3PURA

Cekdm7a from c.elegans, complex with d-2-hg
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
515
structure length
483
Chain Sequence
PKESDRCGGCGKFTLMSKKKSHHHKKNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKCVPHTGHSIRYKVVAPHRYRWYSPNEKHLGIEVGSKTWIEDFITRENTVPSPTDDEVCIVEDGYEFRREFEKLGGADNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETSPDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEANQEGSDMREQEKNIWTASQIMKAEMERWMDRELRLGPEKNAILPTDDKNKIMISVRKQIEIQTKIQNAKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oncometabolite 2-hydroxyglutarate is a competitive inhibitor of alpha-ketoglutarate-dependent dioxygenases
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 7 homolog
total genus 148
structure length 483
sequence length 515
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3purA03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3purA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3purA01
2EGPA 3O37A 5F3CA 5B78A 5FZ3A 4CSWA 4CCNA 5FPVA 4A4CA 1X4IA 2QIZA 1HYJA 5A1FA 4L58A 3DQVR 3SOWA 4IC3A 4V3LC 2HDPA 4EZHA 3ZPOA 2CSYA 2YSJA 2UZGA 4O64A 1ZBDB 5TDRA 4DO0A 5FP8A 5F3IA 3RPGC 4UI9B 5J3XA 4LXLA 5A7WB 4IC2A 4URAA 5CEHA 3HTKC 3SOXA 5FZ7A 5KR7A 4N3WA 3K2OA 4GNEA 4UP5A 5F5IA 5A3WA 3DXUA 2M1RA 1K2FA 3OPWA 5FXVA 1WEUA 4GNGA 2LRIC 2YT5A 2CSZA 2KGGA 3O35A 3QZVA 4R8PK 1WFKA 2ECVA 5FPLA 2KYUA 2H0DB 4C8DA 2VJFA 2G43A 2XXZA 2MD7B 2KR4A 5H1TA 3DXTA 2CKLA 5IVJA 1N87A 1X4JA 3NG2A 4BISA 4ZDTA 3U78A 5IVFA 5TBNA 4QF3A 3MHSA 2MIQA 4I7CA 4D6RA 4HOOA 1WEVA 2ECJA 2LGVA 4QU1A 4LK9A 5IVCA 5TABA 2CKLB 4GB0A 4YABA 4MVTA 5D1LB 2YUCA 4AYCA 4F52B 5FZLA 3N9PA 4QXHA 3ZLIA 4CCLA 1T1HA 1MM3A 2ECTA 5B8DA 3PU3A 5FZEA 4D6SA 3LRQA 5FB1A 2FUUA 5FZ9A 2KWOA 2HYED 5F5CA 4AAPA 4ZUXU 4AYCB 5FZAA 4QXBA 1V87A 2L43A 4LLBA 5IVVA 4PPEA 4MSXA 1WEOA 5FZDA 2P5BA 5IVEA 2MNYA 5JG6A 1WESA 4XDPA 1JM7A 2WWUA 1VRBA 5A7QA 3KNVA 4LKAA 4R7EA 5FBJA 4V2WA 2MA6A 4B86C 1MM2A 2PUYA 2YW8A 2K1JA 1WILA 5FYVA 4IGOA 3EB6A 4FO9A 5LKUA 1JM7B 4D6QA 2KREA 5FY1A 3M63A 5LKZA 2ZETC 4AI9A 3U5PA 4GJYA 5H1VA 4WZ3B 4I7BA 3U5OA 2OQ6A 1WENA 3ASLA 4YAXA 5FYYA 1X4UA 5DKAA 5KH7A 5FZHA 5FYHA 2YBPA 5IVBA 2NAAA 2VJFB 3KQIA 3L1XA 2GP3A 3ZPVE 3U5MA 2L75A 3I2DA 2G45A 4BXFA 3U4SA 4W4UA 5FPAA 5G05B 1DVPA 2KWJA 2C2LA 5ISLA 4LIVA 5A7WA 2LV9A 4Y3OA 5FY9A 5A7SA 5FWJA 2LN0A 5G0FA 2F42A 4AUQB 1CHCA 5FZ8A 1BORA 4AP4A 2LQ6A 3K3OA 5FV3A 5E6HA 3KV9A 3K3NA 2XMLA 2YURA 5A80A 2KU3A 2IDAA 5LW9A 3HCTA 5FYCA 5FJKA 3HCSA 3DPLR 2KE1A 4Q6FA 2ECGA 1WEEA 3ZVYA 2K17A 2VPDA 5AIUA 4A49A 4LJNA 3ZNIA 4FIPA 1WIMA 2C2VS 2MNZA 2VJEA 5F39A 5LY2A 2FSAA 4YATA 4L7XA 5FZ0A 2PXJA 3EB5A 2YBKA 2EA6A 2JMIA 4LADB 5B77A 5TDWA 2XEUA 4QX7A 3O36A 2L0BA 4BHWA 4XDOA 5FYMA 2VD7A 5FEYA 2YU2A 1LDKC 5H9MA 2OX0A 2WWJA 2MT5A 5FPBA 5FZGA 5FZIA 2LXHC 2Y43A 2W2IA 2YHOA 4WZ0A 1G25A 1HYIA 3NJYA 5FY5A 2MD8C 5EYAF 5F2SA 3C6WA 5FYTA 2VPGA 3VK6A 3HCUA 2L80A 5FZFA 4GNFA 2Y1MA 3MHHA 2OS2A 2QJ0A 3PURA 4GJZA 2YYRA 2DX8A 5IVYA 3M62A 5FY0A 2Q8CA 1VD4A 2CT2A 2FUIA 3N9NA 5FZ1A 5FZOA 5F37A 3GL6A 3KVAA 5KH9A 5FZBA 2KFTA 5B79A 2F6NA 3FL2A 5LKXA 3O34A 4V2VA 4EYUA 3LQHA 3PDQA 5I3LA 4CCGX 2JMJA 1WEPA 5LKTA 5IW0A 3LQIA 2ECNA 4P5OB 3LDBA 5B76A 4HONA 3LQJA 1WGMA 2OXQC 5FYUA 2YHNA 3PU8A 5FY7A 5G04B 4CCMA 4QWNA 2Y1NA 4GAZA 4FJCA 2VJEB 3PUQA 2LXPC 2YREA 2YU1A 3AL6A 5A3NA 3N9MA 4CCJA 4QF2A 2ECIA 4N4FA 4YBSA 3PTRB 2G6QA 1WEWA 4BU2A 4TN7A 5AITA 1WEMA 3L1ZB 3M99A 4E4HA 3SOUA 5FP9A 4FK5A 3KV6A 2M3HA 2I50A 4IGQA 4NUBA 4XI1A 5F3GA 2ECWA 4X3GA 4YC9A 2LGLA 4GD4A 2YSMA 4EZ4A 2KGIA 2XUEA 5F3EA 2VNFA 5FP7A 5C13A 2E6RA 3KV4A 3O70A 4Y4RA 2YU4A 4WA6A 2Q8DA 5FXZA 4A0CD 5FZ4A 5FJHA 5FZMA 5A7NA 3N9QA 2D8SA 2RI7A 2VPEA 3N9LA 3O33A 2E6SA 1RMDA 5FUNA 4S3OC 3T7LA 4YADA 3PHDA 4R2YA 5FYBA 4BBQA 5FXWA 2PNXA 3PUAA 2KWKA 5FYIA 5FZCA 5A3PA 3RVHA 4CCKA 3C5KA 4NN2A 1E4UA 5FP4A 3ZPV1 4ZQLA 5LCWB 1JOCA 5D1KB 2K16A 3UYJA 2JRJA 2YQMA 5FPUA 4UP0A 5A7PA 2BAYA 5ANQA 1XWHA 2VPBA 2XDVA 4CA1A 2LGKA 2OQ7A 5FYZA 5KH3A 1Z2QA 4LITA 4QX8A 5FP3A 1WEQA 2YBSA 3RTRB 2GP5A 5TRBA 4I7DA 1WE9A 5K4LA 1LDJB 5FY4A 1Z6UA 5FZOB 3GV4A 1F62A 2MUMA 2XB1A 5F32A 4UF0B 4LIUA 2L5UA 5FUPA 3T6RA 5B75A 3U5NA 1VYXA 3RPGB 5FZ6A 5FY8A 1FP0A 4QXCA 1VFYA 5LWBA 1U6GB 3ZTGA 3ZYQA 4UF0A 2VP7A 5FYSA 5A1LA 4PTBA 3AVSA 3SHBA 5F5AA 2YPDA 5DINA 3KV5A 2EODA 2LGGA 2K4DA 2KWNA 2M6MA 2RSDA 2LDRA 4YBTA 2QICA 2OT7A 3AL5A 3KVBA 2KIZA 1IYMA 4B7YC 4TKPB 5FWEA 3PUSA 4DIQA 5LY1A 2AN6A 4WZ2A 4V3KC 3N9OA 3LD8A 3AVRA 5A7OA 2F6JA 3V43A 4IGPA 2YQLA 4ASKA 2Q8EA 5FERA 4Y33A 5D1MB 5FZKA 2MA5A 5F2WA 3IHPA 4S3OB 2JMDA 4A4BA 1FBVA 5IWFA 4CCOA 2M85A 3O7AA 4CUGA 4AVXA 1Z60A 5FXXA 5A3TA 5FB0A 5C11A 3ZVZB 3OPTA 2H0DA 5H1UA 4GNDA 4YBMA 4C9ZA 3L11A
chains in the Genus database with same CATH superfamily
