3PURA

Cekdm7a from c.elegans, complex with d-2-hg
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
515
structure length
483
Chain Sequence
PKESDRCGGCGKFTLMSKKKSHHHKKNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKCVPHTGHSIRYKVVAPHRYRWYSPNEKHLGIEVGSKTWIEDFITRENTVPSPTDDEVCIVEDGYEFRREFEKLGGADNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETSPDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEANQEGSDMREQEKNIWTASQIMKAEMERWMDRELRLGPEKNAILPTDDKNKIMISVRKQIEIQTKIQNAKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oncometabolite 2-hydroxyglutarate is a competitive inhibitor of alpha-ketoglutarate-dependent dioxygenases
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 7 homolog
total genus 148
structure length 483
sequence length 515
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3purA03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3purA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3purA01
5FZEA 1N87A 5FZDA 3ZVZB 3IHPA 5IVJA 3PUSA 4FO9A 4Q6FA 5A7QA 4ZDTA 1MM2A 2VJFB 3VK6A 3T7LA 1WESA 5G05B 4MSXA 5A7WA 3ZPOA 2M1RA 3OPWA 5FERA 2RSDA 2MA5A 4P5OB 2CT2A 2VJFA 2CSZA 3U78A 3GV4A 5ISLA 2XDVA 4LITA 5A7WB 2YURA 1WGMA 3UYJA 2VJEA 1Z6UA 2YBSA 2KREA 3O7AA 5FWEA 3RPGC 4XDOA 2FUIA 2JRJA 3ZLIA 1MM3A 5LKUA 4D6SA 5TABA 4BXFA 3ZYQA 2C2LA 5A7SA 1WEQA 2BAYA 4XDPA 2Q8EA 3LD8A 3U5OA 2FSAA 4W4UA 2OT7A 3ZTGA 5FUNA 2YT5A 5B78A 5FZ9A 4BU2A 4FIPA 4XI1A 2HYED 3ZVYA 4CCOA 2LXPC 2VPDA 2KE1A 2QICA 2PNXA 2EGPA 2YBPA 2ECNA 5LW9A 3L1XA 2VD7A 4X3GA 2VPBA 2F6JA 2KWOA 4UF0A 2YU2A 1LDKC 2H0DB 4CCMA 3N9QA 5FZLA 4AYCA 5H1VA 4AVXA 5FZMA 2M6MA 4UI9B 3KNVA 2NAAA 3PHDA 4GNDA 3EB6A 2M85A 5D1KB 4DO0A 4LIUA 2YQMA 4MVTA 4AYCB 3LQHA 4BISA 3GL6A 4CSWA 2WWJA 5CEHA 5ANQA 2MT5A 4ASKA 4R7EA 5FY8A 5F32A 4I7DA 5A7OA 4R2YA 1HYJA 5FYCA 2UZGA 