A 4JRLA 3O1IA 1R083 3DPLR 5TBNA 5LMUT 4ZY9A 1TZOA 2A9UA 4A98A 2ECIA 3PUGA 2Q8OA 5FBJA 4CUGA 3GZUC 1LODA 4HN0A 4MGQA 1YKHB 4XXPA 4IL4A 4LF5T 4IQPA 4A42A 4LADB 2BZDA 2YFUA 2IC9A 1N34T 4XURA 1J84A 4OHFA 4CCDA 1HXS3 5HEOA 4Z2AA 4HOOA 2JPFA 1POV1 3TLTA 1HXS2 2Q5TA 1G9DA 2Y1MA 2WA4A 4ASMB 2RV9A 4XOGA 1SPPA 3K46A 5L3GB 4DV5T 4DEQA 5EPAA 4MGIE 1SE7A 2RI7A 5F5CA 5JI9A 1S0EA 2I0MA 2M6IA 4L11A 4R8PK 2QQMA 3QB5A 1AX1A 3H9AA 5FZHA 5KH9A 2VVDA 4BM8A 3BOPA 3DPRB 4CUAA 3TNQA 2IXLA 2K3WA 1RINA 2WQYA 3C64A 3F31A 1KITA 4DV6T 1RXFA 5BNOC 4L0RA 3BOWA 2BYVE 4M0NA 4L58A 5FYMA 5D21A 3M1HA 5LBBA 2WN2A 3IHRA 4HLTA 3SKJE 3E5QA 2DHRA 2A5ZA 5KC6A 5FQ0B 1PO23 1T2XA 4QX1A 2EHOB 2XEUA 4JKMA 1WBFA 5FOBB 4CEYC 4ATFA 1OLME 3ZSEA 4LO8A 3UESA 3AEBA 2W67A 4YRDA 4AZZA 1F5FA 2X5IA 2RDSA 3ZYKA 2WMNA 5EYAF 2KE1A 3B94A 3FBMA 2RMU3 1W9FA 5FP8A 2DCYA 4V1PA 1RUI1 1WEUA 4YZ3A 1DYKA 3CO2A 3VZKA 2YC2A 2D98A 2K46A 4CCEA 4PCRA 1GOFA 1YUDA 3H3ZA 1KF6A 3FHIB 2ZEWA 3IEEA 5FP3A 1N1VA 1V6OA 4B4RA 1XNAA 1REFA 3AXJB 5FUNA 3C3VA 4JI1T 1X79A 3E22E 1UY3A 3AEEA 3HMYA 5CISA 2VECA 4HFIA 3WF0A 5A7WB 1QNYA 3FL7A 2EICA 2DFBA 5H1VA 3MGUA 1LECA 2JE8A 4HETA 1S2BA 2VMGA 5TAOA 1AXZA 4XFGA 1E5IA 1AL23 2RS31 1H1IA 3T4HB 2AENA 1RMU2 2AEZA 4E4SA 3PUQA 4JDMA 3C8XA 3VGIA 4XDOA 3EB5A 4QPIB 2MEV1 4LLOA 1KFUL 4R4XA 4O4LE 3NBXX 4YG6A 1KNPA 1WFDA 4Q0VA 4OK0A 1UPIA 3P4SA 1SBDA 3H3AA 2JB4A 5FYUA 5AQGB 4GMP1 4LF9T 4A56A 1O4TA 1SFPA 3I2HA 4JYAT 2MAWA 2WSSV 5B79A 5LMNT 1WW4A 4XUOA 4CN1A 4DVDA 2XB1A 1IPSA 4RS5B 5FZCA 5K7PA 3N9MA 5FPVA 4BQ5A 3VDAA 4YPJA 2A3XA 4A6SA 4IL7A 5HXVA 3F2EA 3IDEA 2WS3A 5A7SA 4DV1T 3WF1A 2QYWA 1ACCA 3AK0A 3A4UA 4IE4A 5C7GA 4NHYA 2B7YA 4I01A 4XABA 3J7LA 2W63A 1Y43B 4UT5A 4ZU5A 2VVNA 1CX4A 4DUZT 1HNWT 3NW4A 1NUKA 4DR4T 1RXGA 4CEWB 3AE1A 1SLIA 1D0HA 2VJEB 2CDPA 2Q8CA 2X0HA 3W15B 2W62A 5FFOC 3PMEA 2YU4A 5FYVA 5F5AA 3N9LA 3IZOA 4Q8LA 4O4JE 1H8TC 4Q4X1 3BI3A 4YFZA 3CLPA 5L4EA 2E6RA 3QB5K 4FP2A 2RDQA 1I6XA 4KP3C 5EHDA 4IE5A 3KBUA 2BERA 2CKLB 2L0BA 1B35B 4H55A 1N87A 2HWB3 1EAH2 1YFYA 4HWHA 1HRV3 2Y6JA 3TLUA 2R061 2BS2A 3JCIA 4MADA 4EZHA 1V6IA 1GBGA 1X4UA 2EHOA 3R4SA 4M3CF 1W0AA 1BEV1 1OKOA 1XRUA 5I3LA 1O59A 1MR5A 1DHKB 3SLIA 1TME1 1IZNB 3LD8A 4XUQA 3WSOA 3FZ3A 5HXMA 2GNMA 3MA9A 1EZ3A 4AYCB 3SOUA 3RC3A 3CQGB 2GC3A 4AXOA 2PHXA 5LGNB 4CDWA 4YVSA 3VUOA 1AZDA 1UGOA 4WBOA 3RZZA 2OPKA 2CHNA 1RUE1 1K5MB 2FJAA 4IV3B 4HT1T 1DLCA 4LA3A 2J4GA 2QKDA 1PK6C 2ZMLA 3LSVA 3E6DA 5AQVB 4PIXA 4Z07A 3ZYMA 1K42A 4IV3C 1FEWA 1CAVA 1GU3A 4AG4A 4Q1RA 5FO7B 1HJFA 4QT6A 1YXRA 1WW5A 4GYRA 3UETA 3RDIA 1MEC1 3USUA 4BMBA 4NWWA 3T3YA 5F3CA 3RS6A 1Z7S1 3QUJA 5LJMA 2DBNA 1VRH2 1X82A 4R9CA 1TMF1 2QQWA 2AYHA 4I30A 1H2MA 4QQHA 1CPNA 3ESLA 3H42B 3RYHE 1FV2A 1DGWA 5JR9A 3O1TA 1J58A 2J1RA 2Y43A 3V0AA 2VVSA 2BG9B 4ITCA 4XZPA 4ZXKA 3RGBA 2XPKA 4COZA 2JG8A 1QH6A 4AHWA 4TNVA 2BNNA 2ADDA 4Q0PA 3NJVA 2PHDA 1NLSA 1GICA 5C8CA 2RHPA 1IS3A 2DSMA 2J7MA 3C2UA 3NKTA 4AI6A 3KSCA 1CQ9A 1NCRC 2IZWA 3RIUC 4JX0A 2C9AA 4H9OC 1D4VB 3OEAA 1AX2A 1VBA3 3DYOA 4AHZA 1I9RA 3MIGA 5EZWA 3IN9A 3TNPB 1WYBA 4GA9A 1QXPA 3GV4A 1PVC2 2CV6A 2SLIA 3CKDA 5IUQA 2JDKA 1UY0A 3H1MA 5KXEA 1W03A 2WT0A 2PUYA 3VK6A 4JVAA 3N9QA 4E7SA 2VNVA 4MLOA 4ZDTA 1S0GA 4HPKB 3FUOA 5BV6A 5J2TE 3EDUA 3PDQA 4YTPA 1SCSA 4X3GA 2ZEYA 4B1LA 2OVUA 5EQUA 2VUJA 1HS7A 4DV4T 1O8PA 3H37A 4KL1A 3ST7A 4XFAA 2XGXA 5H9PA 2XVKA 4AE2A 4IC2A 3HCSA 3JB8A 2Q8EA 2XJRA 5KC5A 4FAGA 2OKXA 4M4PA 3B5LB 5FY4A 3ZXDA 1OMIA 1N3OA 3E5UA 3NL1A 1RVF1 4MGTA 4ZI3C 3J8F3 4WVWA 3CZUA 3ZFFC 2AACA 1OPOA 2ZGRA 1QWRA 4Y1VA 2PAKA 5L9RA 3RGLA 3WG3A 5DXDA 5JDQA 4BDVB 1WE9A 2ZHLA 3CEWA 3HPNA 4PJLA 1X4IA 2D6NA 4UXNB 1X8EA 2BOJA 1PZ8A 1PNFA 3TN92 4FPLA 4FPHA 3O0XA 3I3MA 2PMWB 3AE2A 3FBYA 3KHCA 4BQXA 2R49A 2HEVF 