1GMMA 3O37A 5FZ3A 5FPVA 4PDWA 3H1YA 1QOTA 5JWPA 4CCDA 2RS13 1POV3 4EZHA 3EUHA 1CONA 1ZBDB 1SG3A 2EIEA 1RVF1 2D5HA 5LG3A 3RLFF 5A3WA 2GC3A 2M1RA 1NQDA 5IFPA 4FFGA 2R043 5ERLA 2MPFA 2ACXA 3AMMA 1RUJ2 3KGZA 1ZBA3 1LTEA 2Y33A 5T52A 2BYVE 2KR4A 3POBA 2DURA 3CJXA 2XLAA 4IE4A 3ZSKA 4U72A 2V4AA 1HG5A 4P9LA 1RUE3 1APNA 4PCRA 2R1DA 2FDFA 5CU1A 1AHSA 1XNTA 3WF0A 4C0BA 5FZ9A 4LJHA 3CNAA 2RJLA 2PQQA 3NNGA 4PPEA 5JG6A 5CFCA 4YG3A 3UGFA 4NPRA 5LKUA 1QF3A 4XJAA 1GQPA 3ZMZB 3AYAA 3DPRB 4JAAA 3POWA 1LOEA 4FT8A 1QH7A 4CZSA 2GP3A 2XM1A 1RYYA 4PIYA 1RUH3 3O1HA 1W9WA 5LATA 5G05B 4Z8BA 3JUEA 5T50A 2C2LA 1SBDA 4PIXA 4A56A 2ZABA 2BUKA 1EV11 3NKZA 1B35B 2QDRA 4KBBA 2EHOA 2BPA2 4LF4T 1RUC1 1KNPA 1HKDA 2X5IB 3O47A 2WAOA 5A80A 2ZM6T 3UT5E 4L0RA 1W8HA 3DPLR 1ZZ6A 1RUG3 4XUTA 4O4LE 3QB5K 2XONA 1C8M3 2PMWB 5JDMA 3Q8CA 1GWLA 1RUF2 3CQGB 3DEMA 2VD7A 1AJKA 1RITA 2WY2A 5FK8A 3RYHE 4CDQB 2VG9A 2VMDA 5J1XA 3IIIA 5KXEA 2DWKA 1WCUA 5LB6A 2FMDA 4BM8A 3WDXA 3ZFFC 4LF8T 2E53A 1HB2A 1GQGA 2XLFA 3ZYLA 1EAH1 3PURA 4DR4T 4IDNA 1BHGA 2W1UA 3HWJA 3GBFA 4YTMA 5FZ1A 3VRAA 2O8OA 2JMKA 3ZCIA 3FL2A 1JUIA 1J3QA 4DV5T 1T6GC 4CCGX 1TNRA 1UX6A 2LHNA 4ZKTB 1F15A 3FC0A 1HX8A 4JQRA 5FY7A 4E27A 2VQET 3M1HA 1PZ8A 2ZM0A 1UYZA 4FJCA 1W05A 3O1OA 4XAAA 4XBLA 2EXJA 1FOD1 1JNZA 2WNVB 2C4XA 1WEMA 4GK5E 1PK6B 4QH4A 2MTQA 3E6CC 2M3HA 5HCAA 4LFAT 2WLPA 5I0SA 4LBNA 5FUIA 3DL3A 3WINE 5LK5A 4OFGA 4Y1YA 5CA6A 2E6RA 4FSJA 3WNLA 1S2EA 2IHR1 4WVWA 1RXFA 3OD0A 2Q8DA 1XWMA 5FXZA 3GXUA 2V26A 3Q9OA 2A3DA 4IETA 4YVSC 5A7NA 2W52A 4DMIA 3RYRA 5IK7A 4XPVA 3M7AA 5JZGB 3PUAA 2G19A 3I3BA 3E0ZA 2YYOA 1WUVA 4EN8B 2BWCA 2HPJA 1DQ6A 3RJ2X 1WMFA 5ABGA 1YIPA 4O9EA 2WWVA 4A7ZA 2VZTA 2YOEA 2ACZA 3JQXA 2C26A 5DZEA 1X9BA 5CFBA 3VBHC 2X09A 4NPMA 3RRCA 3VZKA 5J98B 1PVC3 1HB3A 1GOGA 1NA1A 3JBG2 5L7OB 3CK6A 4CA9A 2BG9A 4OI2A 2NTXA 1P8JA 1KEXA 4DRVA 2YDSA 4QPWA 2XUMA 3N3HA 2XPKA 2DBNA 1UMZA 3CMLA 5F5AA 4P09A 3SWHA 1WMDA 1FAYA 3N7LA 2EIBA 2WL1A 4C91A 2VQAA 4L97A 5EQUA 1DQ0A 5EWSA 4B7YC 1RUG1 2CA5A 2J47A 2Q9QB 4RA0A 4LBKA 2VNRA 3T1MA 2F6JA 5A6YA 4ASKA 4UYBA 3ZN6A 2ERFA 3LIHA 4QT6A 4A7KA 2GMMA 3IEEA 1RXGA 1URXA 4CCOA 1VBD2 4LF7T 3AE6A 3ZJ1A 5FXXA 3HKCE 5ABJC 2ADEA 3Q9DA 3BOWA 1J3PA 1LOCA 2G1MA 3CQOA 5SV8A 4A4CA 1X4IA 2X68A 4OUMA 1O4TA 2OVUA 2VCMA 3B94A 3VRBA 1MACA 2Z4FA 5CFCB 3VDAA 3MW4A 1RUD3 4M00A 3HKEE 3MIGA 1VMJA 4HL0A 4AFBA 4QX8B 4FOVA 5HPOA 2EALA 2GZWA 1H7CA 5CKQA 3VGIA 2KR2A 1VBA2 1WEUA 3ITQA 4JRAA 2LKHA 4UAPA 1WLWA 1MVQA 4P0AA 3GN5A 2C5DA 1AL22 2D6MA 2V72A 2XVKA 3MUY1 5C5TA 4ZDTA 3VZOA 3C4WA 2GC2A 4TNWA 3PJAJ 3WCSA 1FIOA 1K5MA 2BS3A 4LBJA 2JKXA 2FJAA 4AI0A 4NWVA 1OEDA 2E7QA 2WO7A 2QFEA 4KNCA 5F5CA 4AAPA 4NIGA 3HA4A 3BQLA 3DDTA 1KJLA 2LS6A 2TEPA 5IVEA 1QJU2 4BQ5A 4YW2A 3KT1A 2K24A 3FLTA 4ZEYA 2IXIA 4V2WA 1LOFA 2XZEA 4UR9A 5FR3A 1F31A 1W6QB 3ES4A 3SC7X 4ZU5A 1M7KA 2ZETC 5DAPA 2XLGA 3THDA 1W0OA 3U5PA 4GH4B 3FN9A 4BQ1A 1ZREA 4U2AA 5J96B 3O12A 2QQLA 2A70A 2LSYA 1FMD1 2PA7A 2LOSA 3ANWB 1GNHA 3LIGA 4JUYA 1S0GA 1I5ZA 2PFVA 4JGZA 3AZWA 4EXTA 4Y20A 2DCJA 3ETQA 2BDRA 1OHFA 5AQVB 2WFF1 3D0JA 5DJQC 4INDA 5A6QA 3GM8A 4I3GA 4DV4T 1PIV3 2XH6A 5HCJA 4QQOA 2YURA 2PHWA 4P02B 3ZKUA 2E5LT 3HCTA 4X65T 5K0UB 1OOPC 2H6CA 3NRXA 4R4ZA 3FXDB 3E97A 5LY2A 4AE2A 4TTGA 4ZZ5A 1OC1A 4DUYT 4JRLA 1ZHCA 3MW3A 4XUNA 3O1PA 4XDOA 4BJ0A 1D2SA 2WU5A 4IREA 3WG1A 1MS1A 4I4TE 5KXBA 2DHRA 1KGYA 2ORZA 4R8HA 1R1ZA 5FY5A 3TN93 3RYPA 2W67A 3WF1A 1A8MA 5DUUA 2XQXA 2X9XA 2HEWF 4YVWB 5IT6A 5DDJ1 3RZKA 2I6HA 1H1MA 2NR4A 1ND2B 4KU7A 1NENA 3LEKA 5JI7A 4H9NC 2V7JA 1UYXA 4YGCA 4YRDA 3QCWA 5LKXA 4YM0A 5CFDB 4Q4V2 5HYAA 2V73A 2VOVA 4B4QA 2BV4A 2QKDA 2QRXA 2BERA 4H63H 2JDPA 3AXJB 4BPZA 4BCUA 4UV8B 3O1SA 2LSGA 4YZ5A 3SOUA 4E4HA 1QJEA 3P4SA 1VCTA 5FMCA 5IWAT 1BVP1 1RUF3 1WRDA 1N32T 1COV2 1WCSA 1UY4A 3FHQA 3H50A 1U4QA 1NAEA 2R073 4HANA 3HT2A 2VQFT 3UNPA 2OUHA 2XSBA 2ZLYA 2UYAA 1G86A 5HEOA 3RSJA 3MGUA 3MHZA 4C1XA 2YPJA 5L73A 4AEDB 3SISA 3VZJA 5EV7A 2ZGOA 2CRRA 1CD3G 1D0XA 2XHNA 1E4UA 1JI6A 2VW1A 5LCWB 3VN4A 1OOPA 3T9KA 4HMZA 1XU2A 4GYSA 1NY71 1JYNA 3O1MA 2M13A 2W0XA 2YXSA 4Q4X3 5L2LA 1WE9A 1H1IA 2XQ6A 4FJOA 1W2UA 3GGLA 2C5KT 1YCIA 2MKEA 5CG8A 2VKOA 4QXCA 3VU7H 1W8ZA 4XQ4A 3JC6C 2D5FA 3TOJA 1AR92 4X5TA 3JBG3 3AEBA 1UX4A 2VBPA 4GKXA 2WQZC 3PJAA 3V65A 3OYWA 2M6MA 4YZ2A 2ARXA 3UUBA 4Q0QA 2QICA 2B76A 5B4NA 4RHV2 1TMF3 5FWEA 3PUSA 4DIQA 1ZRDA 4HGAA 4V3KC 4OGCA 3M65A 2JDMA 3LOBA 2WDBA 4TWTA 3I2HA 3WEZA 2IC9A 4D0QA 3FEHA 3O7AA 3UJOA 3LOIA 4OI0A 5LJNA 2J1DG 1XJAA 1OEDB 1H2MA 4C9ZA 4NRPA 5F3CA 2YB7A 3ETUA 1Z7S3 2B0OE 2XBO2 4AIUA 5JRCA 4V3LC 2IXLA 4G4FA 1QQP1 2E63A 3W15B 4MGKE 2UXDT 2FD8A 5A7WB 4URAA 5CEHA 5BNQA 1AYM2 4UP5A 3UQ7A 3N4MA 4B3RT 3VBFA 1YQ8A 5AC91 2PLV2 3S57A 4ZI3C 3HMYA 4GH4A 4WVVA 3O35A 4RSUA 2R30A 3WDWA 2WP9A 4HKOA 1ZOYA 1J5WA 4TV8E 3MIFA 5IATA 4LUMA 1D1AA 1D4M1 3O0VA 2VMCA 2ZZQA 3A4UA 4Y5SA 5T3NA 4DBQA 1JH5A 4I7CA 1Z7S1 1T8BA 4XTMA 5IVCA 1RMU2 4YABA 1U5YA 5FMBA 3AC0A 2A9UA 4CRQA 5B8DA 1LKNA 4D6SA 1WW6A 2AZ5A 2CL2A 4W6WA 2BNMA 4XF4A 5FZAA 2JXAA 2BDEA 3PUWF 2D9DA 1WCRA 2ZACA 3ZFEC 3AXDA 2HLEA 4FI5A 1CAUA 2CU5A 3O7OA 4COVA 2QVSB 4IGOA 4UFMA 2KREA 2VZPA 5C3OA 3T09A 4JDNA 1GV9A 5T5LA 1UZZA 1FXZA 1OD3A 5KX5E 1ZBE3 5KH7A 2XQ4A 2DCYA 3QOPA 3L1XA 3OBRA 4CEWA 4HWHA 4CQIA 2GNTA 4EOZB 3LSVA 2I0MA 3L2HA 5A7SA 5G0FA 1OI6A 1K5MC 1QH6A 1MEC3 3LBXA 4TSVA 5H9RA 1W2NA 5F5WA 5D8AA 2KU3A 4Q0PA 4NOTA 3ZVYA 2EAKA 1EYBA 4AQ6A 1Q8PA 4Q4W2 5BUVA 1AL0G 