5KH7A 4EYUA 5A3WA 3C5KA 3KQIA 4BBQA 5FZOB 5FXZA 4QF3A 4PPEA 4LKAA 5B8DA 3M99A 2CKLA 5FPBA 2GP3A 1CHCA 1HYIA 3O37A 5FUPA 1WEUA 5FJHA 4AUQB 2KIZA 5FZAA 3SOUA 2YUCA 4UP5A 4I7CA 1FBVA 1WE9A 3MHHA 5FPAA 4NN2A 2XEUA 5FPLA 5H1TA 5FPVA 1FP0A 3ZPVE 1XWHA 4B86C 5FWJA 5FV3A 2KYUA 5FB0A 2KWJA 3MHSA 5FZCA 1T1HA 5H9MA 4WA6A 4ZUXU 1G25A 5F3GA 4D6RA 5FZ1A 5B77A 5B75A 4AAPA 3U5NA 2Y1MA 5B79A 2OS2A 5FYTA 4S3OB 3LQJA 3KV9A 4QF2A 4V3KC 5JG6A 5FZ3A 2OQ6A 3PUQA 4A49A 1VYXA 3T6RA 5FZKA 2F42A 3DXTA 2KWKA 5B76A 2ECGA 2L43A 1VD4A 2LDRA 3LRQA 3U4SA 2KR4A 5LCWB 2YQLA 2K17A 4WZ0A 3V43A 4URAA 5FZ7A 1K2FA 5A7NA 4IC3A 5FZBA 3AVSA 4QXBA 4YBSA 4LADB 1IYMA 5F2SA 5FXVA 4AI9A 4B7YC 4YBMA 4NUBA 4A0CD 3O33A 5F5CA 3U5PA 4CCLA 4A4BA 5FZ4A 2Q8CA 1X4IA 4CCKA 3KV4A 5A3PA 5LWBA 3AVRA 2L80A 5IW0A 3N9OA 4D6QA 2KGGA 4QXCA 4LK9A 5FP8A 4CCJA 2JMDA 2MD7B 5FZHA 1WEVA 2M3HA 4IC2A 4CCGX 3RPGB 5FYBA 5A3NA 3N9NA 1BORA 2XXZA 1JOCA 4YC9A 5DINA 5FZ8A 4AP4A 2YREA 3C6WA 2FUUA 2VNFA 4C9ZA 1WEEA 5F3CA 2C2VS 3RVHA 4GNFA 4LIVA 5FYVA 5FY9A 1U6GB 5F3IA 4YATA 2Y43A 5F2WA 4IGOA 3AL5A 2XB1A 3K3NA 5LY2A 5E6HA 3M63A 2CSYA 3PU8A 2LQ6A 5FZFA 1JM7A 4DIQA 3QZVA 5FEYA 5C11A 5FB1A 5FY7A 2XUEA 5FYIA 4YBTA 2MA6A 5F5AA 4BHWA 5A3TA 2ECJA 4CA1A 1JM7B 4V2WA 3L11A 3DQVR 3SOWA 2K4DA 2VPGA 5A1LA 3FL2A 4N4FA 1WEWA 3HCSA 3LDBA 3PUAA 2Y1NA 4HOOA 5FXWA 2OQ7A 2IDAA 1F62A 3N9MA 3KV6A 2LV9A 5IVBA 3KVAA 2HDPA 3DXUA 2MD8C 2YU4A 4EZHA 2LGKA 2QJ0A 4ZQLA 3PTRB 5FY4A 5KH9A 2E6SA 2QIZA 4LLBA 2L0BA 5FZGA 5TBNA 2XMLA 2YPDA 5FXXA 2KU3A 5F5IA 4L7XA 5D1LB 5IVYA 2I50A 4GNGA 1DVPA 2AN6A 4A4CA 1VRBA 5F37A 5KR7A 5FJKA 2YSMA 4GNEA 4YADA 5G04B 2ECVA 5FZ6A 2L75A 2ECWA 4V2VA 5FY1A 5FP9A 4E4HA 4TN7A 4UP0A 2GP5A 2LRIC 4QXHA 1ZBDB 2OX0A 5C13A 4F52B 5AITA 5F39A 5FYHA 5IVVA 2YYRA 3HTKC 5IWFA 2LGVA 2LXHC 4LJNA 5FYZA 2MNYA 3NG2A 5J3XA 4TKPB 