2D9DA 5LOVE 1HQWA 1XDOA 5C2TA 5KWRA 2LN0A 3NO8A 5I0UA 2LSKA 2JDYA 5LCWL 3QH6A 1F62A 5LA6E 3LFIA 3RPGC 1WEMA 4MSXA 4YBMA 5LHGB 1OOPA 5FYYA 3JC6C 1IHMA 5C6CA 3AYAA 4YHHT 3NNMA 1UU6A 5C4WA 1N33T 5JDLA 3M3EA 2VW2A 5LNKA 2GC1A 4X1KE 5I0RA 2RE9A 4BYYA 5J1XA 5B76A 4GWIA 1K5MA 1U6GB 3FJUB 2UXXB 1E5SA 1CJDA 2UU8A 2JG9A 3VZOA 4BJ0A 5CKQA 4M3CA 1AL21 5IVFA 2LGLA 4TXWA 2G0UA 1JYIA 1KQRA 4OUSA 5A7OA 2WQ4A 4W6XA 3IDCB 1EV12 2ZMAA 3HD8B 4GQ7A 1UD1A 1QJEA 1NCQA 3V64A 5AQLB 3I2FA 2C2VS 1VR3A 1L7LA 1JTZX 3UU3A 2J1AA 2IDAA 3A7MA 1US2A 1EAH3 2VUCA 5LKUA 5F2WA 3AECA 4BZ4A 2V7IA 4AQYT 1IYMA 3O7AA 3M70A 3FUQA 3GBGA 1VBA2 2XONA 1JZ3A 4UXAA 2WO2A 1AR91 1YQ3A 4E7ZA 3LK3B 1KEXA 1E7PA 2NYYA 2XJTA 1UZWA 1IG3A 4PT6A 3PDYA 2YK0A 4KHZF 2XQ9A 2VWAA 4RHV1 3GBFA 1FPN1 2YROA 4Q1PA 1WW6A 5F6KA 5F5QA 2D5FA 3RYRA 3E1F1 1BR2A 3ZSJA 5JSOA 4MALA 2FD8A 3ETPA 5J7MA 3OD0A 1MVQA 5GM0A 3GZEA 1F35A 2EGPA 1VAKA 2K48A 2HEYF 2Z2SB 5BNOA 4MO3M 3I0QA 3AP5A 1ZBA2 3MK7C 2DVGA 1VBD1 2D6KA 1ULDA 1LENA 4MGYE 4TWTA 2D93A 3W9AA 2NW7A 4LOTA 2GH8A 3K3NA 1W0PA 4MXWB 3WDWA 2EODA 2Y0OA 4GIQA 3LEIA 2HJIA 4EIWA 5JREA 2HWF3 4N3WA 1RUF1 3ZYFA 1O5LA 2E9QA 3PIJA 1HNZT 1X9BA 4GJYA 2GSYA 2XQ3A 1SLTA 1RUI3 1V6LA 4J25A 4DXZA 4ILBA 4XF4A 3ZFEA 5HXSA 4NIIA 4OUMA 2R073 2QQLA 2PXJA 2ZTNA 4QHZA 3WY6A 4E4HA 3B02A 1NA1A 4YZ2A 3ZSMA 1JYVA 3WUDA 2VULA 1BYHA 3B5MA 5GONE 4G63A 3V0BB 4QXHB 4FO9A 3AE3A 4AKRB 1JOPA 5DAWA 4BB3A 5KXDA 5KHKA 1MS8A 2R042 4XFIA 1H8TA 1U5PA 4Y4RA 1O3RA 3ZPYA 2EIGA 3RX6A 1UCUA 4QHBA 3U4SA 3ITQA 4CP0A 1LHWA 3FEHA 2W08A 5C4WC 1IJ5A 1W6MB 3MUY1 1K2FA 4QQ2A 2CT2A 3CMLA 5CFDA 2Q4SA 2D3RA 3PUXF 4YC9A 3VR8A 4MGKE 2CEAA 2JDNA 3RQUA 4IEOA 4UBGA 4Z0OA 3USUB 4FFHA 4CUBA 4F52B 4CEWC 3JXSA 2GH2A 3PE0A 3AA6B 3ATGA 3F57A 5DUVA 3LQHA 4ZUXU 4LFAT 2XUMA 1FXZA 4Q4X3 1B09A 1BQPA 1A78A 2XVLA 2VNOA 4AKGA 4CDUB 4HBNA 2DYCA 3IKWA 4PAGA 4AP4A 1HKDA 4A4CA 3UUMA 3B7MA 4LHKA 4NWVA 5EJ1B 3WQ0A 2HYED 5FZKA 2OX0A 3ZMVB 1GP5A 3VL8A 5JDMA 4AQGA 4EN6B 1MEC3 2VG9A 3RWKX 2FJEA 2BP6A 4JDOA 3I59A 5JDNA 3U1XA 1OVSA 3RYCE 2D8UA 3OSDA 1HRI1 3ZDVA 2WZR1 5LBEA 3CF6E 3POGA 2JXAA 2RS12 2WO7A 1GQHA 3IMMA 1HN1A 2YXSA 2UURA 1ASJ1 4SLIA 4XF3A 2YB7A 4JQTA 4GZ9A 1XNBA 3KS7A 4QB6A 4KQ7A 2MTQA 1ZHCA 1DIWA 4QPIA 1LU1A 2QQKA 2Y6XA 2JIWA 4E27A 3KMHA 4EYYR 4PJNA 1BXHA 4UF0B 2TNFA 4O9EA 4OLLA 4HE8A 1IS4A 4NUUA 1PVXA 1HCIA 2K2SA 2PTMA 4ORFA 2WBLA 3ME2A 2D6PA 4YVSB 3ZVZB 4YG3A 5FDBA 3ZYRA 4YSYA 3B13A 1BK1A 4HEAA 3IB3A 3UYJA 5F37A 2BOIA 2D97A 2B4KA 3K51A 1HRV1 1V70A 5GZCA 2EXJA 2P6CA 4LO5B 5CB4E 4Y20B 5FL0A 3HN1A 3SHBA 3JBG2 4EZ4A 4TUYE 3W59A 2VZQA 2K24A 3MLKA 3LIHA 1ULFA 1I3HA 1XU2A 4O9GA 3WVJA 1DZTA 4H9DA 3T7LA 1N3QA 3ANWB 2BBJA 3O37A 1O3XA 4Y22A 2ZPXA 4MHRA 5IUXA 2HLEA 3OCPA 4PBPA 2H0DA 5K0UC 3P3NA 2ET7A 5FP4A 3IBPA 5C3PA 2EHOC 3WDYA 1UU5A 2KWKA 3MIFA 3WQ7A 5DPNA 5B4NA 1JNZA 4PNIA 5FP9A 3T09A 4YM0A 4HVRA 3SEPA 4BISA 1UMHA 2R071 3PNAA 4CXWA 1UQXA 2BKOA 4XF0A 5C5UA 1IGOA 5JOWA 1HNXT 5FZEA 2Z42A 5GZGA 5CEHA 1AYM3 1RUJ1 2XJQA 4H3WA 1GP4A 2SPCA 4U7YA 1FX5A 5F32A 3AMMA 2X9XA 3LF7A 1YI9A 2W94A 1DFQA 4UFLA 3AP6A 5J0ZA 4XMIA 2JIGA 2J22A 1LHOA 1W9TA 2RDNA 2LM3A 1VBB1 3LWCA 4MUVA 2WZEA 3FANA 3PTYA 1W8OA 3UKNA 4W8JA 4YVWC 4DXSA 1F15A 4AOCA 2NWBA 5FZ1A 3RF1A 4UF0A 4LBMA 3MJXA 2XASB 3V43A 2KKYA 2I50A 5A1LA 1XWHA 2PHFA 1UY2A 1FOD1 2DDUA 5AQIB 3KLSA 4A41A 3U5OA 1CN1A 2VU9A 2C0ZA 3Q9OA 2RM22 1MM2A 5AFEA 4CCLA 4Q4Y3 3WR0A 5AQTB 4D7YA 1K12A 1UAIA 1IQDC 4I50E 1X4JA 5FPXA 1W8NA 1AJOA 2XBO2 1M06G 1TNRA 1FPN2 4I4TE 4RHV2 2XWBB 2Z5WA 4GKKT 1JZ7A 5GZFA 5FZFA 3LIGA 1ULGA 4A0CD 4AFAA 1VYXA 4BQYA 2D6MA 2LQ6A 1PGL2 3K4AA 2Q30A 1K5MC 1MM3A 4M1PA 2CGPA 4D69A 2DCFA 3FB2A 4S3OB 3N3HA 5FKBA 3D3AA 4JTOA 3JB4C 4TTGA 3ETVA 3MPPG 4GK5E 2UXDT 4ZZCA 2VCMA 