3EVYA 3OUIA 1VMFA 1PIV2 5AFEA 3U37A 4L7XA 4ES8A 1XMQT 5J7MA 1PVC2 1MNDA 1X8EA 2WFPA 2L0BA 4CU6A 2J1RA 3VBHB 2YU2A 5GJ6A 2PJQA 5GKAC 1O4YA 1J5ET 1DF0A 3OY8A 1QLBA 4E4ZA 3P4QA 1BBT1 2VXRA 1Y3TA 1L7RA 4LBQA 1IPSA 3VBUA 4BMBA 5FY0A 4LORA 2RVAA 1W0AA 2LJLA 4MG2A 3ZFEB 1L7QA 4N43C 1S55A 4DR3T 3ZYBA 1QU0A 3QC9A 3ZC0A 4DMWA 2XB6C 3DWDA 5C8WA 3LDBA 2L9LA 1QJU3 1QXJA 2CHHA 3WDUA 5FYUA 1D0YA 4IEPA 1QOSA 3EXUA 3AL6A 2LT3A 2C6SA 3GF6A 2GN3A 1M06G 2OIIA 3L1ZB 3J7NA 4MXVA 5JOWA 4CU9A 5LHGB 3B9IA 2VW2A 4TLGA 4IGQA 3ZFFA 5LK7B 4OK0A 1AXZA 3EHZA 4UT5A 2C5JA 2W62A 2VNFA 5C13A 1VBE2 3AX4A 3O70A 1VAMA 1FX5A 4COYA 5CA1E 3TNQA 2CGOA 4LO7A 5LB7B 3ROUA 3SLIA 1PZ9A 2OW4A 2W9XA 3S5QA 4RS5B 1RUE1 2VOKA 5FYIA 4A98A 5JOZA 3C5KA 5KHIA 4D69A 2VJXA 1S2KA 5A33B 3FLPA 2YZ4A 4V1PA 3SFEA 5J48A 3UQ4A 2RS31 2WRAA 1UZYA 3UKVA 4P0BA 4IGUA 2VUJA 3CEWA 2BBVA 2W1WA 3WW1A 1UZWA 4PJNA 3RTRB 2NW7A 3VKGA 5FY4A 3E6BA 4HFIA 5C8YE 5JIUA 4I09A 4LIUA 3JB8A 2PHRA 3U5NA 1R1A2 4GKKT 2VL4A 3RPGB 3BQIA 2LRKA 2HBTA 2G9GA 4O9GA 2XVLA 1WMXA 4FP2A 1H9PA 4QQ4A 4Q4Y2 4AG4A 4L9IA 2W5FA 2EODA 1RMU3 2X66A 3VR9A 1NLSA 4NHLA 2AEYA 2RM21 3AAIA 4EEDA 1SLBA 5ABHA 1JYWA 3AB0A 4BWOA 2EIDA 3KWVA 1AR62 3JAEA 3ZYKA 5LY1A 4PBOA 2AN6A 1NCQA 1T98A 3AJZA 1I94T 2VW0A 1OD5A 2WA4A 2MA5A 3IHPA 4WVMA 2V6YB 4OHFA 4NUVA 4EB6E 3AK0A 1B35C 1FBVA 1BKZA 1GP5A 4U31A 3LZZA 1UOJA 1C1FA 4QGMA 1R1A1 2XTLA 3WQBA 5A3TA 1IZNB 5L3BB 4Q4Y3 1ZNPA 4OQ9A 5FB0A 1NXMA 4JGZC 3NRUA 1V6JA 1UY3A 5B78A 1WD3A 4Q8KA 2A73B 4UVBB 1X9PA 2GMPA 2VKJA 2DBIA 2FFWA 5A3OA 3GALA 2WAUA 5F7UA 2H89A 3P1IA 4L8QA 2UZGA 5TDRA 4CYDA 4NIQA 3DN7A 1HXS2 4IC2A 3U10A 5LCYA 3LDRA 5F5IA 5EFUA 3W5NA 3O1TA 2XBO3 4CVUA 1N3PA 3MIHA 3SS1A 4FOWA 2AGSA 1PMIA 5I8SA 4XF3A 3AYDA 2ZX4A 2RDSA 3ACGA 4X20E 3CPZA 5EK2A 4JDMA 4XHXA 4TV9E 3AFGA 2B5HA 2YDEA 3RZJA 2HYKA 2L3LA 2BZBA 1PNFA 3KBTA 4D6RA 3ZMVB 3TLWA 1U0AA 2RG4A 3VB9A 1ZRRA 3NSTA 1LJ7A 5L3GB 1MNEA 2JUNA 4QGNA 2ENRA 3CF6E 3G6JB 2FQPA 1QIQA 1V9U2 2BP6A 1NG0A 4O8SA 2XWBB 4NIIA 4H9DA 2JDKA 4YVSA 5JTGA 2L43A 3MACA 5D8AB 3CZJA 4CN6A 2RHPA 1LOGA 4UELA 3ZR6A 3WQ1A 3OGGA 2L7PA 4MO3M 1WESA 2Y0OA 1YWKA 1CAWA 1QJY2 3RKOA 5BMVE 5FBJA 1AR71 2WUHA 4A4AA 3C98B 2K1JA 2ZGKA 2C5IT 2K3WA 4BMEA 4CUAA 2BFUS 2XQ8A 5AQTB 3K48A 2Y6GA 3C8XA 2OQ6A 1R081 3PVEA 5DKAA 2XOZA 3L9JT 1AL21 4BOWA 1NAFA 4KGQA 3NNFA 3RYCE 4YM1A 3I3DA 5HI0A 3K77A 1G9BA 3EB7A 4CDWB 2YUEA 5FPAA 4EN6B 4HEAA 4I0UA 2QQOA 2KWIB 4AXPA 4XQWA 4K20A 3B01A 4DV3T 2VCBA 4AUQB 2LN0A 3AYCA 5IAXA 2WNUC 4IL9A 2PHFA 2JRKA 4GZ9A 5C5UA 2D6PA 5L3DB 1JHJA 2QQMA 3ZEFB 3SUBA 1VIWB 2GN7A 1JZ2A 4LPLA 5GZDA 3ZT5A 5AQSB 5FYCA 4QB6A 4N7IA 1WFDA 1ALYA 5FQ0B 3CZUA 3K3QC 2P6HA 4N43A 4HFCA 1D0ZA 4JVAA 3TLSA 2PXJA 1UWWA 1CN1A 1UU4A 4ASLA 3MZHA 4LBLA 3ZIXA 2JG9C 1ZEEA 4QX7B 3BTYA 2EXKA 3OCPA 1LODA 2DDUA 2CE7A 4L92A 2UU9T 4ZU7A 2VVNA 1YFWA 1NEKA 4PK6A 1BMV2 4YTNA 4JV5T 2YYRA 3V0BB 2ZGPA 4JYAT 5I3LA 5L4EA 1JOPA 2CCQA 4YSYA 3AXJA 1V00A 4K40A 1SACA 1XYPA 3VR8A 2DCTA 4QPGB 4QWNA 1G6NA 4GMP0 4IV3B 1XDPA 3NWIA 1HQLA 3S0MA 3U0ZA 1J1LA 1QXPA 4TN7A 2G9ZA 4E2GA 4CEYC 1O8SA 3C7OA 2OWAA 2GNBA 4Q27A 1CQ9A 2ODVA 3J8F2 1IBLT 1QQP3 1NA1C 2YSMA 1YXRA 2KGIA 4UBGA 1V6IA 4XETA 2WBLA 4BIOA 4H9QC 1EV13 1BZWA 2VWAA 3T1YT 2ZPXA 4IL7A 4A6SA 2DCKA 2R062 3SQOA 5C3JA 3N9QA 2YROA 4IW3A 3VD9A 1BXHA 3VZLA 4ILBA 1W6NA 2JG8A 4MGYE 4O7XA 3UKTA 2LAUA 4Q4V1 3KCCA 1XNDA 3I9YA 2VTFA 2XJUA 5FMOL 2CBJA 2ILMA 2CLYC 2A6YA 3OBAA 3EYPA 1IJ6A 4OX9T 3GV4A 3VD5A 1F62A 2BVVA 2W94A 1N1TA 3THTA 4Q29A 3AKTA 2UUAT 3OYWB 3MICA 5DQVA 1N33T 4YZ3A 2BOJA 1Z8UA 4DEVA 4DNDA 5KHKA 1UOGA 4PJLA 2ZTNA 4YARA 1C4RA 2EIGA 4GH4C 3D0SA 3EDVA 4GA9A 4BQ2A 4NHXA 3IKWA 5GONE 5JLVA 4WZ2A 1KS5A 5FFOC 3MIBA 1HXS1 3TYJA 2A75A 2MEV2 4GIWA 4Z2WA 3V43A 2HPLA 1PZ7A 2BBJA 3BOPA 2XHKA 4PNIA 3ZYIB 3LGRA 4B4PA 2W92A 4AR2A 3IPVB 2W87A 3BU7A 3I2FA 2RV9A 2NWBA 2A6WA 2NZ9A 2W2UA 1E57A 3TNPB 2RR12 3WNPA 1QJX3 5H1UA 4LLFA 4KGGA 1FT9A 2E9XC 4CCNA 1O8PA 4LBMA 1HLCA 2QIZA 4FCAA 5KBFA 3KHBA 3V56A 1GNYA 1S4CA 1OFNA 3H7HA 4ZI2C 1Y9QA 4K1YA 1GP4A 3HEIA 1YFXA 2MEV1 1J3RA 3PUHA 3WZ1A 2CSZA 3GYDA 2OV9A 3RQWA 1RL3A 1DG6A 2WSVA 3WP5A 3DXTA 2WNUB 4CDWA 3NG2A 1IPJA 5IVFA 5TBNA 4DMVA 3C4XA 2WYFA 4PJMA 4HWIB 1SLTA 4MGZE 2QTWB 4I2OA 2ECJA 5TABA 2BWAA 2YDRA 4KMQA 4BH9A 2BVBA 4MVTA 2R072 3C4ZA 3MF6A 3N9PA 1BLZA 3PV0F 4OZOA 4CCLA 1GQHA 2ORXA 5LEKA 2ZEXA 3IDBB 3AZVA 1XE0A 5GZEA 4L5GA 1QKQA 3UU4A 5LA6E 3NNMA 4LT5A 1NLQA 4FXGB 4DV2T 5IHRA 3HNBM 1HG2A 1VB4A 5CB4E 3VBRB 4F8HA 2QQPA 3H3ZA 2ZEZA 3EB6A 2BU9A 3Q5EA 4MUVA 3WW3A 1CAVB 4NE9A 2WMNA 1K5MB 1JXNA 1CPMA 2A6XA 4YAXA 5FK7A 1O7FA 1E5RA 3POIA 2NAAA 3KQIA 3H8OA 2ZEWA 4IESA 2R16A 3RFRA 1XDOA 5I8TA 3FX3A 3AJYA 5J1GA 2VPVA 1TZOA 1ASJ1 2LV9A 2F42A 1YQCA 4LHSA 5H9QA 5BV6A 4AP4A 4JGYB 5A32A 4YM2A 3ZYJB 3KV9A 3M7KA 3SEPA 5CZKA 5JXJA 1SZBA 3UV9A 4ATFA 1DQ5A 2ZMAA 4GK0E 4NO4A 2VPDA 4WW0A 1OH4A 3VUOA 3HN1A 3ZNIA 4QWNB 1NCQC 3NQHA 3AE7A 3D5OA 2JIJA 1GKBA 4LKFA 1GWKA 5L4HA 4GIQA 3GWHA 2XL9A 2KZ7B 2AYHA 5AFUL 5JR9A 5FEYA 5FZGA 2YHOA 4DY3A 2W2IA 1UZVA 2MD8C 5EYAF 5FNVE 3HCUA 5LBEA 2WQYA 1ND3A 4QDSA 2B4KA 1PO11 5A6ZA 2WINB 3Q8AA 