3N9LA 2JMIA 4GD4A 4FK5A 1WEOA 5LKTA 3EB5A 3LQIA 5G0FA 4Y4RA 4CUGA 5EYAF 5TRBA 2ECTA 4GJYA 4GJZA 3L1ZB 3OPTA 5DKAA 2PXJA 2PUYA 2K16A 5FPUA 4L58A 2MUMA 4GB0A 2E6RA 5LY1A 2L5UA 4PTBA 2VJEB 1WILA 1X4UA 4R8PK 2LGLA 1VFYA 5K4LA 5LKXA 4QU1A 5A1FA 4N3WA 4GAZA 1X4JA 2YHNA 2K1JA 2YHOA 2YU1A 1WFKA 4YABA 3U5MA 3HCUA 3O35A 2VPEA 3KV5A 2ZETC 2YSJA 4FJCA 1WEPA 2F6NA 5TDRA 2KWNA 5KH3A 2EODA 4Y3OA 5FY0A 3DPLR 1WEMA 5IVFA 4QX8A 5FZIA 1E4UA 2OXQC 5IVEA 2D8SA 2KGIA 5FP7A 3KVBA 2MNZA 5FYYA 4YAXA 5FP4A 3RTRB 3I2DA 2DX8A 4QX7A 3PU3A 4I7BA 2WWUA 2ECIA 5LKZA 4UF0B 5FYSA 4S3OC 2H0DA 4C8DA 5H1UA 3ZNIA 3O36A 3O70A 2EA6A 3HCTA 2KFTA 4Y33A 1V87A 3AL6A 5F3EA 5I3LA 1Z60A 3NJYA 4O64A 4V3LC 2P5BA 5TDWA 5FBJA 3ASLA 2LGGA 2LN0A 4WZ2A 5A7PA 5A80A 4EZ4A 3K3OA 2W2IA 2RI7A 4LXLA 3M62A 3ZPV1 2G6QA 5FYMA 4IGPA 2YBKA 3SHBA 3N9PA 3O34A 4QWNA 5FYUA 1WENA 5D1MB 5FZOA 2G45A 3SOXA 1RMDA 2CKLB 4IGQA 3PURA 4CCNA 5FZ0A 5FY5A 2JMJA 5FP3A 2MIQA 1Z2QA 3K2OA 4HONA 3PDQA 2Q8DA 5IVCA 1WIMA 4WZ3B 5AIUA 2G43A 2YW8A 2VP7A 1LDJB
chains in the Genus database with same CATH superfamily
1N87A 4FO9A 2WAAA 4GKKT 3PIGA 3WNXA 1IS5A 5KMGP 5ISLA 1OMIA 3IHRA 3SHRA 2DFCA 4XUNA 3W5MA 2PAMA 3KDSE 3BQKA 4EN0A 3UU3A 1ST8A 1RMU1 4ZXLA 2JDPA 5LKUA 2BS3A 4BXFA 1N32T 3AZVA 5JDQA 2VWAA 2OT7A 1D1CA 1RUJ3 4FIPA 4XI1A 2FD4A 2HWF1 4L0RA 3W58A 3DJBA 3VL9A 3I3BA 3P3NA 4HXCA 4PJYA 4X64T 4HN1A 4OFZA 4AAXA 2M6MA 2E63A 2WT1A 3O1HA 4CU8A 5C2TA 3N7LA 2JXAA 2ORXA 5DAVA 1IBKT 4Z90A 3DTOA 1VBC3 2G9FA 1DGRA 3PUVF 5FY8A 2B46X 5CIRA 5FYCA 5IWAT 5JOXA 4CEYC 4ARXA 1Q8SA 3WINE 4Q0PA 4DUYT 4LKAA 5CFDA 1UIKA 1IJ6A 4BMBA 1W3VA 3O1UA 1HYIA 4P14A 3MJXA 1ASJ2 4AKGA 5DAPA 1EUUA 1MZ6A 4I7CA 1D4M3 1SFNA 2QCSB 5LJNA 2VH9A 1N1TA 1UKRA 2XEUA 4LMKA 5FPLA 3ZMSB 1GP4A 4S2FA 2BKOA 4YG3A 5IATA 1RUG2 5ABJC 2YZ4A 2YC0A 3FLPA 1HXS2 2AUYA 4P9IA 5J7MA 