2ORXA 2Q1ZB 4F8HA 2VZ3A 3HEIA 4FFFA 3TB0A 4QD2A 2WM9A 4WBBA 3DYPA 4PJMA 3CX8B 2OQ6A 2D2SA 2HN1A 1RVF3 4YZ1A 1C8M3 2FUUA 4HN1A 1B35C 3DGTA 2YURA 2OWAA 2DNXA 3OGJA 1LR5A 4F83A 3ZYHA 3HT2A 2E2AA 1AL22 3VKLA 5KHGA 1WLCA 3NWIA 1CR7A 3NZPA 4FQ4A 5C13A 3OGSA 2C4XA 4S2HA 4YADA 2NP9A 4DV3T 3NAPA 3NV3A 3U75A 3AVRA 2C5KT 2HN2A 3D0TA 3A8YC 3ZTGA 2ZM0A 2ERFA 3WZ1A 1SA0E 4LK7A 4DUVA 4HK8A 5FXWA 1RUD1 1VLNA 5FZ8A 3AJZA 5FY9A 4U2ZA 2D8SA 3AZZA 3OYWA 1RUC1 1TVGA 4EV0A 4JV5T 3K4ZA 1J3PA 1UOFA 5LKTA 3OPCA 3FX3A 3ELNA 5M4YA 5FY7A 5F7UA 5JDHA 5FWJA 4Y5TA 1PIV3 4DS0A 1QOSA 4ISRA 1AYN3 5FPBA 4YW3A 3J9SA 1YIPA 2G1MA 5HCAA 2JIJA 2YC0A 1ZZ9A 2V8SV 2HEWF 1AJKA 1WW7A 4FPCA 4TZ4C 2IUWA 2X0LB 5FP7A 3LOBA 4V1Av 2FDIA 3KF3A 2ECVA 2RP4A 5FNVE 4LJHA 2E9XC 1H6XA 4MBQA 1DCSA 2CU5A 2VPEA 1AYM1 3B57A 4BQ2A 4YVWA 1DZRA 5K9YA 2VBBA 2HPJA 3EDVA 2MUMA 1RVF2 3A22A 5AQRB 4YWAA 2CBJA 1CPMA 2ET1A 4M4RA 2P3KA 5E8AA 5FXXA 1X36A 1W0BA 2VCAA 4INDA 2YOEA 1ZRFA 5LATA 1PGW1 5K0UB 3PHMA 1NE6A 5L3EB 3I9YA 3PJYA 2YSMA 1VB4A 4WVVA 1X8MA 3TN93 2R0HA 3LG7A 5FWEA 3WDXA 2VMCA 1JM7A 4CI1B 2RM23 4Q0QA 3V0AB 2OT7A 2XQYA 2E61A 3D82A 3NJZA 3N5LA 3WX5A 2CYFA 4AQFC 1RGSA 4DINB 4CEWA 2IVJA 1SEFA 2WDRA 3G06A 2XBO3 2GMPA 4I7BA 5EK3A 1UOBA 2RSDA 1LEMA 1ZRDA 3ZT7A 4V3KC 1X9TA 4RQPB 5F9TA 1ZM1A 2QQUA 2X09A 1F4HA 1OD3A 2XBO1 5FVKA 2IFWA 2ZMKA 3HJRA 3HN3A 4JQRA 4FI9A 3O1OA 1COV3 3Q8CA 3VBUC 3O12A 3BU7A 5F5IA 2FJBA 2HWB1 2ID4A 1RMU3 1PGW2 2P37A 4DR2T 2IXIA 5JXJA 4XQ4A 2VPVA 2UYBA 4W4ZA 4ISQA 4IV3A 1WMXA 2VASA 4N7UA 1HLCA 2A3WA 4AUQB 4QXBB 2VQFT 1Q8VA 4COYA 2LJLA 5D1MB 1AR62 3ZXKA 2GALA 4OI2A 3C7GA 3THTA 1Q43A 4U2AA 4NJ4A 4TV8E 3AYDA 2IC6A 1ZRCA 3DKQA 2BS4A 1ASJ3 1E4UA 2ZEXA 4LOSA 3ZFFB 2BDEA 1YFWA 2DFCA 4FPFA 5BUVA 4JI2T 3VDDA 5A32A 3JAEA 2VPDA 2CM0A 3ZFEB 2BG9A 2OW4A 2LOSA 2HWC1 5JVVA 3NRYA 4UW5A 4YHJA 1NAEA 2VOTA 4NIAA 5L7OC 1OWAA 2V4VA 2PG8A 5CFCC 4A97A 5FTTC 4GB33 1CUNA 5BNNC 1ENQA 4PQ9A 5IHRA 4AFDA 3SHRA 2KU3A 2RR4A 2X10A 2QJ0A 1RUE2 4WZ0A 1CVNA 1MQTA 3OBAA 1R1A1 1JYXA 3DV8A 3H7YA 1WR6A 1XWMA 3UUXB 2WU2A 1AVBA 3OUIA 3MLJA 4TX5A 4ISSA 3T1YT 2D43A 2ACXA 4RSUA 3PUIA 3VBHA 1GZCA 4CZSA 3TWIA 4JKKA 3D0SA 2F6NA 5FPAA 4LMFA 3M7AA 4L8QA 3WAJA 4K21A 2HWD3 2VBDA 2JECA 3UUBA 3HWJA 1UOGA 5AFBA 4IUGA 4B4QA 2WWVA 4KWUA 4QWNA 3J4UH 2HWD2 1OPMA 2HKXA 3IPVA 4OYUA 2E9XD 1TG7A 2KR4A 4NHXA 4IIJE 2BGPA 5DQWA 5L19A 2GK9A 4HFHA 1TEIA 4X5TA 5CFBA 3ZFGC 2O14A 1W6NA 1YQ6A 3J8F2 5JZGA 1A8MA 4FOYA 3J9X1 3LJCA 3VKHA 1LU2A 4OZXA 1ZBA1 4CCJA 2MOZA 4BQ3A 2CWMA 2VXJA 3RFRA 4U74A 3M63A 1UZ0A 3N2OA 2VOWA 2NM1A 4A6OA 2KM2A 1HTJF 3ZYLA 3V65A 5CFDB 2YDSA 3ZDSA 3ZYGA 1PGL1 1OEDE 3DF0A 1IPJA 1PM7A 3L11A 1WLWA 3B9IA 2Y34A 1D0ZA 2E6VA 2W46A 3APBA 1D4M1 2DCKA 3MXZA 2B39A 2UY8A 3WW4A 1E57A 4YBSA 2X8KA 5LEJA 3TKLB 2CWYA 2E5VA 2GMEA 1HB3A 3QK6A 4WVZA 3INAA 1MQTC 5BYNA 4Y3OA 4MSVA 4A5XA 5G04B 4XZCA 1VBD3 4L97A 2WIIB 1UX7A 3ECQA 1CAXB 4AYCA 4A3XA 1WENA 4GMP3 1PMIA 2YINA 5C3OA 3RZMA 4EN7B 1WRDA 4EN9B 3ZPOA 1UMIA 4KI5M 4NIDA 2YPJA 2D0UA 4ZZ8A 4CXXA 3KDSE 5F6LB 2EXHA 1PO13 5LBCA 2LSJA 1YEWA 2A6WA 2WNVB 1GV9A 4YG0A 3LJUX 5T52A 1GZWA 4CEYA 2XY8B 1XXNA 2XMLA 1STMA 2A7AA 4AK3A 3GL6A 3HVDA 3H3LA 3OY8A 3O70A 3URFA 2LM9A 1XPWA 3V5UA 4W6YA 1G8WA 4RGGA 1F2NA 3IHPA 2HWE2 4H63H 1UYZA 1RJ8A 2XL9A 2R1DA 2H7OA 1UY4A 2G19A 3H1WA 1HFAA 3POEA 5ANNA 2RG4A 5D8AA 3A21A 4Y22B 2OXBA 1QJZA 3LQJA 2WS91 3RSJA 3POIA 3WLUA 3PUZF 4X1YE 1XYPA 5JXIA 2W00A 5FO9B 4DV0T 4FI5A 4OFGA 4DBQA 4FPOB 1AF9A 2NMNA 2WS92 5AQFB 4QPGB 4BE3A 2E6SA 2BVMA 3KV4A 1W9SA 5LHHB 2BV4A 4TNWA 4GIWA 4IEUA 4IDPA 1C28A 4AVSA 4CZZB 1CAUA 3S5QA 3OBTA 2HHHT 2H0VA 1W2OA 2AEYA 2W0XA 5HBAA 4CPBD 4OHWA 3WNPA 2LAUA 2DURA 3HR0A 3ZPV1 2QRXA 3EBRA 5A3WA 1RUG3 3JBG1 4OQ9A 1VE0A 2QQIA 3ZMNA 