4DB5A 3OSDA 3T8OA 5IYZE 5B2GB 3R0RA 1WR6A 4YZ1A 5FZOA 1ZVFA 1CIWA 2VUCA 2JJ6A 3WT3A 2BVMA 2NMOA 4CEYB 3AA7B 2UWCA 1X33A 5G04L 1MBMA 2LM9A 1GUIA 5B76A 5DUWA 5CKMA 1COV3 1MS4A 4K1ZA 4GWMA 2VJEB 1RHI3 5I91A 4HK9A 1XYNA 5H9PA 1YQ4A 4UV9B 2EHOB 2H0BA 4MALA 1UXXX 5CADA 1SHWB 4RD7A 3BTXA 4Q4W3 3L09A 2EAAA 3QH6A 2LHRA 1LRHA 1AVBA 2GK9A 1W28A 1OLME 3OPCA 5CFDA 1R092 1XSQA 3I2JA 1AJ3A 3Q5WA 3S7EA 3PTYA 1FMVA 5C8CA 4B6XA 4P9XA 2O8QA 1ST8A 4LO4B 4R2YA 4YW5A 3V0AB 4X66T 1DHKB 3RC3A 3RVHA 4CCKA 2IXJA 3LDQB 3MF9A 3WCRA 2BS2A 4AHWA 4Q5OA 4PW8A 4DRRA 3WNNA 2RR4A 1XWHA 4CA1A 4WBNE 1DP0A 3M70A 3QNUA 2X8KA 4O61A 3RKGA 4N53C 4PI0A 4M0HA 3N7KA 5HCBA 2ZGLA 3OBVE 1W9YA 2P6CA 5ACA2 1VFYA 1NQJA 3ZTGA 4EROA 2ZA9A 5JXHA 5A1LA 2JDNA 2HWB3 3UKNA 2DU1A 4B8EA 2XWJB 2V5CA 2PN5A 4DZGA 2VCAA 1PK6A 5GZFA 2IDOB 3AE5A 1LOBA 4AI8A 1WLXA 4COUA 1G9CA 3ZSMA 5BNNB 4EEBA 1W09A 1AYN2 4OHZA 5IWFA 2HWD3 4XOGA 1DBNA 3TB0A 1MQTC 3KSCA 3RPQA 2PLV3 3RZHA 1OPMA 4UW4A 5KDMC 2ZM8A 1N3QA 3LB9A 3L11A 3PL0A 3I3EA 4S2GA 3BI3A 1YUDA 1DZTA 1SUMB 1ZBA2 4HPKB 2RS51 3B02A 2RS12 5ABJA 3HD8B 5AQNB 5GLUA 2AACA 3VBRC 2ZMKA 3TAYA 1BYHA 4IC3A 1KDMA 2VZQA 2KWHA 3AZZA 4UWDA 3IZOA 1SLCA 4O64A 4DO0A 2C0SA 3KQ4B 2CXLA 3BB6A 1AYN3 4JI7T 4UVCB 3T1HT 2IUBA 3PMEA 2XBO1 4KH9A 1EP0A 4IV1B 1I9RA 1CAVA 4IEZA 2E32A 4ZS3A 3WF4A 4R8PK 1MQTA 1LEMA 2MD7B 5LBCA 1WLCA 4QX5A 4AEJA 3S5AA 1LKXA 1W6MA 5HXCA 1SFPA 3I97A 1OA4A 5BXXA 4NRMA 3UU8A 1WEVA 4AKHA 3VD3A 2D0TA 4ITCA 1W04A 1QJX1 2B39A 3H3AA 3I1AA 2HYED 1HFAA 4W6XA 4E7ZA 2HWE1 3RIUA 1XE7A 4QXBA 2ZX2A 4OUSA 5FO8B 3WP4A 2ZMLA 2P5BA 4QX0A 4HG6B 4P1NA 5A7QA 3UL2A 3KNVA 1JZ4A 2FBWA 2YW8A 3F2EA 2HH7A 4LBOA 4CDXC 3W58A 1ULEA 5BPXA 1L3JA 5FYYA 4PJYA 1HX6A 2VVDA 4NMIA 2HN1A 2NP0A 1IKPA 3H37A 3IDEA 4QM8A 3L39A 1UOFA 3JAFA 5JXIA 4YFZA 4LO6B 4FXKB 3CDZB 4AKIA 3UETA 3I54A 1ND2C 1BORA 3RC8A 4LF6T 1ASJ3 2ZOEB 3ST7A 5EJZB 4YYOA 5C71A 2CM0A 2XQAA 3I0QA 3PMSA 1MPXA 4BQYA 2VJEA 4AXOA 4AKLA 4EE2A 1KDKA 2J1TA 5FZ0A 1GOFA 3EB5A 2YBKA 4LADB 3POYA 3A5XA 4BQ3A 4JEUB 4QX7A 1M62A 4BHWA 2WZEA 2RS53 4YJ3E 5FYMA 3C3VA 4CZZB 2B7YA 3JU9A 4XFIA 4HETA 1OQDA 4XABA 3AZXA 4Y1XA 4YGEA 3C6WA 4QQ2A 3ZN4A 2L80A 3VDDA 4DR1T 2D6OX 2DWRA 5GLZA 1WA6X 4HT1T 2W00A 1N1SA 5DABA 2OS2A 5C8CB 4GJZA 4DPNA 3NNLA 2Q8CA 1OLQA 1MMNA 4YW1A 3W59A 1GBGA 3CU7A 3O34A 4R52A 1ENSA 1WEPA 2UXNB 4ZZ8A 1J59A 1GZWB 4TNVA 5AFBA 3IHRA 1CAXA 2OXBA 1QNYA 1VRH1 1YJKA 3PUQA 1RJ8A 3HQXA 2LXPC 3N36A 3O0XA 5LA9A 1IS5A 5JDNA 4OZXA 2WYSA 5FP9A 2UXBT 1D0GA 4QDRA 4V1Av 1BVVA 3ZSSA 2VTXJ 1BBT3 5SVIB 1O4ZA 1C5IA 5F3EA 4J6GA 4XUPA 4FFFA 5K0UA 4G2AA 3ENRA 2ZGNA 4RGKA 2C24A 4DUVA 5FMOS 2MYSA 4B7KA 4DUXA 4HFHA 4GWNA 2GH2A 2V7IA 4UOJA 2PNXA 2CSVA 3ZN5A 4F6RC 2XJSA 4NN2A 4YSXA 5FP4A 4C0HA 2ZCWA 1PGL2 1NE6A 4NN0A 4WM7C 5AQGB 2IXHA 1AF9A 4KHZF 2VZ3A 2X9HA 5KH3A 4Z92B 1OUXA 2JENA 5C33A 3WDTA 1MMGA 1WEQA 3WX5A 3CQXC 2VQUA 4NPLA 2X0YA 5LNKA 1N47A 5F6LB 2XVGA 1UMHA 3J9SA 2UXCT 3T3YA 2ET1A 3ETPA 3HBKA 3ZYQA 2SBAA 3OGJA 3HBZA 2R061 3RQUA 2BGOA 2KD7A 4LBQD 2F4PA 2P3KA 1HN1A 1UKRA 1S0BA 4HLTA 3J4UH 4RFT0 4J25A 2PHLA 4OMDA 3POSA 5A7OA 2HWC2 1OLMA 3N2KE 3K4DA 1W9RA 1WMEA 3I59A 2DVDA 2FBEA 2WDQA 3FHIB 5A70A 1M4WA 4EQVA 2WO3A 2WZR3 1RUNA 4OUEA 1DU3D 4FPCA 3F2ZA 4EGWA 1ENXA 5EK3A 1BK0A 5HCFA 4HWCA 1ULGA 4CSWA 4HN1A 4LHNA 2O1QA 1ZRFA 2YV8A 3F31A 4NPPA 1SLAA 3MFAA 3RZZA 3TEZA 4QH1A 1YI7A 1I6ZA 1HQNA 2HDPA 1RUJ1 5FPXA 5C3SA 1X9TA 3WNMA 4UFKA 3GJBA 3C7HA 1OVPA 4HVQA 2XKOA 1B35A 5KR7A 2TUNA 2P4EA 3J9X1 4AKRB 2VULA 1D4VB 1GZTA 1AR73 4Y1UA 2LRIC 3O4XE 4KL1A 1FPN1 2EA7A 1XE8A 1X79A 2G4IA 2CRBA 2LSKA 2X5IA 4FPEA 3HT1A 5FPLA 2XY8B 3GDBA 5DDJ3 2D44A 4GWJA 3LEMA 1KNRA 3WVJA 1N87A 4YGDA 4RR3A 4AGGA 4XUQA 2CYFA 2KA3A 1LESA 3I2KA 4HOOA 5F1RA 3N7JA 2JMHA 4MLKA 2VUAA 1Q43A 2XAJB 5CB7A 4KWUA 1T1HA 3LRQA 2WO2A 4ZUXU 4H9OC 3RIFA 3P6BA 1IOAA 4UXNB 5IUQA 4LLBA 4X6RB 1CIYA 4HKAA 4YT0A 2MNYA 2YEVC 4Y4YA 3ZYMA 3P3PA 1JYVA 3ZYGA 4MZUA 3DV8A 1SDDB 5FY1A 5LKZA 2J42A 2VASA 4NHYA 5AQOB 3CX7B 2RM23 1BR4A 1GQEA 4NXNT 1OVSA 4AQSA 2SPCA 2CPTA 5DUVA 4AF9A 1DYPA 4O2AE 3B13A 1CHUA 4IDOA 3RIAA 5HCHA 1V9U1 5JRCB 1H8VA 4CU8A 1MZEA 2MPKA 1G9FA 5EYYA 1NOVA 3D0TA 4N53B 4Q1RA 1SFYA 5A7WA 2F4LA 4EN9B 5IJRA 4DXZA 4M1PA 2WNVA 4LOSA 3WLUA 2YGLA 5H6RB 1OSGA 5E6HA 5KMGP 1IQDC 1DYKA 2RS33 1NX9A 4ERRA 2LEHA 3OEAA 2K17A 2V8SV 4JI0T 3ZMUB 1AR72 4FOQA 1PM7A 1YYNA 2HWE3 5HEGA 4PLNA 1XRUA 2PHXA 3S4UA 2VY0A 3PUZF 3WW2A 5LXTE 3EBRA 1OEDE 1EAH2 2E8IA 1JOBA 1G9AA 2E5VA 1ZKEA 4L0PA 1JNRA 4GB33 4MADA 4M3CB 1YQ5A 3WW4A 1IAPA 5DUXA 1HV1A 1MIYA 2K9AA 4FQZA 1WBFA 3HOBA 4CEYA 1VD4A 4CDWC 1X7NA 1RUH1 4H3WA 5DZFA 2QA7A 3UGHA 1JHNA 1O6UA 4IEVA 5FLHA 2O14A 3PUYF 4LHKA 4CCMA 3N2OA 1A6CA 3MW2A 5BNNC 2YINA 3WQ7A 5JVDE 2BBHA 3PTRB 5LOVE 4GB32 1O3RA 3VHNA 1JODA 4FK5A 4HFEA 4XZCA 2I50A 1WCKA 2RS32 4ZY9A 2WZPP 3G06A 3ZN6B 4OHXA 2ZMNA 2L8KA 3AEAA 4AW7A 2JDUA 1RB8G 2Q1MA 4J1XA 1RHI2 3ZXFA 2RR13 3RYFE 4NWWA 3ZYFA 1YKHB 4KX6A 2PAMA 4I0WB 2E6SA 1OF4A 4S3OC 1DGWA 2XPJA 3VV1A 4Y22A 5JMOA 1VP6A 3DP7A 1PO22 2JIGA 4AQFA 5EZWA 1TG7A 2AR6A 3QACA 3IB3A 4ZU4A 4LMFA 1A3KA 1ONAA 2OQ7A 3MO4A 5FYZA 1ZRCA 