2GU9A 1MR5A 3BPSA 1UOJA 1W8WA 3ILNA 1EYBA 2O0OA 1GNZA 5JG6A 4A49A 1AYN2 1JU4A 2YHJA 2EF6A 3LRQA 2K9ZA 3B57A 1IKPA 1ZREA 4Q8LA 4P9JA 3GWHA 2W68A 4YSFA 4QQPA 2D0TA 1ENXA 3ZYLA 3U5PA 1NCQC 2ZMKA 2PHXA 3ACHA 3SCHA 3IAQA 1RUI3 2VXJA 5IFPA 3P5BA 2XLGA 1Q43A 4BCUA 1DDLA 5HXHA 2Q9QD 5JSRA 2I07B 2WS93 2CTVA 2ZCWA 4CP0A 4HKOA 2LKGA 3ZN6B 1UCUA 3LSEA 4LO6B 3VHNA 3ZFFC 3O14A 3PTYA 2VAUA 1AYM3 3AL5A 4W4ZA 3ZXKA 2VCMA 4NE9A 4Y24A 1V9U1 1O59A 3Q2MA 1JM7A 1XU1A 4ISSA 3OGJA 4CA1A 4CUAA 2R16A 3SXWA 1T6GC 2KXLA 2HN2A 5A1LA 4FPJA 3DPRC 2A71A 2GMMA 4CDQA 2BBJA 2IQJA 5ERLA 4IV3A 1UKGA 2Y8KA 2SPCA 5CFBA 3P4RA 1GOHA 2YC2A 3OD0A 2FJBA 3VGIA 1R1ZA 1D0YA 2CYFA 3ZOIA 1CAVA 1QSDA 1YNAA 1QY4A 4ZI2D 2QQJA 1G86A 2R30A 1N34T 4JI3T 2AEZA 2Y6JA 1NY72 2XSAA 2ZPXA 4HBNA 4KWUA 2Y6KA 1DVPA 2AN6A 4A4CA 5G04B 3M70A 5DDJ3 4UIGA 2VPVA 4QMAA 2LRIC 1C57A 2DI4A 5HV4A 5C13A 1G9AA 3EB7A 1AR61 2XHKA 3RMXA 3ZSTA 1UYYA 1YQ5A 4TKPB 5AVPA 4CDXB 4HE8A 2M67A 1YWKA 2WO2A 1AR92 3RRDA 3WF0A 2WABA 4MALA 2VVSA 2JMHA 4A44A 5HCJA 4EJRA 4GQ7A 1AYN1 3OYXA 1SLBA 4EN6B 2K9AA 3SCFA 4X5TA 4UR9A 1NCRA 4FTSA 3UUBA 5IVFA 3ACGA 2A7AA 4DY5A 5JXHA 2CMRA 1KXGA 4XBNA 5JQGE 2V5DA 3IM0A 4DUZT 4LMFA 4UF0B 4BPZA 2LSYA 2QBXA 1GICA 2R1BA 3EDVA 1V87A 3AL6A 4Q29A 5I8YA 4V3LC 4XBQA 4ATEA 5EZYE 3CJIA 2LGGA 4OI1A 1HRV1 2BUKA 3D0JA 4XBFB 3VDBA 3ZFEC 3POIA 4ISTA 4F3JA 5FYUA 4HT1T 2F6BA 2E9XB 1QU0A 4ZU4A 2AGSA 2VM9A 4BIOA 4IGQA 2OVUA 1W2AX 1LGNA 2DU1A 3R84B 4DY3A 1RUE3 4PFOA 4YZ5A 3FAOA 5LP6E 4RQPB 1V6OA 1XNQT 1QQP2 2NW7A 4ORFA 1JZ4A 3I3DA 4JDMA 3MZHA 3IPVA 2ARBA 3ZYPA 2ZEWA 5L36A 4OGCA 1GWLA 5AQFB 1NA1C 2A1XA 4AVTA 5LBEA 4OQ9A 4AYUA 4QH5A 4EROA 4OQ8A 3AAEB 3CKHA 4P5HA 2YBSA 3KHBA 4J1XA 2R043 1HFAA 3IBPA 4NR1A 5JDFA 2ZABA 4NUVA 5FUNA 4AFCA 1CAWA 5AQQB 3VD7A 2NP0A 3VKFC 2ILMA 4U3CA 4YZ3A 4ANJA 1S2BA 2F6JA 2KWOA 