3MZHA 3K3QC 1H8TB 2X53S 3HKCE 4WM8B 2Z4FA 1R1A3 4AEMA 3M3ZB 4JEHB 2PAMA 1QQP2 4AFCA 5GALA 1LVFA 4P9LA 4X65T 3AA1B 4TN7B 2W9XA 5LWBA 2LGVA 4WM7C 2AR6A 2D3SA 2L9LA 1X33A 1UOJA 3LDRA 5CFCB 3RRCA 4HG6B 3J7Yq 4O7XA 2IVIB 4LMJA 5TRBA 3H7HA 3NAPB 4XJ8A 1ZZ6A 2M1RA 1LAJA 4V3LC 5JXGA 4CDUA 4RR3C 1RHI3 4LNVA 1Q3EA 3CBNA 4P00B 4BCUA 5L4HA 1O5UA 1LCLA 4CCKA 2BU9A 4UBHA 2IW5B 2WZR2 2BJSA 3KM5A 4ZKTB 1H30A 5E6HA 3DDTA 5A7QA 1S0DA 3QD6A 3N9PA 2DI4A 2NPIA 1SUMB 1CZTA 1LRHA 2XSBA 2J1UA 2VBPA 3H8RA 5DUWA 3HR9A 5GLWA 5AQHB 1VBE2 5C9AA 1Q56A 5DZEA 3O36A 5F3JA 1QKQA 2YU2A 1YKEB 1WESA 2YDRA 3VN4A 2HPLA 3ETQA 1XNRT 3MF6A 5CBLA 3A5XA 5BNNA 3H7JA 2LHRA 2A6YA 3M7KA 5FL1A 3TEZA 3CMGA 5FY8A 2TEPA 2JE9A 1C8M2 4LUMA 1CAUB 2WNUA 2NZ9A 2LSYA 5DKAA 1OXZA 5I91A 3CKHA 4P5OB 4TKPB 2K0GA 1LOBA 2RR13 2JRKA 3RJ2X 1G9CA 1CHCA 3SH5A 1Y01A 4FT8A 2WCAA 1REEA 5J36A 3VHNA 1GWMA 4G3YC 2MPFA 2P3JA 3MIBA 5LHIB 2WYSA 1W3XA 1V87A 1GWLA 1ZX5A 2BBAA 3HBZA 5FLHA 3BPZA 1JU4A 2P1BA 3LQIA 2I2SA 1RUOA 3O9XA 2PFWA 4Z1VA 2XHKA 2NMOA 1MBMA 1Z6UA 1Z7S2 2NR4A 3ZXEA 5FPZA 4CA1A 4JI5T 1MEC2 3LSDA 2ZHMA 1WMDA 1SZBA 2WRAA 2XVGA 4NAMA 2PLV1 4YVSC 4L2NA 2DV9A 2KWNA 3WP6A 1S94A 4AI2A 3RZHA 1ZA7A 4U31A 3AKRA 2ACZA 4HKOA 3QNUA 4MV2A 3U78A 2ZBJA 2P3YA 4I3PA 4UELA 1T1HA 1MZ5A 5FYCA 3UU5A 2P9BA 1C8M1 5BXXA 1L7QA 5LY2A 4QDRA 2DWKA 1GNZA 3ALQA 2V7MA 4DZGA 1XNKA 1UU4A 4YJ2E 4B29A 3D8CA 2VXRA 4DXRA 3UU4A 2W3JA 1JHJA 2QE3A 3RYPA 1S2KA 2CGOA 2X9YA 4CU6A 1W8TA 3ZSLA 4KUMB 3LDYA 1D7PM 1EUUA 4LK6A 1PO11 1TME2 1DU2A 3M62A 4WYVA 4QX5A 1ENSA 5C9AC 2C0SA 3WG1A 2VM9A 4GULA 1W9RA 4QGNA 1YLLA 3AJYA 2CBIA 4HGAA 1GQGA 1OOPB 3UNPA 2BKNA 2C5IT 1RUC3 4XMAA 4Q25A 4JV4A 4GB32 1GQPA 2JM3A 5BNNB 1XYOA 4IEQA 3M3QA 2LXHC 3WQ1A 3B3QE 2E51A 5H9SA 2VMIA 4FXKB 4AI3A 3N7KA 4AFMA 4MYEA 1Z0HA 4ZI2C 3MPBA 1ND3A 2Y60A 1AR92 2XQ5A 1VMFA 1SBFA 5JUVA 4WBNE 3IWZA 4XHXA 5LRSA 1DG6A 1VBA1 2JE7A 1KS4A 4H9NC 3IF8B 4MX3A 5GLVA 5D1KB 4YTMA 1D1CA 2RVAA 4LBQD 3EB6A 2DVFA 3I3DA 1DGRN 4EGWA 4QX7A 3RZGA 3JCFA 4YT0A 3MV01 3JQXA 4K40A 1NKGA 3CHXA 1V6MA 4RFT0 3GZTB 4ZXEA 3O14A 1CD3G 1H2LA 4QPGA 1ENRA 1YO8A 5IAXA 3FFQA 3PLWA 2ZZJA 2PFVA 2N1GA 1CJPA 3SH3A 2XJ7A 2Y6LA 5FKCA 3AA0B 5AQNB 4BJNA 3S7EA 1KNRA 4J1WA 1BR4A 1D2SA 1ALYA 2VO5A 4CTEA 1J3RA 2DVBA 4P02B 4BHPA 3H1YA 5FJHA 2W91A 3IIIA 3ZEFB 1KDKA 2E7QA 3NRUA 1W6PA 4NIHA 3JUUA 2DUOA 4RL7A 1O3SA 3OUHA 2W2UA 5T5OA 3OGGA 2XJUA 1WKYA 3MBWA 4DR1T 2QQNA 4OMCA 3P4WA 2HWE1 5LG3A 2D5HA 4UIGA 4CCOA 1Y7BA 3BPSA 3RHWA 2KIZA 1W8UA 3Q8FA 3I97A 2MA5A 1TQ5A 4ZU4A 4DB5A 2ZGQA 2D44A 1ZREA 3PUVF 1OQDA 5LK7B 2FUIA 3FLPA 5EJZB 3WF2A 4YW7A 5EV7A 3NRXA 4LUKA 5CADA 1OKQA 2KFTA 5DDJ3 2ZHKA 5F3IA 1SLLA 2BRTA 3HNMA 4IW3A 4UP0A 4ZS3A 3GF6A 2X29A 4YBTA 4AR2A 1LOEA 3CX7B 5KXBA 3FXDB 4X20E 4QB2A 1AR63 4IT4A 4G9SB 4C9ZA 1UPSA 2BPA2 4XJZA 3DUIA 2F4PA 5FMDA 1G73A 4J6GA 3SC7X 1BORA 3AVSA 5GKAC 1UURA 2IAKA 3I9WA 1GUIA 2VQ0A 4JHTA 4Y5Z0 5FKYA 3NNJA 5FMOS 1D4M2 4P08A 4O8SA 2R16A 3ZVXA 3CIHA 4LIUA 1LOFC 1XNCA 2WZR3 4GB0A 5I8SA 2A6ZA 1XYNA 2MBGA 2W95A 3HQXA 1MS5A 2PN5A 1R64A 2VKJA 4QQLA 3K1SA 3VBUB 2A75A 4AEDA 2R6GF 3ILNA 3UFEA 1UZYA 1V6JA 1T7SA 2SBAA 3OPZA 5LA1A 2VQAA 4AVTA 2E33A 5FPLA 3T9KA 2HWD1 2FMDA 4PLNA 4RQPC 4FTSA 3WNKA 3MDBC 1CIWA 5LGUB 3TRSB 2FCUA 2WO3A 4BBQA 5I0TA 3RI8A 3ZSTA 3RZKA 3C5KA 2X51A 1QSDA 2CNAA 4CXYA 4MOAA 2X67A 4WZ2A 4EROA 2GNTA 5LASA 3O35A 5LBQB 3RYIE 1C4RA 4RFRB 3GXUA 4WM7B 4LHSA 3SFDA 4NHLA 4D3WA 2VB6A 5GZDA 4FVVA 3OG2A 1VOMA 2GC2A 2XLAA 1ZKEA 1S0CA 2XDVA 3ILRA 4XAEA 5LBFA 5AQMB 4MXVA 1TMF3 4QXHA 2H7VC 5C33A 3HCUA 1KEYA 3ZIXA 1KD7A 4QX7B 1HX6A 3GN5B 1HG5A 4CU7A 4PPEA 2P2KA 1UW8A 4QDQA 4KU7A 5SV8A 2K17A 5FXVA 1RUJ2 1MIVA 3J26N 3JQWA 1W39A 1YQ2A 2DWGA 5J3UA 1HG2A 3JD73 5L73A 4ZEYA 4WNKA 4FTEA 