5K0UC 4XC9A 4QXKA 3O14A 2X05A 1DGWX 2LW8A 4S2DA 2ZZJA 2ZHMA 2VAUA 3TRSB 5FY8A 5LMNT 2LKGA 2IAKA 1VLNA 4W6YA 3BPSA 1ZZ9A 4MLOA 3G7DA 3VHRA 4FPLA 4YLHA 3MIEA 2DNXA 1FV2A 1BR2A 4XF0A 2PFWA 3ABZA 1UPSA 1YHFA 2VZ1A 3T30A 1QDCA 1YFUA 4HXCA 5BNPB 3ILRA 3UFEA 3QD6A 2VE1A 1HXS3 1TME1 3ES1A 4S3OB 2DCZA 2C1FA 1B7TA 1Z78A 4MXWA 1YEWA 2RE9A 1ZZCA 2PHDA 3OG2A 1EV12 4CDUA 2HN2A 2ODUA 1HCIA 5L3CB 3HAGA 4QX3A 2P17A 2KT9A 2L9QA 2VUDA 3MZKB 2K0GA 3DF0A 5LCWL 4I50E 3J7HA 4DXSA 1W0BA 1AXYA 1XB9A 2ZS6B 5KHHA 5L9VA 2DFBA 3HTKC 4LKEA 3SKJE 3JQWA 4RFRB 3DXUA 5HBAA 1C1LA 2VKDA 2DFCA 1N1YA 1WFKA 1JYXA 5LRSA 3HI2A 3M3EA 2G43A 1SLLA 4P08A 4XMIA 1SE7A 4K0UA 3FL7A 5CFCC 2KNDA 3HJRA 4E4DX 4JC1A 1JU4A 3CKDA 5JDQA 2VMEA 1G73A 2LGVA 4QU1A 5JCTA 2J62A 1IS3A 3PU3A 1Z0PA 4RN5A 2FUUA 3X1DA 1G9DA 2CY6A 4PFOA 3K4ZA 2GALA 2HWD1 5I0DA 3JZVA 4WBBA 1OA2A 4Z0OA 4D8MA 4LOTA 1JM7A 3DKQA 4R7EA 4XIKA 3RZGA 1WILA 3IBMA 4D6QA 5J09A 1UAIA 1KK7A 4A97A 4NHKA 2QBXA 2D3PA 2X0LB 4WZXA 2X53S 3UULA 4F1PA 1IG3A 3WQ0A 2YN6A 5GM0A 2DF7A 2JPFA 3AM2A 2ES3A 4YZ4A 5JPMB 1K5JA 2I74A 5FY9A 1W2AX 3ZXAC 5DAWA 3WAKA 1MIVA 3T4HB 3E5QA 2A6ZA 1YKEB 1CHCA 5ABFB 2LQ6A 2WWSA 3HQUA 4WM8C 1H2LA 2XMLA 2XJPA 3OEBA 4WM8B 1CZTA 2I2SA 3RRWA 5K3QA 3PLWA 2XAQB 5KXDA 4UFHA 4BLJA 3AKPA 4W8JA 1WIMA 2Y6FA 3IBPA 2MNZA 5F39A 2D0UA 5A3MA 2FSAA 2HWF3 4XXAA 2JX9A 2VNVA 5AC92 2EA6A 3R4UA 3JBG1 4PI2A 4IDZA 1W06A 4JI2T 2HJIA 3PDYA 1H9WA 3H42B 1YIFA 3H8UA 2LALA 2Y34A 3B5LB 1YNAA 5F3JA 3IDAA 4H9PC 2HKXA 3CX8B 3ZDVA 5IHYA 5HXRA 5ETWA 1HB1A 5F37A 4P5HA 5EJ3A 2JJ9A 3PNAA 1RHI1 4RQPC 4R9DA 1BEV2 1PK6C 1D4M3 4B29A 1SPPA 1C8M1 3AAAB 1WGMA 1KNZA 4CTEA 4JQTA 1US7B 3KBUA 4GAZA 1PHMA 3DKWA 2XASB 3UU3A 1HTJF 2CNAA 1KF6A 4F3JA 4PJJA 5CYYA 1PO13 1HRI2 4YM3A 2R0FA 1HNWT 5JOYA 4NUBA 3TEWA 4AAXA 5JZGC 4X3GA 3W20A 4YG6A 3SNMA 1F5JA 3SHRA 1QDOA 3I2GA 2QZ2A 3MDBC 4CXXA 1XQNA 1OURA 5FZMA 5ANNA 1V6MA 2GC0A 3RJRA 1UW8A 4YADA 3JC6D 1W8OA 4Q0VA 1Q3EA 4A5XA 3FXEB 3WG4A 5A3PA 2BBAA 2DVFA 3BCWA 2WZR1 3R4SA 2XQYA 2UXXB 1RUD2 4LO8A 3QUJA 4Z90A 2VPBA 3OF1A 1WWYA 4YTPA 3OBZA 3AA0B 4LTAA 1I1EA 3U4XA 4EWAA 4O65A 5KWRA 5AQIB 3IAQA 3MA9A 3M3QA 3T6RA 2JD9A 4JHZA 3PE0A 3HKBE 1XZYA 1U6GB 2BGPA 4UF0A 5LRRA 2PHUA 4ARYA 1R091 4QHZA 4X6QB 2R1BA 2FCVA 4PTBA 2D5UA 3IMMA 5DINA 3AP7A 2KKXA 2XJ7A 1CJDA 5IAVA 2IC6A 2VZUA 1O3XA 2RP4A 2AC1A 3DPRC 4TN7B 3UJQA 4MHCA 4OCTA 4YGBA 3I59B 1YFYA 2KM2A 2LOPA 3CL1A 4W4ZA 3LA2A 4D7TA 2Q8EA 3ZCJA 5FERA 4WBOA 3GZTB 2HBUA 2X9YA 2VU9A 1AR81 2Q9QD 3MLLA 3WXPA 2ARCA 5LP6E 4JI8T 1SQ4A 4PDWB 3ZVZB 1UX7A 3M4FA 2JQKA 3I8TA 4ADZA 1STMA 3B57A 2QE3A 2JG8B 1JUHA 3OGRA 1HB4A 1HYJA 1KEYA 2KXLA 4L58A 3F57A 2R071 4S2HA 1AYM3 2EF6A 4LEJA 2PTMA 5JDHA 3WAJA 4CDXA 4CI1B 1D1BA 3O5SA 4RHV1 1GANA 3OPWA 5FXVA 3LBXB 2HWC1 4HWDA 1WYBA 1RVF3 2NM1A 4A3XA 1H8TB 2H0DB 3GJAA 2JIWA 3LK42 1AYN1 4GKJT 1JZ5A 5LEJA 4CP9B 1REDA 5C3RA 4U74A 3B3QE 3NJVA 1F5FA 2DTYA 2VQTA 3WG3A 5DDJ2 3IF8B 4QPYA 1V9U3 3PVOA 2E6VA 1RUI2 2V7KA 3ZLIA 2QQJA 2C9AA 2X51A 4IHJE 1WLDA 2HWF1 3MFCA 1UYYA 2RDRA 4HFDA 4IV1A 1H2NA 1ZM1A 3AECA 1DZRA 5E1RA 1ODNA 2D2SA 5APAA 5C9AC 4ZXLA 1SBFA 3WY6A 3IPVA 3MEPA 1KITA 5LHIB 4DOUA 4FO9A 5EP9A 5HXEA 1FNYA 1LECA 2D97A 4QAWA 2ET7A 4GXLA 3M2MA 1X4UA 1OA3A 2DUPA 2QQVA 2UURA 1HNZT 3CMGA 4XZPA 4GMP3 2YY1A 1X36A 2DCFA 3ACFA 4BJNA 3L3PA 4LIVA 1E2AA 5H9SA 3ZM8A 3RI5A 4G9SB 3USUB 3ZN1B 1LVFA 1UO9A 3GNEA 3Q1DA 5CA0E 4XTPA 3AEFA 2VQ0A 4FTSA 3T0BA 4KBZA 3WNOA 4I0BA 3UUMA 4DV1T 3PUIA 4L11A 4TUYE 3SH4A 3HCSA 5FVLA 1SPPB 3MPPG 1W8UA 4TZDA 5AIUA 4IXLA 2ATFA 4LJNA 4XYXA 3MKDA 4U7YA 3ACLA 1OXCA 2E2AA 1KD7A 1SEFA 3LJCA 4YATA 3MXZA 4Y5Z0 2I07B 3SRZA 2VXJA 1WBLA 4P14A 2JMIA 5TDWA 4NJ4A 2B9UA 1C8M2 3E5XA 2XEUA 2QGSA 2OX0A 1LNSA 3NJYA 3ZPYA 2XQRA 2Y26A 2FHRA 3VK6A 1US3A 2IXKA 1MEC1 4N7UA 1WCDJ 1WCQA 3FJSA 1HRI1 2RDQA 2Y1MA 2ETEA 3VBRA 2IQJA 5EZYE 1D0HA 1MS0A 5JI9A 3M62A 1T7SA 3C7GA 4A42A 4DQAA 5LBFA 5KH9A 3AZYA 5FZBA 2VNOA 2F6NA 4V2VA 1OF3A 2FJBA 5LKTA 5IW0A 1ZBE1 2ECNA 3RZMA 1O3QA 4FPKA 1V70A 4D7SA 2XGXA 4HONA 5JR2A 2FCTA 5D8AC 1LHWA 3ZXJA 1H0BA 3I0OA 5DG2A 2YU1A 2ZX0A 4QHOA 4XEZA 4CCJA 2VMIA 5LYJE 4ISSA 4GKYA 4FTEA 3ONLC 4N90A 1OOPB 2QCSB 4E9KA 5AITA 3HVDA 4QMAA 1SFNA 3NL1A 2YDQA 4XDQA 3EDUA 2KLQA 5FKYA 1WYCA 1OFSA 4JI1T 1NYWA 3A8YC 4YW3A 2JB8A 4XJUA 1SMVA 4OHWA 4XXPA 3CJIA 1WZXA 4OI1A 5HAXA 3OOXA 3Q8FA 3EHKA 3NZPA 5FL0A 5CKNA 2X67A 3FJUB 1COV1 4LKDA 3CBNA 4RR3C 1WD4A 5HV4A 2CGNA 3R05A 2P9BA 2LM3A 3H8XA 1ZZ7A 3ZPV1 1H2KA 5T5OA 2XL7A 3ZYHA 4BZ4A 3R6SA 4QKFA 5BY5A 3PUXF 1ND3B 4X1KE 2ZGSA 3S7IA 3TEXA 2VMHA 4JKKA 2R042 2YBSA 5F5QA 1RUF1 1X50A 2MUMA 4OFZA 4O4JE 2IIUA 4LQRA 2WIIB 3I9WA 3NV4A 5IFTA 1JMUB 1LAJA 2WNVC 2V6XA 1WW4A 2FJEA 2NOXA 2RJKA 4WV8A 3EABA 2KKYA 1X8MA 4AOCA 4OHVA 2K4DA 2MNGA 2M6BA 3C51A 1POV0 2Y6XA 1JZ6A 3BQKA 2Q9QA 1LB2A 1J58A 2YK0A 2N7GA 4FPHA 3K4AA 3HN3A 5D21A 3URFA 2WLQA 1PO23 4DR6T 3P4PA 5FL1A 1GZCA 4U2YA 1CAWB 3AKQA 4CUGA 5IYYA 1X82A 3GCWA 4EJRA 3ETVA 3KS7A 2WN2A 1XPWA 3CLPA 3RMYA 2VC9A 3D6EA 3LDYA 3AEEA 1KFUL 4H55A 4Z07A 1XNKA 3V0AA 3ZMOA 1BCXA 1EUUA 1UY1A 2SLIA 2HEYF 4I3PA 4ZOLE 5KC5A 3MV01 4Q4Y1 4Z91A 5CG9A 