1DQ2A 2H0DB 3K51A 4ZHQE 5FZLA 3F31A 2A2FX 1MS0A 5HXMA 1K3IA 1US2A 3UJQA 4LBOA 1E5SA 1QJX3 2A6YA 2H3RA 4DIDB 2RMU3 4R2YA 2Q1ZB 3ZFEA 4OUMA 4WM8C 2G9ZA 1GP6A 3HNBM 2W66A 1U5IA 3ZYHA 4P02B 1OEDA 2OPKA 1WEUA 1S4CA 3RDIA 1WR6A 1RUC3 2K5BB 4HVOA 2MKEA 1FBVA 2ZM0A 5D8AC 5FPVA 2V1DB 4JUYA 2KWJA 3UGGA 2XAFB 4IL7A 2VQUA 4QB2A 4E4ZA 3KM5A 4L9BA 4C90A 5B75A 1GUIA 2H7OA 3WP4A 1HN1A 2VNOA 1VYXA 4QM8A 4YVSB 3DKQA 4LUKA 2RJKA 1W9YA 2LRKA 2E31A 4H7LA 2D6OX 3HN3A 4HSLA 4MFRA 3LEMA 2JD4A 2JKBA 5LZ6A 4CN6A 3R4UA 1ZKEA 2B8MA 4AI8A 1XNAA 4LHSA 4LADB 1IYMA 2C4XA 4RQPC 2MHFA 1OFNA 4UW5A 3DP7A 4GB33 3ASIA 4S2DA 2V5YA 4FTEA 4OHXA 1NCRC 1LR5A 2IXCA 4TUYE 2DU0A 2KGGA 5JDBA 5M0TA 2ZGRA 2F4PA 1W09A 4PK5A 3SRZA 2VOWA 4YW2A 3U75A 3ZJ2A 5F3CA 2D93A 4XETA 2D3RA 2X9XA 4BK4A 4QKNA 4YY3T 2DCJA 2XQAA 3FLTA 3ZIWA 2HWF2 4JZRA 1F35A 3R05A 3FANA 5LCWL 5LB7B 1RUH1 3IAPA 2HYKA 4BH9A 3QNUA 3OEAA 2YDSA 4EE2A 1W6NA 3WZ1A 3FL7A 4Y1XA 4XUOA 1RHI1 3AFKA 4FSJA 2UXCT 4J2CA 2CE7A 2VZSA 3JD71 4H9QC 1LGBA 3P4WA 3RI8A 3BYWA 3MFAA 3KVAA 2WN3A 2YU4A 3SFEA 3G06A 2Y6HA 2CWOA 4I02A 4Q5OA 2VL8A 1S0EA 2I50A 2WL1A 4PBPA 1CR7A 3I2KA 2OPWA 4DXSA 3NNGA 2CV6A 4R8HA 2ECWA 1YHFA 2PHUA 4UP0A 1H0BA 2YYRA 3KGLA 2HPJA 4JI4T 3AE7A 4IE0A 2MNYA 4Q2FA 3RGLA 1FNZA 1R083 4CQIA 2JQKA 3ZYGA 4XZPA 5T3NA 1RUD2 2Q1MA 1XNDA 1WW5A 2ECTA 3B00A 3L1ZB 3O1RA 1WR0A 5I8SA 2PUYA 5FBZA 2BNOA 1XNTA 4GB0A 3USUA 2JDNA 1O3SA 3V5UA 3ZR6A 2EVXA 3ZYRA 1RUOA 3AYAA 2CONA 2BS4A 3FXEB 4KP3C 1BLZA 3M3EA 2VPEA 4LFBT 3OYWB 1JYTA 4X1YE 1Z8UA 2JJ6A 5IVEA 1US7B 5GJ6A 4AZZA 1YW0A 4N43A 2ZGLA 2CCQA 4B29A 3QOFA 1AJ3A 3WCSA 1HRI3 4LBNA 3ZMTB 2RM23 3T1LA 3WQ7A 4ET7A 2LKHA 2AE9A 3LA7A 2Y60A 1O8SA 3POGA 3TOJA 1WENA 5K0UB 4NUUA 1YQ3A 1LTEA 4KWKA 1V9U2 3RYCE 3WHTA 4HG6B 1OPMA 4A6OA 4HWIB 1UIJA 4OI2A 3PVEA 4WZ3B 4META 4XMAA 5A7QA 2AZ5A 4ZDTA 2E2AA 