3ZXFA 1OQ1A 4Y4YA 3AL5A 5JPNB 4YW4A 2LTNA 4QH1A 2VGDA 3TN91 5KH3A 3VBFA 4NHKA 1NCQB 1VP6A 4PTBA 4PK4A 4O2BE 4QF2A 2LGKA 1NE4A 3B01A 4HN9A 4AHXA 1W2UA 4DUXA 4Q26A 5A3TA 1N1YA 4LTAA 2W5FA 4FBFA 3BIEA 2ARAA 1MIYA 1ZZ8A 5CIRA 1NCQC 4LKFA 1W6PB 5FLJA 1AR61 2JWPA 4QPIC 3TLWA 2HDPA 2X68A 2O0OA 3KFWX 4ZXLA 1VBD2 1ZA4A 4AWDA 3ES1A 1GSLA 5FZ9A 1YQ4A 4XEZA 4URAA 4IGUA 4L99A 3VRBA 4WZFA 3WHUA 1HV0A 3OJAA 3U5MA 2WWJA 3NV1A 3HKBE 5JXHA 5JR9C 4DQAA 3ZLIA 2YV8A 3DPRA 2HYKA 5LA9A 1LJ7A 1K5JA 1JW6A 4RS5C 4W6WA 2CL2A 3PJAA 4AQ2A 3UV9A 3ON7A 1DQ6A 3L09A 1Y9GA 5JLVA 2BS3A 3HOBA 1OSGA 2MPKA 2YFZA 3TLSA 4QDSA 2D6OX 4LMKA 4YZ5A 3PURA 4F6RC 1JZ6A 3BQKA 4AL9A 2LOPA 5IWAT 1Z7S3 2LROA 2NW8A 2F4VT 3AE7A 5F5WA 4Y24A 5HWXA 1XC6A 3WG4A 4XDQA 2L43A 1QQP1 2X05A 3PVEA 4D0QA 2LV9A 2WUHA 1LVKA 3IDBB 1F5JA 4GYSA 2WLPA 4CEYB 5FYZA 4UW3A 1VCTA 1MQTB 3LRQA 1JODA 4QQPA 2ATFA 5KHJA 3VDDC 3M65A 4OX9T 1UY1A 1LB2A 2WS93 4WM8A 3LGRA 2YUEA 4BQ1A 2VPGA 4P5HA 1XE7A 1POQA 3WT3A 3I2IA 4QB1A 3VDDB 1ZEEA 3EJKA 1WCUA 2VMEA 4XF9A 1LHUA 4LKDA 3P3PA 4FPYA 5F3GA 2V4AA 3UL2A 1G9FA 4PBOA 1NAFA 3ANWA 1S2EA 2ECGA 4HWFA 2IXKA 3AB3B 1HF8A 2JICA 1MMNA 2GAUA 4L9BA 2WABA 4P09A 2LEHA 2CAUA 2VTXJ 1WD3A 4AYUA 3AE9A 2Z79A 2HYXA 3LAGA 3EHKA 1DGRA 2XOYA 4O62A 5C3RA 3AE5A 4HXCA 1B7TA 2BW8A 5BNQA 1VBB2 2EXIA 1YWKA 5IVYA 5EK4A 2UUAT 1RUC2 1NCRA 1NLQA 4AVAA 4HFCA 1MNEA 2DTWA 4ASKA 5A1AA 5C3JA 4RR3B 1AXYA 4XACA 3WF4A 3O1SA 3DP7A 3BTAA 3Q8EA 1POV3 2H0BA 3LKJA 1YXWA 4RS5A 3POBA 2WBKA 5FZ6A 1WEPA 4E2QA 4XI1A 2HWE3 4DNYA 5HEGA 1SLAA 3P50A 5L36A 1QJFA 4QH4A 4DXTA 2YYRA 4B3RT 1BR0A 2ARXA 1YC61 3AE4A 4NAOA 5FCCA 1MS3A 4N53C 2BGOA 2WFF2 4Y20A 4YGEA 2GP5A 5JMOA 2B9UA 2Z6EA 5HXCA 4N53A 2QVSB 1UO9A 1RUNA 1ONAA 1Q5OA 3ZC1A 4L5GA 3C4WA 4XILA 2VURA 2C24A 2IXCA 1MZFA 3WF3A 4HK9A 4JI6T 1FMD3 4O2AE 5LB7B 4CQIA 1W8ZA 1YI7A 2JMHA 1XNQT 3G6JB 4KWKA 1YQCA 2ORZA 2W1WA 5AQSB 1ZP0A 3ZCJA 3GYDA 2HWB2 5A7PA 5JPMB 3K8PC 1ENXA 3AXJA 2XSAA 1OLMA 2BG9C 2DCZA 4CI3B 4QX0A 5FRAA 4QKBA 3OGVA 3T0AA 3UKTA 4LBQA 1J83A 2LT3A 2HBUA 1F9KA 2QTWB 3HKDE 1IZ3A 4RQPA 5I8TA 2VJFA 5EIYB 2DVAA 1CIYA 5TDRA 2MNGA 4FFGA 3EAMA 3QOPA 5F2SA 5T54A 4AVVA 3WDTA 4GKXA 3EVYA 3C7EA 4FOVA 2ZAAA 3PV0F 2E8IA 3K2OA 4JBWF 4BJMA 2QNKA 3CIRA 1U0AA 4YM1A 2OXQC 4S2DA 3SKVA 4NROA 3OTFA 4GB31 4PI2A 3VLBB 1JZ8A 4IE0A 2RM21 5ERLA 2UY9A 2MD7B 2Y1NA 2CRRA 2PBIA 4ZHQE 1AL0G 3R4UA 3ZKUA 1OC1A 1QNWA 3SCGA 1WFKA 1PO12 1MZ6A 2ZKNA 3RZLA 5FZGA 3WG2A 3RPGB 4GD4A 5FVLA 4LF7T 4WV8A 2BVVA 3V56A 1SLBA 2XXZA 2RS13 4GOUA 1AYM2 2IUBA 2QJVA 3UT0A 4OYKA 2XOMA 2JRJA 1GWKA 5I0SA 1VMHA 3PJQA 3S30A 5FIXA 5A6XA 3BQIA 4L92A 2UXNB 3I1AA 2QQVA 2WU5A 3MHHA 4XCAA 4UI9B 3F95A 1GZWB 2Q1MA 3KF5A 4P9YA 4WZ3B 2UWBA 3ETUA 1IKQA 3ZXAC 1JS9A 2ZGOA 3K77A 1SLCA 4DRVA 1FNYA 1GFF2 2FMYA 1DCQA 1P8JA 5C8WA 5I0DA 1KRIA 5DUXA 2QQPA 4JDNA 2HWC2 2ZETC 2H3RA 2MYSA 1HQNA 2QCSB 5FREA 1HN0A 2CAVA 2WLQA 4B3ST 1QH7A 4K1ZA 4LBKA 3W20A 1W09A 2XM2A 1RL3A 4JGYB 5D1LB 3OBRA 1RUH1 5A3NA 2ZS6B 1BBT3 3P8CD 1ND3C 5KXJA 1LDKC 1OA3A 4AXPA 3N36A 4UVAB 2NAAA 1XB9A 4HKLA 3E6BA 3VBHC 2N2NA 3L1ZB 1PX4A 1W9YA 3T8OA 5G05B 3ZYBA 2QBXA 3I3BA 1D0XA 4GH4C 1RITA 4W65A 3LPFA 3PUAA 1AX0A 3NWKA 4JAAA 3RYFE 2W4XA 1VB2A 3JAFA 2KLQA 3R05A 5FBZA 2OV9A 3RNSA 5KH7A 1J5WA 2KGIA 4GJZA 4B3TT 3R6NA 3WQBA 2V26A 1JU3A 3EHZA 4IERA 2J1DG 5FMOL 4XUTA 4NRMA 4CDQC 5IWFA 5FZOA 1WEWA 1HB4A 3HNBM 1WCKA 2FSAA 1MPXA 3DEMA 1VBE1 3I0OA 4YLZA 2VJEA 2C1FA 5LY1A 3KWVA 2WR9A 1KJRA 3U0ZA 2YDQA 4KG0A 1TNFA 4NPPA 5AITA 4RD7A 1VBC1 4XVHA 4DRRA 1N1SA 3ZPVE 4A44A 1O4YA 1IJ6A 1OFNA 4ET7A 1NXD1 5A33A 4JI0T 4ZHNA 5FLIA 4MGSA 3WNLA 3VBFC 3G7DA 1B35A 4FFIA 1QIQA 4AEDC 2OQ7A 2J1EA 4PIYA 1UNBA 3RKGA 1W6MA 3IAPA 2XKPA 3OBZA 5C11A 1JN2P 2JDHA 4AAXA 1XMOT 4Y1XA 4XYXA 