1QJX2 3OUJA 5FP8A 3GBWA 1NCRB 2HWE2 4FOYA 4LLOA 3SKVA 3C7EA 4LHLA 2BKOA 2PTFA 3APBA 2Y8KA 2FZ2A 2CLYB 1JN2P 3B9CA 2CMRA 1GWMA 4CEWB 2WFF3 2NMNA 1FNZA 2ZGRA 2LSJA 4AHZA 1PGW2 3CHXA 3NRYA 2XJTA 3KHCA 2UU8A 4X8NA 3J7MA 2JWPA 2CKLB 2YHJA 3KCYA 3USUA 4DV0T 4JI5T 3T2QA 1CUNA 2WS93 3ZJ2A 4AFMA 5AQPB 2CDOA 1HRI3 5BYNA 1IKQA 1RINA 2MAWA 1D2QA 2DI4A 1MS5A 3UU5A 3T0AA 4XFAA 4D7YA 3VZNA 2WA3A 1OUSA 4LKAA 4PK5A 1POQA 1F8VA 3DUIA 2EXIA 3OTFA 3E22E 4AKGA 4AI9A 3OJAA 4GJYA 3NNJA 4FPYA 3ASLA 4TX5A 4HFSA 1Q5OA 5FZHA 4XJ9A 2ZX1A 1OKQA 3BVCA 3I2DA 4ISTA 3I3QA 4YG0A 3TLUA 4IEQA 3H9AA 4QPGA 5FOJB 4IT4A 5LA2A 2X0HA 1UX5A 4XF1A 2VM9A 4BA6A 2BG9C 3POGA 5FWJA 3FZHB 5G05L 4Q1PA 1SCSA 1LVKA 2V5DA 3VDDC 4O4HE 1S0DA 3K3OA 3IA3A 4GOUA 1W6PA 1WW7A 4HKLA 4MYEA 4A2UA 3E1F1 2KE1A 4ZI3D 1W6MB 1K3IA 4AEDC 4YJ2E 4HN0A 3SEEA 1RVF2 2WJSA 5GALA 3ZO0B 1JS9A 3H0OA 3RNSA 4DVDA 4I01A 2NN8A 1CX1A 3ZXKA 2DYCA 4X1IE 1VB2A 5FMNA 4IV3C 4QXBB 2Y43A 5TSWA 2BQPA 2XQ5A 1CZSA 1UUSA 5L19A 1ND2A 1AR91 5FZFA 4Z8XA 4KUMB 4Y24A 3LQCA 4AYUA 4BB3A 5IVYA 5KXCA 5GLWA 2ZHNA 2YG0A 4N9IA 3B7MA 3U75A 1ZP0A 3BU0A 2JMJA 4AHYA 4AVVA 1XC6A 5AVPA 2JQQA 1WR0A 3F95A 2WNEA 3K75B 5LJMA 4QB2A 4RQPA 5FLJA 3POFA 1AR63 5A3NA 1YQ2A 1QY4A 4ISRA 1MZ5A 5A33A 1VPHA 2R041 4QF2A 1BK1A 4HBNA 3ABVA 1AUYA 1FATA 1REFA 4IEOA 1VBC1 3JADA 4XAXB 2GC1A 1ZRIA 1HJGA 4A0CD 1MS9A 2X5IC 2DJAA 1YXWA 3ZT6A 1SLIA 3UK9A 2VPEA 3N9LA 3ASIA 5C4WB 3PHDA 1YJLA 3FFZA 4IEWA 2CAVA 1LOFC 1NCQB 2JRJA 3L8RA 1V6NA 3MIDA 1HRV1 4JI4T 1S0CA 4OYKA 4MFRA 2V6YA 5AQKB 2Q8OA 3E6DA 4U2ZA 3GBGA 2LGKA 5I0TA 5BNPC 2ZAAA 1VR3A 4W65A 4LITA 5CFDC 3ZIWA 3RS6A 4DINB 4JCKA 3SITA 2B8MA 5EPAA 1LDJB 3VBOC 4XUOA 2QQNA 4SBVA 2Q1ZB 1QUUA 2RPAA 3OGSA 1W8NA 3VKFC 4O62A 4AQGA 4AFDA 4AQFC 4MV2A 3I3MA 2D43A 2W1SA 3VBUC 1JBCA 2GH8A 5AVAA 4RYDA 1XXNA 2Y6KA 3AEGA 2GMEA 3AMNA 2CGPA 2K48A 3ZR5A 2VL0A 5FOBB 4LKSA 4FPGA 3LD8A 4IGPA 2YQLA 2I59A 5C7GA 4Y33A 5L7OA 2Y6LA 5SVIA 5SV5A 5C4WC 2QZ3A 2RM22 5FZKA 5F2WA 3WI3A 1WGPA 4B3NA 4XIOA 4X8PA 3K51A 4LK6A 3RHWA 1UURA 5JPNB 2W66A 2HWB1 2JE8A 3BUCA 1NA1B 3FZKB 2PG8A 4XE9A 4DUWA 4P9YA 3RPUA 2V1DB 3LAGA 2H88A 2V4VA 4BA9A 1UIJA 2A71A 3BIWE 4CI2B 1MR5A 2FDIA 4QXHB 2WT0A 3RPGC 2W0GA 3MI8A 3FM8C 2WM9A 1CESA 2OLTA 3SOXA 4WZFA 3CWZB 5AC93 1TNFA 1LHNA 4XFBA 1UYPA 1H6YA 4ZPIA 4C8DA 2HWB2 4F83A 1IJ5A 2D7FA 5T55A 5IVJA 2ADDA 3KF3A 2RMU3 4BISA 1PMJX 1ULOA 3ZMSB 3TLTA 2R49A 3U14A 5D1LB 4WNKA 4XACA 1OQEA 1QJFA 1VAKA 1MM3A 2ECTA 2W3JA 4NUUA 5D2AA 2TNFA 4E8DA 5AQRB 1QSDA 5CJ5A 4MSXA 1UXZA 3WUCA 3MDPA 1W6OB 1DQ4A 1TME3 1VRBA 1E5HA 3K46A 2GU9A 1NT0A 3H8RA 1Q8VA 2UUBT 1MM2A 4X64T 3ZKRA 4JV4A 3PUVF 2J4GA 4NROA 2QQWA 5H1VA 3RWKX 1IBMT 1LGCA 1G8XA 2UUCT 1F4AA 3H7YA 2G45A 2WO1A 1XNRT 3U4SA 1DVPA 4HK8A 4LE3A 4DXTA 1YI9A 1H6XA 3RX6A 5C2TA 2QQUA 1NZCA 3A22A 1UKGA 5LASA 3H3LA 4XHBA 1S2BA 4IEUA 4H9RC 2D98A 4GALA 4Q0SA 1LHUA 4A6OA 1JYTA 3VD7A 5LW9A 4COWA 3JD72 5AQUB 1WEEA 3VZMA 4A49A 2MEV3 3Q5XA 4RQPB 1AJOA 4IV3A 1DCQA 3AE4A 4PIZA 1O5LA 3Q8BA 2GNDA 2P34A 4DFSA 2EGMA 4NAMA 3R84B 4PQ9A 2A72A 3TWIA 2DWGA 4H63V 2Y64A 4AI2A 5ADXL 4LBQB 1PM4A 2WSSV 4AHXA 2LUWA 3VBUB 2PBIA 2R6GF 3M8LA 1HF8A 1Z7S2 3MHHA 4Y20B 1RC6A 3WP6A 2VECA 4WVZA 2DU0A 3DTOA 5C4WA 1TMF2 2BRTA 1VBB1 5HWYA 3HNYM 4IL4A 3POEA 3PDQA 3AAEB 1FOD2 1OQ1A 2LTNA 3ZXEA 1HRV2 1VOMA 1QJU1 5FRAA 1UCXA 1W8TA 2OXQC 4Z82A 4M4RA 4QKDA 5G04B 5E8AA 3NVOA 3PHMA 4EAHA 2CV6A 3LF7A 3ZFGC 1BEV1 2OA2A 3EQEA 4B1MA 1WEWA 2IVJA 4XFGA 3SFDA 2VCCA 1OWAA 2IC1A 5C3PA 2P3YA 3AP4A 1AR93 3OYZA 4BDVB 2VKHA 4PLOA 4NAOA 5JVVA 4Q26A 4OLLA 3ONXA 1J1TA 4JBWF 2E31A 4Y4RA 5FZ4A 1GICA 1PX4A 2NLRA 1KXGA 3QK6A 5T5PA 3T08A 5FXWA 2W39A 4B3ST 2VVSA 3PJYA 4TWFA 1V9DA 2P3IA 1ZBE2 1OBNA 2YQMA 3PUGA 4BHPA 1GZ9A 3K1SA 2WR9A 4M3CA 2OYZA 3EJKA 1YRZA 3O1UA 4IDQA 4QKNA 5HXSA 5DAXA 4AI3A 3SCFA 2XDVA 1GSLA 2Q1FA 1ULCA 4NIDA 1XBFA 3ILFA 5J3UA 4UW5A 2VB6A 4CP1A 5AQMB 4PHZA 1DIWA 5FP3A 3WP3A 3FUQA 3LSEA 1YD8G 4AVAA 2H7OA 1PVC1 4MBQA 2L5UA 3I2OA 2JDHA 2Z42A 5AQFB 3S6PA 4QH5A 5LGUB 1IHMA 1U5ZA 4YPJA 3W9AA 3KT4A 5IUXA 4BQXA 1N3OA 3VBOA 4MSVA 5L36A 3MUZ1 2QYWA 2RSDA 4U3CA 4A41A 2HHHT 4B1LA 1XNBA 3J7Yq 2ZAHA 4LFBT 1NLRA 2IW5B 1JYCA 2VTXA 5JMCA 2CBIA 2OT7A 4QQLA 4AEDA 2WZR2 3BK9A 2XJRA 3GCXA 4WVMB 5LBMA 3GHMA 3P50A 3THPA 2Y6HA 2Z5WA 2XR4A 5IK4A 2JMDA 1H1AA 2Y38A 5JDFA 3TN92 3LA3A 4AVXA 4I30A 1C3HA 2PELA 1XMOT 1WA4A 1L7LA 3KT7A 4B4RA 4YBMA 2V09A 2A6VA 3WF2A 2KMFA 5JZGA 2GNMA 4AVCA 4JEHB 1D7PM 2UY9A 1CGPA 1MMDA 3HPNA 4EN7B 5C9AA 4R4XA 3H1WA 3DQVR 2IWGB 5DAQA 4LO5B 1UZ0A 2VGDA 4NIAA 2ZKNA 4AQ2A 2BS4A 3H1MA 1HN0A 4UI9B 5K9YA 1RJ7A 1IS4A 1UY0A 3HL6A 5FZ7A 2I45A 5I0UA 3T0DA 3K2OA 4ZI2D 1WKYA 1FV3A 4M01A 3T1LA 1RUE2 3UFGA 3AMQA 4GWIA 2LRPA 1DU2A 1AR82 4QX2A 1OH3A 4XZUG 4AI6A 4AFAA 4E2QA 2XXZA 1CVNA 4URTA 4CDUC 1O3SA 2CKLA 1X4JA 4QHBA 4TYSA 2VZOA 4I43B 1DQ2A 4FI9A 3ZXLA 2YVRA 1EUTA 2YUCA 4XBQA 1DLCA 3NO8A 4CDXB 1UNBA 2VNGA 3VBFB 3ZSLA 4XQDA 2JDAA 2JKBA 3OD4A 4YW4A 3QOFA 4C90A 4K3UA 2DVGA 2UY8A 2BVLA 3LK3B 3LE0A 2EHOC 1S35A 4B86C 2HWF2 1NUKA 1MS8A 4CCEA 3OVUA 3AE2A 3HR0A 2VURA 2WS92 4EYYR 2VBBA 4MGIE 4ONUA 3U5OA 5IK8A 