5L3DB 4CEYA 4BDVB 3VK6A 5A7WA 1OH4A 3CNAA 3RZZA 3D82A 3WF3A 5CFDC 1VBC1 3ST7A 4BHPA 2LSJA 1NT0A 3ABZA 2ZZQA 3NMBA 4AXOA 3N7JA 4OI0A 3HT1A 1LHUA 4H9OC 3J9SA 2KMFA 1NY71 1OOPC 4LFAT 1OVSA 4D6SA 3H7JA 3FE5A 3TNPB 4XDPA 2BOJA 1D0GA 3U5OA 1COV3 4ZI2C 2Y6LA 1S0CA 1BEV3 3VBOC 1WRDA 3WNPA 2RMU1 5BNPC 4Y5TA 5L3FB 2D6NA 1E7PA 4QHBA 3THDA 2WWSA 5K9YA 2QQMA 2PQQA 3MFCA 2CGPA 5F5WA 4CCMA 3N9QA 2B45X 1E5IA 4A56A 2YDRA 2ES0A 5LBCA 1DQ5A 3BU0A 3OKQA 1MQTC 5DQVA 3SEEA 5EK3A 4CUCA 2QTWB 4Q4W3 3KQIA 2ACXA 2QUOA 4XOGA 2BFUL 2XBO3 1M62A 2VZVA 4UBHA 3OBAA 2BBHA 4R9BA 3I0OA 2DBNA 5HV0A 4AFMA 4RS5B 1C3HA 5FKBA 5LK7B 3H3ZA 2Z42A 1ASJ1 2VY0A 3CKDA 2VB6A 2CGNA 3AEAA 2W67A 1V00A 5H9MA 3CMGA 4DPNA 2VW0A 4Q4V3 4AI2A 2XJUA 2LT3A 3SS1A 5HEUA 5FZ3A 3WOGA 4S2HA 3V0BA 3VKLA 3B01A 5C3PA 1C8M1 1V6MA 4BYYA 1T6BX 1WCRA 2FQPA 2D5FA 4YHJA 2GNBA 1S1AA 5FZBA 4LF7T 4M0NA 1ZZ6A 5ABEA 3QH7A 2P3JA 3VBUA 2ZHKA 3L2YA 2HWE1 5FZ4A 2Q8CA 4LEJA 4E8CA 3C7EA 1JNZA 5A3PA 2D5UA 1OOPA 3DEMA 4NVPA 4JVAA 1WD3A 2UY9A 2WZR2 3E6BA 2CRRA 1MEC1 4KQ7A 2ENRA 3FHQA 5LG4A 3C6WA 3RRWA 2BFUS 1X9PA 2J1EA 2HWD2 1D4M1 3IBMA 5CJ5A 3T0AA 5KC6A 3IA3A 5CA0E 3E6DA 2ZAAA 1S2KA 1J83A 2IVJA 1MVEA 5FQ0A 2GN3A 4UFIA 2WZEA 5FY7A 2BQPA 3FWEA 1MIYA 3W21A 2XQXA 3RZHA 3OJBA 1ND2B 3PUAA 1R1A2 3PLWA 3MIBA 1KS4A 4MGSA 4KWJA 1Z7S1 3D0TA 2V7MA 2XWJB 1B35B 3VKNA 4MZUA 1OKQA 1N1YA 2A6VA 5TBNA 5JUVA 2KU3A 4M00A 3ONXA 2IWGB 4JKMA 5KDMC 4BK5A 4EN8B 4XBLA 3IZOA 2E9XA 2PTFA 5FR3A 4BQYA 1UY4A 3SCGA 5ABHA 5EYXA 3LVRE 3UULA 3HTKC 5T5OA 2IZWA 1AXZA 4LBLA 2QE3A 2XZEA 3CPZA 5J3XA 5FMNA 5CYYA 5C5UA 2C5IT 2EIDA 1WEOA 2E33A 4I30A 1MS3A 3KINB 4YVSC 2WYSA 5EZWA 5B2GB 5JI7A 4DV7T 4CP1A 1X8EA 1X79A 1YXRA 4TTGA 2KWIB 4HLTA 3HD8B 3HKDE 3H3MA 4N3WA 2WRAA 4HANA 2CXFA 3KV5A 1A3KA 3JC6D 3OUIA 1VBE1 1UYXA 1X33A 2KWNA 5KHIA 3RZGA 1E5HA 4AW7A 