5E89A 4D8MA 4JI8T 2E53A 4UFMA 5G04L 2E26A 4LBQB 4JTNA 3I4IA 3NKGA 3I2DA 3NVCA 5IFTA 4HL0A 4ZPIA 1RHI1 2R1BA 1W0NA 4YM2A 2FBWA 3CZJA 4AF9A 2I74A 5J2UE 3OD4A 5FZAA 3AA7B 1W0OA 5M0TA 4QGLA 5IVJA 2UXCT 4A7KA 2R063 4RN5A 2GNDA 1OFSA 5E16A 2KINB 3IBMA 4HVQA 3W5NA 4C0BA 4W50A 4BK4A 4Y33A 5A3UA 2UWCA 4XUNA 2VZOA 1T6GC 2VKHA 3AFKA 3WP4A 1FAYA 1HIXA 3ZR6A 1GYKA 4PDWA 3M4FA 3P4RA 2WDQA 2NQYA 5H1TA 4KBZA 2G45A 4JEUB 2LKGA 3LBXB 2QZ2A 4PLMA 2XPJA 1RUD2 4JUYA 1QDOA 1RUG1 4X8NA 3B93A 2HWF2 3E97A 1FPN3 1AUYA 1TMF2 2A70A 3CJXA 3WP3A 5IK4A 4BLJA 5EK2A 3C7OA 3A7QA 2YYOA 4N90A 3RTRB 1UKGA 1UXZA 4AGGA 4UW6A 5FB0A 4N8MA 1IS6A 3RPQA 4X66T 2CHOA 5L3BB 3DQVR 2R072 4HZFA 4IDZA 3RVHA 1BCXA 1YJKA 3WP5A 4FCAA 2F42A 4Q4V3 3U14A 3KQ4B 3P7IA 4DUYT 2B9VA 3L2YA 3FHAA 2GN3A 3LK2B 2E9XA 5EYXA 4LF8T 3VHOA 2I07B 3ES4A 1PMJX 2XM1A 2ECTA 3LEKA 4LFCT 4DR3T 5T50A 3MHSA 5AVAA 3RRWA 4JGYC 4YZ4A 2MNZA 3WINE 1UKRA 4WVMA 2W39A 4JGYA 1NQDA 4H7MA 1TME3 3VV1A 1PK6B 2FDFA 5JH7E 3AAIA 2AUYA 4Q0UA 1BEV3 3H8OA 4TSVA 2GNBA 5FMCA 4DMVA 5K8SA 2WNUC 5FV3A 1BEV2 4CDUC 5FK8A 2YQLA 1VAMA 4JRAA 2WMOA 3LZZA 4QXKA 1QEXA 4I7CA 2XJPA 1SMVA 5L7OA 4KMQA 3AZVA 4UFIA 3WW2A 5TDWA 4XZUG 3P6BA 2D5UA 5J96B 2WNOA 4AVXA 5A3PA 3MW3A 1C57A 1IBLT 1A8DA 3BTZA 1US7B 5CJ5A 3BCWA 3SCFA 4KU8A 1MMGA 4XTMA 3DCQA 4X6QB 5C3QA 3PUWF 2VUAA 5A1FA 4NO4A 5L9BA 1QF3A 1NX9A 1ASJ2 4LA2A 1W6OB 2XQRA 2P5BA 3OUJA 1AJ3A 5LW9A 2HH9A 4OUEA 2P4EA 2KR2A 4DPNA 5ABJB 2VVEA 2BVLA 2PAEA 1O8SA 2VQET 5CZKA 2J62A 2BWCA 4OI0A 2RA1A 1KJLA 4ZI3D 2WZHA 4EOZB 3AMNA 2AN6A 3UGFA 2VL0A 4N4FA 2KA3A 1PVC1 3IM0A 2YC4A 2ZOEB 1I5ZA 2VZ1A 3QBQA 2MD8C 3SOXA 5HCMA 2VW1A 4OMDA 2ZLYA 5JI7A 2ARBA 3ZFEC 3CVRA 3IA3A 4EWAA 3N7MA 3KT1A 2OZJA 5APAA 3AM2A 1W6NB 1WCQA 3HL6A 2BNOA 2KNDA 3DPRC 5JDFA 4NIGA 2PLV2 3GWHA 2CSYA 4COFA 2H88A 1JUIA 1O6UA 4FPEA 1XJAA 1UYXA 4BU2A 1V0AA 2VNFA 5IAVA 4QKFA 2VKDA 2RS32 4YTNA 1FV3A 4CCGX 3T08A 4A7YA 2MA6A 3O33A 4UFKA 2A72A 5HPOA 5AQKB 2EXUA 1OF4A 2ZACA 4Y26A 4LBJA 4HKWA 2ZKLA 2MT5A 5BPXA 1R1ZA 3ACIA 3PVOA 1O91A 4UW4A 2D3PA 4N53B 5DG1A 1XU1A 1BBT1 5FZ4A 3RI5A 4IEXA 4LHLA 5LA2A 4HSLA 3NZQA 4IDNA 4TWFA 5T55A 3C51A 5IVBA 5FOJB 5B8DA 4B4PA 4AFBA 3VHLA 2Y48B 2XOZA 2JQKA 5B4XA 5C4WB 4BIOA 4GNEA 4XXAA 2MNYA 4UI9L 1NA1C 1QY4A 4Z82A 1WMFA 2YW8A 5I8YA 1G25A 2NP0A 4O64A 4BQWA 1REDA 1VBC3 1WR0A 3UFGA 4P14A 3OF1A 1TE1B 2B8MA 4R9DA 3POYA 1WILA 2J1VA 2VZUA 4Z92B 2QDNA 4J1XA 1T72A 3ZMSB 4QHOA 3KZ4C 3C7HA 4R4ZA 1H9WA 3ONLC 5HAXA 3D5OA 5JRCB 2Y8KA 2XAQB 1ULPA 3MIEA 4D6SA 4BXFA 2D0TA 4L0PA 5DAVA 5H6RB 3KCYA 2DUPA 3E5XA 2FHRA 2PHTA 2VW0A 3RYKA 2IMLA 4F3JA 4YM3A 2BGCA 5FK7A 4AI8A 2ZGPA 3RQ0A 5GLZA 1OD5A 2V7LA 1ND2C 1OEDA 2VAUA 2I6HA 5AQJB 3KB5A 3BN6A 2G9FA 3RMXA 3ZN5A 3AB0A 4YY3T 1OH4A 5KXCA 3KGLA 2E31A 3GHMA 1V6NA 2CLYC 3AZWA 1WGMA 3M99A 4EEDA 4UFJA 4M3CB 1S4CA 1ZV4X 4LULA 3MW2A 5A7WA 1C3HA 1RUE3 3QACA 4CSWA 2BDRA 3SS1A 2LKHA 3OYZA 2QICA 4KWJA 1AR93 2M67A 1WEQA 4I43B 4UV9B 4YW6A 2R30A 3AX4A 2JDPA 3BQLA 1POV0 4GK0E 1HX1B 3FLTA 4N43A 2CXDA 2BVBA 4FIPA 4IC3A 2VZPA 4UYBA 1RUH3 5H6QB 1HR0T 4ADZA 2GP3A 5GLTA 5FUIA 1R091 1LGNA 1W8HA 2EALA 3FFZA 3CNAA 2CDOA 1QXRA 3BIWE 4XW3A 5B75A 2XLFA 2ZGTA 2WQ8A 1DQ0A 1OLRA 1ULCA 2C5DA 4TLGA 2DU0A 5LG4A 4C1XA 2OA2A 1FNZA 4CCMA 4NN2A 4NPLA 5JR2A 3FZKB 1SFNA 3P5BA 2R041 5B78A 1VMJA 1JZ4A 4V2VA 3CDZB 3CQOA 3PU8A 1RMU1 5K3QA 2UXBT 2JDUA 2MIQA 1JZ5A 3LB9A 4K7JA 3JU9A 1Y64B 2YDEA 4AGRA 2VUDA 1J1TA 3EI0A 1E1HB 3ZOIA 3KT7A 4C91A 4FPGA 1R093 1XNTA 3ZYPA 2RS33 3ZN4A 2J1TA 5ETWA 3EMRA 4AW7A 3KVBA 4BK5A 1U5YA 4CUCA 3FBZA 1OVPA 2O1QA 3VD9A 5BNOB 2L7PA 5CVRA 2XLGA 3L1XA 1W2TA 3VD7A 2OZ6A 5KHHA 5F1RA 3PUYF 3KBTA 5E88A 3N9OA 3WNNA 1AR71 1J1LA 5FMBA 2JG9C 2P6HA 2DF7A 1M4WA 5LKZA 2ARCA 2ADEA 3AYCA 3GBWA 