1ZA7A 2FJDA 1LR5A 5IVBA 2VJFB 1K42A 3OBTA 3VHLA 2R063 1OEDC 4BXFA 1JW6A 4YSZA 5LA0A 3SMHA 1RTVA 1BJQA 1Y64B 1SHZC 4IDPA 4ZHNA 1W6PB 5JR9B 5LHHB 4YXDA 1FMD2 1CAUB 2B46X 4Q4W1 2GDFA 1LU1A 1AX2A 3JCFA 4HFBA 3GMIA 5FJKA 1PGSA 4UFLA 2ECGA 5A6XA 2Q4SA 4WM7A 1OLRA 4RGAA 4TZ4C 2C2VS 3LEGA 4JI3T 1G7YA 4ET7A 3RDIA 5LGTB 4PF5A 5FQ0A 3LEIA 1C28A 1H30A 3W21A 2JG8C 5JREA 3NV1A 1HYIA 4BXSV 3M3CA 4ZHQE 1NZIA 4XJ8A 2WN3A 2J22A 5C70A 2D6LX 4XFHA 3GZEA 4AVTA 2HWC3 1MZFA 1W6QA 4AGVA 2IZWA 2WDRA 5CISA 5HEJA 1S0IA 4Q0UA 2KFTA 1VRH2 1KJRA 1UK5A 4EYUA 5EJ1B 3LQHA 1ULFA 3ZN0B 3Q5DA 1RGSA 1EY2A 3LQIA 3AKSA 4YVWC 1I6XA 2RMU1 5F6KA 4FTBA 4SLIA 2ZBJA 3BPZA 1NY72 2G9FA 3M3ZB 2IXCA 1Q8SA 2Y1NA 1DDLA 4QPIC 2C9KA 4QD2A 1NE4A 3OY8B 3P8CD 2FDHA 1CWPA 2ECIA 4BU2A 5ABFA 4U36A 1UCUA 3FWEA 3M99A 1EAH3 3FZFB 1RUI3 2R32A 5DMYA 3ZXDA 4KU8A 4OQ8A 1IG0A 3WR0A 4NR1A 2YC0A 3DYOA 2FDJA 4FAHA 1JZ7A 1Q8QA 1IS6A 1HJFA 1WW5A 1AZDA 3IDCB 4X1YE 5LGNB 4KWKA 2Y0IA 4BK4A 2RMU2 5CNAA 3E08A 1KFYA 1F4HA 3PVNA 1JU3A 3CQCB 4CXYA 1KQRA 5FZCA 5AQQB 4QQHA 2VOWA 4R9BA 5J0ZA 3VDCA 2JDYA 4ZQLA 5BNNA 3AB3B 1W6NB 4EV0A 2WZHA 2BAYA 1LGNA 2ZXQA 4Y1VA 4YVWA 4FPFA 3USSA 1SCRA 3T2OA 4BK5A 2DLRA 5E88A 4HN9A 2NTYA 1PIV1 4IE7A 2X29A 3Q8EA 3WHUA 1RUC3 3CIHA 3SCHA 4PAGA 5TRBA 4AWDA 1Q8OA 2XB1A 2VOXA 1OPOA 2R0HA 4IQPA 3TN91 3WSOA 2W4XA 3BYWA 5C9AB 3IMNA 4KQ7A 4EV6A 3C50A 2Y8DA 1BBT2 5FYSA 3ELNA 4XJZA 4Y26A 3AVSA 3SHBA 3NZQA 4DR5T 2YPDA 2P57A 2LGGA 5ACA1 2LDRA 3PIJA 1MVEA 4MOAA 4BIFA 5FKCA 3NW4A 4RS5A 2DV9A 3N35A 4P9GA 1W2TA 4E4SA 1PGL1 1PNGA 3RRDA 3FB2A 1CX4A 1QXRA 2NW9A 1VALA 1U5IA 4OGEA 2QNKA 5K8SA 4CPBA 4E2SA 2Y60A 1OT5A 3HNMA 1IQAA 2DTWA 4MGSA 4GB31 5TAOA 2XQ7A 2WABA 4P9WA 2Z2SB 3E5UA 3ZSJA 5A1FA 3SOWA 4H14A 2YC4A 2OPWA 3RYIE 4RS5C 1TQ5A 3LCPA 5JSPA 3KCXA 4N8MA 4N53A 1J1JA 1KRIA 4H7LA 5FO9B 2XG3A 3ESLA 3AE1A 4BYYA 2WCAA 3ZFGB 4HSJA 2XOCA 2QUOA 3QZVA 2WNUA 5KXJA 1VRH3 4PQQA 1JOJA 2VJFA 1W3XA 2ZGQA 5JR9C 3A0KA 1Q56A 2WS91 5JDGA 1POV1 3MHSA 5BNOC 2MIQA 2DUQA 3AE8A 4LK9A 1ODMA 5LZ6A 1R093 4F52B 2Q5TA 3DGTA 1K45A 1SBEA 1TVGA 2IVIB 4JI6T 2WB5A 2UWAA 2KWOA 4B3MT 2RA1A 4ILAA 4LUKA 4CDQA 3PLQA 3EMRA 3FAOA 5FTTC 3U11A 4WM7B 1MIWA 2MA6A 1BEV3 3CVRA 3OGVA 1PVXA 1UOBA 4DY5A 1GR3A 1ENQA 4TWHA 3PJQA 4W50A 4WZ3B 5GLTA 4Q4V3 2IFWA 4JZRA 3RZLA 1NCRC 1LU2A 3I49A 2YBPA 4YWAA 5JXGA 3U5MA 2L75A 3RIUC 2YC2A 3ZMTB 4OMCA 1QWRA 1XU1A 2DVBA 5FDBA 4ZONA 1S94A 2WQ4A 4JGYA 4UVAB 4P00B 5EXOA 5CBLA 4GQ7A 3KB5A 5FZ8A 5JSRA 2X10A 5EHDA 4U7IA 4XVHA 1A8DA 2MOZA 3ZMNA 3RYKA 3K3NA 2CRWA 5FVKA 4YVSB 3D4KA 3SH5A 1O5UA 1VE0A 3KINB 1ULDA 5A32B 2BTVC 3GHNA 3H3UA 1NWMX 3T2PA 3A7QA 1RUJ3 4COZA 3OJBA 2F17A 1L0VA 3B00A 2Y48B 1GZWA 4IV1C 4DIDB 2WU2A 5C8CC 5FPZA 3O36A 5HXMA 3O1VA 1DZQA 2M67A 4AQYT 5BR8T 1LGBA 2MT5A 4WZ0A 2LXHC 4R9AA 4ANJA 4G63A 5FYTA 2VPGA 1RUC2 4B7EA 4K6BA 2QJ0A 1XNQT 2BNNA 5FBZA 2CT2A 4CI3B 3GL6A 4JKMA 2W63A 5B79A 3FANA 1CJPA 1U12A 2D40A 1GNZA 2WMOA 3J8F3 5DN2A 3VL8A 1H4HA 1DGLA 2HWD2 3MYXA 5HXHA 4K9SA 4QM9A 4DXRA 1LHOA 4H2AA 4QPIB 1R8IA 4FFIA 2ARBA 1Y9GA 4N43B 5EK4A 4ASMB 1VBE1 1UU6A 3ALQA 4HTEA 4LMKA 1PX3A 4BE3A 3TEYA 1BQPA 1R1A3 2P1BA 4WYVA 3V0BA 5F8PA 3BTZA 4XI1A 4QPGC 5F3GA 4YC9A 4D3WA 2OA5A 3NMBA 1S0FA 4JKLA 5JH7E 4I02A 4P9IA 4MXWB 2PYTA 2YU4A 1ASJ2 5FJHA 1V6LA 5I0RA 2RI7A 5L9BA 1QMJA 1E7PA 4HVRA 3ILNA 3FBYA 1KS4A 3T7LA 1LENA 1AL23 2PLV1 3KD4A 1FPN2 2J1UA 4YFWA 3FZ3A 3P3NA 3VKHA 1VAVA 2HEVF 4JTNA 5CVRA 2Q9QC 2FDGA 3VBHA 1JOCA 5D1KB 2K16A 3EO6A 2R7EB 3D82A 4UW6A 4P5YA 2AREA 2CEAA 3KDSE 2JEMA 3POJA 2ID4A 2A1XA 3FBZA 1BR0A 4META 4PK4A 4QX8A 2E26A 1VBC2 1UU5A 2D3RA 3BTAA 2MBGA 5D1IA 1DCSA 4YW7A 2CAUA 3ZFEA 3LWCA 4GULA 2AE9A 4XURA 1CZVA 5F9TA 3VBOB 1F2NA 4DV7T 2EXUA 1VYXA 5FZ6A 2F6BA 4XW3A 3WD5A 4H7MA 2J7MA 4J2CA 5LWBA 2VP7A 4HZFA 1AR61 3HR9A 3DYPA 4A44A 2E9QA 3NJXA 5B4XA 4ORFA 4AL9A 3I4IA 3L2YA 2EXHA 2XM2A 1BMV1 3WF3A 3B5MA 3NJZA 1QGLA 5CGMA 2W68A 4CN4A 2NYYA 1K12A 4N9HA 3O1IA 1C8NA 4QX1A 4ATEA 2FD4A 1XYOA 2CWMA 2RR11 3NAPB 3KLSA 4HFVA 2N1GA 2QDNA 3VHOA 2M85A 1QOOA 1GYKA 2VMFA 4PDWC 1W8WA 3OB8A 4FPJA 1O3TA 2AUYA 1E5SA 2AENA 3WOGA 3RGBA 4DV6T 2EGPA 3CKHA 4NHMA 4XFCA 4HSLA 4LMLA 4L99A 3BGAA 4HPKA 3PVBB 4JTOA 3ZPOA 1RUOA 2KXPB 4Z0RA 4JGZB 2WS3A 1KFXL 5J3XA 4LXLA 3QH7A 2D6KA 4QGLA 4ILCA 1ULPA 3QLQA 5HXVA 2WSUA 4G3YC 5JAXA 2WKKA 4FP3A 4EN0A 2XOYA 1LRZA 2E7TA 1OXZA 2YT5A 1FOD3 2ZGMA 5FKBA 1E1HB 4PLMA 2QJVA 4KWLA 2KINB 2LRLA 5BNOB 4IE0A 4ILUA 1UY2A 1LOAA 5M4YA 5C3QA 2HH9A 3DPRA 3MLKA 4I0AA 5EIYB 3V5UA 4YLZA 1FYUA 5FZLA 4QXHA 4OYUA 3OPZA 5FB1A 3FUOA 4A7YA 4LNVA 2J1EA 3MLJA 4AYCB 4LF5T 4KMCA 1ZV4X 3NWKA 4CUBA 3IAPA 1VBC3 1VMHA 3WNXA 4UBHA 2FUPA 3V5SA 2B45X 2Q30A 3D8CA 2ZM2A 1UN1A 2VOTA 4NRQA 2WWUA 3LPGA 3WDYA 4PT6A 2VZSA 2RJ2A 4LA3A 1FMWA 3LJUX 3M3OA 4M3CE 1EZ3A 3WV6A 2LM2A 2FZ1A 2WT1A 3M63A 4EWEA 3KZ4C 1SDWA 2BFUL 4I7BA 4CCCA 4IUGA 2OZJA 3RWNA 4UEMA 1QJY1 2CONA 2K46A 3VBSC 2YGMA 3VDBA 1HDKA 4LFCT 4DNYA 1GFF2 1W3VA 4OULA 3NKTA 3AE9A 4HKWA 3MV11 4MHRA 2KWJA 1VBD1 2XAFB 4OYJA 5ISLA 4QQPA 4KWJA 5FIXA 4Y3OA 3LKJA 4AVSA 1YQ6A 4FFHA 3C64A 1ZZBA 3ATGA 5LG4A 2K5BB 3IIAA 1DYOA 1LCLA 1C5HA 