4QPWA 1WCRA 3PL0A 5AVPA 1ULEA 3CJIB 4AEJA 2XL7A 1W2AX 3J7MA 1DF0A 3T30A 3BU0A 3MKDA 2R062 4OQ8A 3AC0A 1SG3A 2A3YA 4FJCA 4MG2A 3AEAA 4DMWA 2NW9A 1A6CA 3M3CA 2QIZA 4DUWA 5FJKA 2XOCA 3ASIA 1BZWA 1D0GA 4QQOA 1WZXA 5JVDE 2JENA 2QZ3A 3L8RA 3OYXA 2A2FX 4YGCA 4XHBA 2XQAA 2A6VA 5J1GA 4JI3T 1UZZA 1V6KA 2KZ7B 3PVBB 4JHZA 1DYPA 2V5YA 4K6BA 3MV11 1SDWA 3VD4A 4ZI2D 2EIDA 5LRRA 3T0BA 3WV6A 4P0BA 2VNRA 5HCFA 1GR3A 5L3FB 3W58A 4I2OA 1MACA 1QJU3 3EYPA 5HYAA 4H9RC 1WIMA 3I3EA 4Y5SA 2BEOA 4BLIA 5FY0A 2RMU1 2JG8C 4B7KA 5JOXA 2WAAA 1WYCA 4YNIA 2VC9A 4UEMA 3ZMTB 5FYSA 2XAJB 2OUJA 3EQEA 3Q2MA 4ILAA 1SCRA 5CKNA 3K48A 3VBSB 4ZU7A 3AAEB 2VMFA 3M8LA 2YHOA 1WLXA 1RC6A 2ZM6T 3UK9A 3OYWB 4IETA 3OPWA 5EXOA 2JKBA 4OZOA 4EE2A 4RGKA 4URTA 4Q29A 4PK6A 4KI0F 3ZX7A 4E4DX 1N1TA 1CAXA 3B9CA 3RIUA 4ZZBA 5C71A 5FZ7A 1DGLA 1OT5A 3RMYA 1F31A 4IGQA 2JMIA 4FJOA 4AKHA 2GU9A 3RJRA 5A70A 1R1A2 5ABHA 2VZRA 5LP6E 1O4ZA 2FJDA 5FZ3A 1G8XA 1G86A 1QJY2 1XNDA 2VTFA 2AH2A 1DQ4A 2V7JA 3VZJA 4X8PA 3AE8A 4X64T 3HCTA 5HV4A 1I5PA 1XSRA 4LO6B 1NCRB 1HB2A 1G6NA 4WA6A 4YVWB 2ILMA 3KQIA 3DTOA 1HB1A 2GZWA 1YFUA 2K16A 1LOFA 5ADXL 3BGAA 4YAXA 5ABEA 5A3LA 3T6RA 1EV13 2WZ8A 3UKVA 2X9WA 4JI7T 2F6JA 1QHDA 4PJJA 3QC9A 4WW0A 2DX8A 2LXPC 3N7JA 1JHNA 1RUI2 2YBPA 1LKNA 4GAZA 4IDQA 3ZIWA 2VPBA 2AE9A 2ZCWA 4DIQA 1JOBA 3O1JA 4X62T 4PF1A 1J3QA 2YUCA 2YGLA 2MHFA 4Y1ZA 4P5YA 5JWPA 1AR73 2ZMNA 3MDPA 5FY1A 1JNRA 1PO21 5DZFA 5CA6A 3EABA 1RYYA 1VALA 1OUSA 3NV2A 2B5HA 3O1UA 4P9WA 3S7IA 4GNFA 4FOWA 2W92A 3WEZA 4Q8KA 4M0HA 2KWIB 1ODMA 3ROUA 4AI9A 1HRV2 4D7SA 4XF1A 4QX8B 2G4IA 2Q9QC 1JYCA 4LLBA 2E63A 2K4DA 1KGYA 4ARXA 4AI1A 1YCIA 2EAAA 4Q4X2 3ZXLA 3VB9A 3TLVA 1YHFA 4PIZA 4OHVA 4CU9A 3ZN6A 3UGGA 2WB5A 5A80A 4AEDB 1LNSA 5JOZA 3I3QA 3VBFB 4FPJA 1HXS1 1SFYA 3PIGA 3U5PA 4HWCA 5JIAA 4OHZA 1VRBA 1YQ8A 5CYYA 2XG3A 4M00A 3U4XA 1LOCA 5JOYA 3LEGA 4XFFA 4Z8XA 1XSQA 2RS11 3NSTA 4YABA 5HCJA 1LESA 2L75A 1HRI3 3VKMA 3T4VA 5FZBA 4PFOA 2WNVC 4D6RA 3BKZA 1GANA 5BY5A 4MHCA 1AR82 3SISA 5FYIA 2ECWA 1QJX3 4AAPA 1IOAA 1QU0A 3DXTA 4OHXA 3ONJA 1UK5A 3P4PA 1BR1A 4R2YA 1R092 2NLRA 2WA3A 2WO1A 5G0FA 3MF9A 3PMSA 1UMZA 4KX6A 2Y6GA 4Y1YA 4DR6T 2FDKA 4RGAA 3HNYM 2OUHA 5LCYA 4U36A 5AFUL 2JD9A 3N4MA 3VZMA 3CU7A 1DGWX 2A71A 4YSXA 2YBSA 2FQPA 4L9IA 3DKWA 2M85A 1PHMA 2Y8DA 1E5RA 4E9KA 4AQFA 4NPRA 4ILCA 4YW5A 1KDMA 2ZABA 1VPHA 3WCSA 2WAOA 5T5JA 2KWOA 1XMQT 3B69A 5FUPA 3WDVA 4WVMB 1V9U3 4J2CA 1WMEA 2RDRA 4QWNB 3UTKA 2QQJA 1WCDJ 4L7XA 5LKXA 4XC9A 3N9NA 3MFCA 5AQUB 4NN0A 3MIHA 4QGMA 3OGRA 4YFWA 4U2YA 3VBOC 4QKNA 5T3NA 5E1RA 4KBBA 1XZYA 2W68A 2M13A 5LZ6A 3FE5A 4H63V 1ODNA 4ES8A 3GCXA 5EZYE 3HBKA 2YVRA 1VD4A 4CDXA 4META 5LYJE 3H8XA 4QU1A 2JB8A 1PO22 3HTKC 3DECA 1A3KA 4U3CA 5J3XA 4UVBB 2VTXA 5AC91 5HEUA 3GM8A 1VIWB 1AYN2 4UR9A 5L7OB 2X5IC 1BMV1 1V00A 1BJQA 2CWSA 4DIDB 2I45A 4N9HA 4DV7T 5LCWB 5GJ6A 3P4QA 2P3IA 1ZOYA 4GKYA 2X66A 2VOXA 4UAPA 1LOAA 1U5IA 1IAPA 1W6QA 5AIUA 2BWAA 2PNXA 5FZLA 1U5XA 3FM8C 1E2AA 3LA3A 4LE4A 1N36T 4X1IE 4Q0SA 3ZYQA 2R0FA 5GZEA 5KDMC 2VL4A 3ZN6B 4KHPT 4PK5A 1S0IA 2QFEA 4WZCA 2WSUA 2R32A 1U12A 3WW1A 1GOGA 2LRLA 4ES9A 1XE0A 3T0DA 4EN0A 4DY5A 3VDBA 4FXGB 4DOUA 2K9AA 5F8PA 4QF3A 1L3JA 5TABA 2Y33A 3O7OA 4ZI7E 2RJLA 1X9PA 2YY1A 3LOIA 2Y0IA 2PHRA 4ATEA 1S1AA 3AEDA 1RUD3 3AKTA 2YBKA 1DDLA 2ZGNA 1PVC3 3JZVA 3MHZA 1FOD2 4CP9B 2LSGA 3L2HA 2VY0A 3LDQB 2JKXA 5CKMA 3VL9A 5AQPB 3VKOA 4O61A 3LBXA 4ZS2A 2B45X 2CXLA 2ZGMA 2XTLA 2Y38A 3QZVA 3AP9A 3S57A 2XKOA 3ZNIA 1GMMA 2G9GA 5ACA2 2RMU2 4Q4V2 4M3CE 3ZN0B 1R081 3SRZA 3PLQA 3I2OA 1EV11 4BA6A 4MFRA 1FBVA 3HKEE 1QJU1 1DQ5A 1FMD1 2VQTA 2P17A 4IDOA 1NOVA 1WA4A 3NV4A 2Q9QD 5C9AB 1FATA 3VBRC 3QCWA 1UCXA 5ISLA 4EV6A 3VBOB 2KWHA 2EVXA 3IDAA 4XUPA 4HVOA 3ZFGB 4Z0RA 4BMEA 3HT1A 2RS52 2Y6HA 2C6SA 4JCKA 2YEVC 2E5LT 5L3DB 4CN4A 2Q8DA 4XDPA 2LGGA 4OGEA 2TBVA 4LR4A 5DDJ1 3C4XA 3U07A 2G6QA 3U37A 3FZLB 1W04A 3O1PA 5AC93 4DEVA 5EP9A 1ZYBA 3JC6D 5D1IA 4N9IA 5CFCA 3FZHB 3PUHA 3VRAA 3WNMA 4Q4Y1 1EY2A 3ZVYA 2P57A 4HFSA 5HXEA 5C3SA 5J48A 5H9MA 3MUZ1 1W3VA 2AZ5A 4EQVA 3ZSSA 1OEDB 1FOD3 4W4UA 1WEOA 4B1MA 4H7LA 3FLRA 2PELA 2FZ2A 2WKKA 3THCA 5EJ3A 2CA5A 3ZSKA 3FMGA 1MS4A 2XHNA 3RWNA 2DLRA 5ABJA 2EA7A 1WA6X 5CA0E 3VHPA 5F39A 5H9QA 1C5IA 3UT5E 4JKLA 5IHYA 2BAYA 1ZBE3 4S2GA 3Q5WA 2PHUA 1J5ET 1LKXA 1DLLA 2J42A 3BTXA 2X5IB 2NOXA 3ZMZB 4AHYA 2ECJA 1HW5A 2PYTA 2RS51 2XQ4A 4XPVA 2VR4A 4CYDA 4I55E 2VCBA 2ZHNA 1QMJA 2ZGLA 3VKGA 4GNDA 2HBTA 2EF6A 1HRI2 4HKAA 4P1NA 3L39A 5DG2A 2YMZA 1J59A 5G05L 4XQDA 1QJX1 3ACHA 4AQSA 2WDVA 4WZXA 5FZDA 2C9KA 5FB1A 1SHWB 1PMHX 3WHTA 2L3LA 1ND2A 4MZUA 4OCTA 2CY6A 5HV0A 5JQGE 3D6EA 3I8TA 1HJGA 3VDCA 2WT2A 3ZCIA 4MLKA 3QLQA 1Q8OA 3KQRA 3O34A 2NTXA 4ZQLA 1W99A 2LE8A 4YFSA 3T1LA 2LSIA 2JJ6A 1N32T 4F7ZA 5ABFB 1ST8A 1NT0A 4P9XA 4S3OC 5CFDC 3NAPC 1LULA 4CU8A 4IXLA 4IE7A 3WI3A 3MFAA 1UXXX 3SEEA 5FO8B 2OLTA 5D8AB 4Q6FA 3PJAJ 3DYMA 3UULA 4ANJA 1RHI2 1AR81 2E32A 2FBEA 3OKQA 2W87A 1OUXA 3KNVA 4I02A 2WY2A 4C8DA 3Q8BA 5IVVA 4UFHA 1COV2 3UGHA 4N78D 1S35A 3UQ4A 5A6YA 4BHWA 2UUBT 4COVA 2WNVA 1VRH1 2VKOA 2ODVA 4HTEA 3VBRA 2UZGA 2CTVA 1HV1A 4LFBT 4Y1UA 2M6MA 3A0NA 2QQOA 5J09A 2YU1A 3Q5EA 3U11A 2VOKA 4PDWB 5BR8T 4XTPA 4XBLA 3FWEA 2LRKA 5H9RA 1W6QB 4XFCA 2RS53 3VBHB 4F8AA 3NQHA 4QM9A 4LIVA 1RMDA 1UIKA 1J1JA 3PVNA 1AR83 3K4DA 2XP0A 1O3QA 2YT5A 4IL9A 2HWC3 4Z2WA 5FEYA 2JJ9A 4EWDA 2CPTA 5LK5A 4NRQA 5AQOB 1IBMT 1RUF2 2IWGB 3WNXA 3BK9A 2ZJCA 1D2QA 4Z8BA 3Q8AA 3SCHA 2D7FA 1LHNA 2BUKA 2WT1A 4LKAA 2DL1A 1ZRRA 3WOGA 1KS5A 2YG0A 3HQUA 5L47A 1LGCA 2CWOA 1BK0A 3E2DA 1CHUA 3KINB 2EA6A 4IESA 3VZLA 3RLFF 2ETEA 3ASLA 5JIUA 4AISA 1V9DA 4OHYA 3HAGA 4F1PA 2FDHA 1CAWA 1FI2A 4LBLA 2JUNA 2RR11 3AYEA 1PIV2 4AKLA 1EAH1 4U33A 3JBG3 5DDJ2 1LEDA 1W9WA 4XFBA 5HXHA 1G9AA 4P9IA 3WCRA 2L80A 3FJSA 1COV1 1JYTA 3MEPA 1DVPA 4DMIA 4CDWB 4IGOA 4KGQA 3OVUA 4CCNA 5CGMA 1SHZC 2JMDA 3H8UA 1NY71 1OH3A 4OYJA 1W90A 3M3IA 1FIOA 4GMP0 4CP2A 2XZEA 1V9U2 3A0KA 3ZYJB 1IG0A 3RPUA 1ZVFA 3KCCA 1XBFA 3AEGA 3C6WA 2OIIA 1JUHA 1NA1B 2PQSA 5SVIB 1FMD2 1Y4WA 4FQZA 1BVVA 3OOXA 5SVYA 1R082 2F4LA 3J7HA 3EO6A 4Q4V1 2CSZA 1MZEA 4KNCA 4BPZA 3Q9DA 3NNGA 3JD72 4QX8A 1H0BA 4A7ZA 3ACFA 3DN7A 5JCTA 3ZXJA 4C1WA 2VOVA 1ULOA 1QJX2 1UF2C 5EWSA 4QU2A 4CN6A 3D4KA 1PM4A 2E7AA 4IEVA 5JZGC 3RC8A 2OPWA 2DU1A 1ZZBA 3ENRA 2ZX2A 4IGPA 3ACGA 2RPAA 3LSEA 1ND2B 1H6YA 2JMKA 1H1AA 4DV2T 1RTVA 4Q4W3 2Y64A 1AXKA 5IFPA 2KSRA 2MEV2 2G43A 4IE6A 3AXDA 5BNPC 3ACLA 1H7CA 3WNOA 4P9GA 4Q4W2 1WEEA 3BVCA 4I0AA 2Z69A 2W66A 3NJXA 2BTVC 5A6QA 4RYDA 1C8NA 1LOGA 1MMAA 4DNDA 3QOFA 4DR5T 3AMHA 2BG9E 1PIV1 3EXUA 4QMAA 4AQ6A 3BUCA 3FHNA 1JI6A 5LEKA 3RQWA 2EHOD 4EAHA 4KGGA 4WM7A 3LK42 4XAAA 4HFBA 4ZOLE 4RHV3 4R7EA 5A7NA 4Z90A 3O1HA 4V2WA 2XR4A 4OGCA 3B00A 4KWLA 4D7TA 4N43C 2WAUA 3H50A 4IV1A 1D0YA 1N3PA 3ZJ2A 1L0VA 2AGSA 1BMV2 4LHNA 5HEHA 4U72A 5JZGB 3GHNA 1XOYA 2N7GA 2BBVA 3ABZA 1NENA 3FAOA 3LDKA 1NG0A 2A73B 2JDZA 3KVAA 3UJOA 2WYFA 2XJSA 5IJRA 4XETA 2GC0A 5FR3A 1UX4A 2P34A 3ZMUB 3ZN1B 4FK5A 5I93A 2JMJA 1IBKT 1UL9A 3OJBA 1H2KA 3S5AA 4Q2FA 4JC1A 5SVXA 4Z91A 3CPZA 1LGBA 3ZC0A 2QA7A 2LRPA 1C5HA 1C1FA 1JZ2A 1NZCA 1CESA 1VCSA 1FMVA 1AR72 3SQOA 2XAFB 3AKSA 5FYTA 1GQEA 5KX5E 2ES3A 4K8RB 2LDRA 4PF5A 1JYWA 2V09A 2MEV3 2WINB 4LITA 1UYPA 4A45A 3H0OA 4JGZC 2R6QA 3GNEA 5IYZE 3VU7H 2CHHA 4Q5OA 3O1MA 2ZZQA 2IHR1 5DABA 5JMCA 1MS1A 1K3IA 2FDJA 4FTBA 3C50A 2ODUA 3FXEB 2O8OA 2TUNA 2VVFA 3T1MA 4N7IA 3U5NA 5KBFA 1L7RA 5CU1A 1DQ2A 1OURA 2JQHA 5FZ0A 3UUNA 2VP7A 4K8FA 2VMHA 4E2GA 3ZJ1A 1OOPC 2WNEA 3P1IA 1QLBA 4FP3A 3O4XE 4JGZB 3C7FA