1QHDA 3I2IA 4HVOA 3OYXA 3ZC1A 3P4WA 4Q25A 2P2KA 4GMP1 3J7LA 5FLIA 3E2DA 2Y6JA 3N2GE 3FMGA 2VVEA 2GAUA 2E33A 3EI0A 1LULA 4RGGA 5JIAA 4D94A 3A0NA 1HR0T 1PO12 2E51A 3VBSB 2G0UA 4E7SA 2WWJA 5FPBA 2R6QA 1W9TA 2WZ8A 1JZ3A 2CDPA 5KHGA 4IEYA 3IM0A 3P7IA 3VHPA 1RUI1 3VDDB 3WDVA 4LULA 1V0AA 3JD71 3UU6A 2D3SA 4ISQA 2Z6EA 2KSRA 4QXCB 2E9XD 4COFA 1AX1A 3RQ0A 5A3LA 1S1AA 4H9SE 2YHNA 3PU8A 2JM3A 2H7VC 3ORJA 2K2SA 1VBB3 1MS3A 4CPBD 3N9MA 2G6QA 1CAXB 4KI5M 5HEUA 2ZHLA 3IN9A 5JR7B 1PMHX 2ARAA 4IE5A 4L9BA 4AGRA 4Y5TA 3KFWX 2OPKA 3MJXA 3UTKA 1GU3A 5CIRA 5DQWA 4Z2AA 4U33A 2XUEA 3KV4A 2DUOA 4UFJA 1RMDA 1V6KA 5FUNA 2A2FX 3JCIA 1TMF1 1VBB2 5C6CA 4XCAA 5BNPA 5LA1A 4CP2A 3AXEA 1B09A 5ANQA 2D6NA 3S30A 4YHHT 3VKMA 4PFPA 2P37A 2WC2A 4TXWA 1A34A 2A3WA 3AA6B 4A3ZA 2A3YA 3RG0A 2RDNA 3B93A 3K8PC 4DBRA 4OI4A 4YNIA 1G8WA 1RUD1 2JQHA 4CU7A 4FPOB 5F32A 5HWXA 5FUPA 5B75A 1AXKA 5A3UA 4JGYC 1FP0A 1NXD1 2WQ8A 4CP9A 1FEWA 3UT0A 4BQ4A 3FBLA 1RUG2 2P3JA 3JUUA 5FMDA 1J83A 1IBKT 2JICA 3EAMA 5E89A 2KWNA 4HE8A 4BJMA 3T2TA 3KF5A 3AL5A 3KVBA 4TWDA 5FAXA 2ZEYA 5DXDA 2V7LA 2FMYA 2AXDS 3DYMA 2XSAA 1QNWA 2J1AA 3AP9A 1VBA1 4Q8LA 4KG8A 4EWDA 2C0ZA 5A1AA 3DJBA 5H6QB 2VO5A 3DCQA 4GNDA 1Y4WA 2VBDA 1TME2 1RIRA 5KC6A 1T2XA 5J36A 4O4IE 3RI8A 1R083 2VR4A 2CSYA 2BZDA 2YSJA 2CHNA 3Q2MA 2JDZA 2DL1A 2J1SA 2CTVA 4NIHA 2XAHB 2WDVA 4GNEA 1ENRA 3D3AA 3GA8A 1T72A 4S2FA 3ZYRA 3CIRA 1ZYBA 1HS7A 3CJIC 4NXMT 1DGRN 2ECVA 3AKRA 3J26N 1UD1A 3HKDE 3H7JA 2EHOD 4I55E 1UMIA 3LSDA 3U78A 4FBFA 4QF3A 2LROA 3VKLA 1MZ6A 4GB0A 3VKNA 4PF1A 2IUWA 2VZRA 2BW8A 5FZEA 3GZAA 5GZGA 2H3RA 1V87A 1O59A 2JE7A 3X29B 3WUDA 3ECQA 3OUHA 2V7MA 4QU2A 4LMJA 1W8FA 4DUZT 2XKPA 4XDPA 4XCBA 1JZ8A 1ACCA 4DR7T 5FYVA 5IK5A 3C7FA 4AI1A 1D4M2 2JG9A 3BIEA 3VBFC 5JSOA 2XJVA 3KM5A 3O1JA 1RMU1 1DGRA 1MQTB 3O0WA 5DG1A 3J8F1 5DZGA 2W47A 2Z79A 3NKGA 3FFQA 3NVCA 4W4UA 2UWBA 3CX6B 4Y1ZA 2CWOA 1UL9A 1UQXA 5L7OC 4K8RB 4JLEA 3LFIA 1ZBA1 3LFMA 1R64A 5JUVA 4Q4X1 4DR2T 3O1RA 5CAZA 4WZCA 2QQIA 4RHV3 3NV3A 3KMHA 3ON7A 4FIPA 1U5XA 5EYXA 3FE5A 5LMUT 1VJ2A 4B3TT 1AYM1 4UIGA 5SVYA 3ZYPA 4ZXKA 5J2UE 3O9XA 1MEC2 1EPWA 2BGCA 3CO2A 1LDKC 2W95A 1YC61 3AEDA 5FZIA 5F2SA 3R4DB 4Q4X2 5JQGE 3B69A 4JX0A 5T5JA 4IE6A 4GNFA 5HV0A 1GP6A 2DX8A 4XBFB 1HNXT 3ZDSA 2FUIA 1QJZA 2WT2A 5J2TE 5JDLA 1YQ3A 3R6NA 3A21A 4QPIA 3AYEA 3RH3A 2IFRA 2NQYA 1QEXA 3ZX7A 1XNAA 3LQJA 2B9VA 1UF2C 2WZIA 1W2OA 2NPIA 2XP0A 3WHTA 2YREA 4O2BE 4DS0A 2PQSA 2CHOA 2FDKA 3FLRA 3QBQA 3LDKA 4AEKA 2B42B 3LVQE 4LA2A 4XAEA 4GD4A 3V64A 3TLVA 5FP7A 1Y7BA 4WA6A 1CPNA 1DLLA 1VBD3 4KI0F 3ONJA 4LE4A 2XQ9A 1FMD3 2OZ6A 2MHFA 4YY3T 1MMAA 2BEOA 5M0TA 2KWKA 4RL7A 5L3FB 4Z1VA 3T4VA 3MPBA 5I8YA 4YW6A 3UYJA 5FPUA 2ZJCA 3RGLA 4UP0A 1HX1B 2EICA 4J1WA 1Z0HA 3LG7A 2QVAA 2JD4A 3ZKYA 1Z2QA 3FBMA 5GLVA 2QQKA 1T6BX 1I3HA 3LA7A 3FHAA 4I7DA 3VLBB 1Z6UA 1YLLA 5FREA 5FZOB 1LEDA 1N34T 3UESA 3WNKA 2VMGA 2RS11 1JTZX 2ES0A 3RMXA 3PIGA 3HQRA 2W46A 4YHJA 2BG9B 3VKOA 3FHNA 4YSFA 4AFCA 1QJY3 4K7JA 2E61A 2YKSA 4FVVA 3ZOIA 4A45A 3ACIA 2YFZA 2W61A 5KHJA 2CXDA 2W91A 1AR83 1IYMA 4HWFA 3IT8A 2X9WA 3NAPA 2XHEB 4TLFA 3INAA 4M4PA 4R9CA 4UFIA 4AZZA 3ME2A 1XSRA 2CSGA 2Q0AA 1JYIA 4CDUB 5K7PA 5AQJB 5HCMA 4K0KT 4ARXA 1DQ1A 5ACA3 5L9RA 3OPTA 1S0EA 1H8TA 2H0DA 2ZX3A 1QQP2 2XOMA 2HYXA 3A23A 1O91A 2D93A 3VD4A 1ZA4A 2H0VA 4XJWA 3BKZA 2ZHKA 1US2A 3HIFA 1CR7A 2AH2A 3VL9A 1F9KA 2BJSA 4OVEA 5F3IA 3GZUC 4F7ZA 1IPKA 3AE3A 4N3WA 4LK7A 1HQWA 3H3MA 2E9XB 1H4GA 1OKOA 2XJQA 2ZKLA 1FPN3 1K2FA 4GNGA 2JG9B 1PO21 2KGGA 5BNOA 1J84A 4K8FA 2KYUA 1ZZ8A 4ZI7E 5H1TA 3ZXGA 4ZZCA 1Y9MA 1W39A 4MH0E 3ZSEA 2PHTA 3GN5B 2M6IA 3KQRA 3SCGA 4ZXEA 1FJGT 3ZSTA 2ZGUA 2W08A 4AYCA 1GLHA 2WFF2 1HIXA 1GOHA 3AP5A 2AEZA 1W9FA 1XNCA 1D1CA 5IVVA 2LE8A 3ZFGA 5L3EB 2JECA 5JDBA 4UW3A 3P5BA 1WEOA 5FZDA 5GZCA 2YMZA 2WNOA 1VCSA 1AX0A 4FQ4A 4AQTA 4JDOA 2PUYA 4XFFA 4AEMA 4X62T 1W90A 3WG2A 2VH9A 4QB1A 3FZMB 1SA0E 1JM7B 4RR3B 1Y01A 2H6BA 2XQ3A 2WBKA 3M3IA 2BKPA 4ZS2A 3MK7C 3RI9A 1WENA 3I7DA 4E8CA 5ABJB 1W0NA 5FYHA 2PAKA 4EIWA 3TBDA 3ZPVE 3ZVXA 3P4RA 1OMIA 4CN1A 5LBBA 3SH3A 3SXWA 2A7AA 3U1XA 2VZVA 3ANWA 2BOIA 4QDQA 3LPFA 3SOLA 3FZLB 3N7MA 2EVXA 3ZT7A 1UIKA 4M0NA 3A7MA 3KGLA 5FV3A 2CWYA 4BQWA 3N5LA 1VBE3 1N36T 4UI9L 1ND3C 4CP0A 2IDAA 3C2UA 4Q6FA 1I5PA 3JXSA 5SVXA 3KDEC 2Z69A 4IEXA 1HRV3 4WM8A 3THCA 4PBPA 4F8AA 3NV2A 2VL8A 3VBSA 3MBWA 1ZX5A 4CEWC 5B77A 1IZ3A 2JQ9A 1C57A 2LLYA 4YFSA 2UYBA 5H9MA 3ACHA 1G25A 3TKLB 1FI2A 1DFQA 4L2NA 4QKBA 3BALA 5AQLB 5FCCA 2DSMA 4IIJE 3AA1B 1E5IA 3BODA 3ZFFB 3N9NA 3KVAA 4AK3A 3CJIB 4AISA 1LHVA 1Y43B 4P5OB 2BG9E 2VVFA 1BR1A 4JHTA 1EPZA 1HV0A 3AMPA 4DEQA 4C1WA 3U07A 2A5ZA 1A78A 2CWSA 2JE9A 4IERA 4N4FA 3U3IA 4YBSA 3OTOT 4Q2FA 3NBXX 3JD73 4FAGA 1U5PA 5HEHA 1R082 3KV6A 2RS52 5I93A 2PAEA 2IMLA 2YFUA 1S0JA 2F4VT 5LBQB 4OHYA 2ECWA 2LGLA 4ES9A 4EZ4A 2OUJA 5FO7B 4AVBA 2J1VA 1IGOA 1YW0A 2D8UA 1REEA 2D8SA 1NKGA 3O33A 2BNOA 3IWZA 2N9DA 1TE1B 2LSIA 4MHUA 5FYBA 4BBQA 4KBMB 4M3CF 1W99A 3AP6A 1YO8A 1VBA3 2E7AA 5A7PA 1W03A 2NW8A 2DVAA 3DECA 1UGOA 3BN6A 1W0PA 1PGW1 1W9SA 4XILA 2GP5A 4N78D 5K4LA 3LK2B 2GSYA 1TEIA 2O0OA 5L47A 5ABEA 2BKNA 1UPIA 2K9ZA 4UF0B