3LIHA 4LLFA 2LTNA 3RIUC 2D8SA 1CAWB 4GYRA 2MNZA 4AI3A 4GMP1 4GH4A 2DCFA 4E4DX 2DX8A 1UMIA 4QX7A 3ZT5A 4Q4W1 5LKZA 5FYSA 1W8TA 5HCBA 3PJAJ 4MGIE 4OMCA 1CONA 2QVSB 1LVFA 2WZR1 2WFPA 5JLVA 5IUQA 3QCWA 5A7PA 4WV8A 1RUD3 2KKYA 4ZEYA 5BR8T 3N9PA 4ISRA 4LORA 2KSRA 3GBFA 3ZFEB 4UV8B 3UUXB 1HR0T 2BVBA 4D3WA 1CGPA 4DR4T 2BDEA 2ID4A 2A6XA 4XTPA 3FFQA 4AQ2A 2XQ4A 4Q4X2 1Z2QA 3AA7B 4D7YA 2IHR1 2ZKLA 4DEVA 5HEGA 2HEWF 1W8OA 1VP6A 4PJNA 5FIXA 1BMV2 3MXZA 2XP0A 4BA9A 4I50E 1I9RA 2CWYA 2CY6A 3ILFA 4P5OB 1R091 4BQ3A 1OEDC 2LM2A 4LITA 4EB6E 1FMD2 3O7AA 2EXKA 1EV12 3RPGC 1ULFA 4XDOA 4MGYE 2JRJA 4TNVA 4IEYA 1O3QA 1UK5A 4M3CB 2C2LA 4JEUB 4IIJE 3FN9A 1HB4A 3WG3A 3AE6A 4CI2B 3HNMA 1XMOT 5B78A 3Q5XA 1NQJA 5CAZA 2A5ZA 2N9DA 1ZBA1 3THTA 1ZRDA 3ILRA 2YU2A 1ULDA 1F5JA 3AAIA 2LRLA 2DURA 5GZGA 4ZOLE 1JXNA 4IREA 1DGRN 2MT5A 2JDAA 5GZEA 3EAMA 3MI8A 3F2ZA 3PE0A 5IUXA 1X50A 5BXXA 4QF3A 2CKLA 3OSDA 1KS5A 4BQ5A 1YQ8A 1RC6A 3POJA 2D3SA 2JDMA 5HPOA 3GYDA 1NA1B 3EQEA 1U5ZA 3QK6A 4YSZA 4NN2A 3HKCE 4J6GA 3MPPG 2BG9C 5FWJA 2VMGA 2KYUA 2V7LA 2W61A 4UFLA 2BKPA 4CE8A 5CNAA 5LGTB 3ES4A 3LK3B 5SVYA 5JPMB 5FZ1A 3KT1A 5LASA 2CGOA 3AXJB 3K3QC 1ASJ3 4UWDA 4S3OB 2RR11 3LQJA 1H2MA 4LBKA 4EN7B 2OQ6A 1C1LA 1R081 3FLRA 5C8CB 1CPNA 4WVVA 4N9HA 5IK8A 3H8OA 2ZGUA 2JKXA 4W6WA 2YQLA 4WZ0A 2VECA 2J4GA 4WZCA 3WDTA 3URFA 5A7NA 3BUCA 1S35A 4Y1YA 2MNGA 4CDWC 1RUC2 2NMOA 4AI9A 5LHHB 3OY8B 2VZRA 2PQSA 1OD3A 4Q0SA 1UW8A 5H9RA 2Q9QC 2OUJA 1HG2A 3KV4A 4WM7A 3NVCA 2GC0A 1L7QA 1IQAA 2IC9A 3ZDSA 1LHVA 2YFUA 1YD8G 4YW4A 2JMDA 1CZTA 4IGUA 5C3SA 5A3NA 2BVVA 3U1XA 4LF4T 3F95A 2FUUA 4A7KA 3AYEA 4MSVA 2V26A 3NZPA 2CLYB 4JRAA 4AQGA 1SFPA 2XB1A 2NWBA 4WNKA 1JOPA 4DRRA 3I2IA 2RS31 1ZA4A 1TNFA 5C11A 4XAXB 4RHV2 3W59A 5JRCB 4MXWA 3CO2A 2WLQA 1DU3D 4U2AA 2PELA 4DB5A 1W8HA 2Y1NA 1WLWA 1OXZA 2O14A 1OLRA 4O4JE 1T8BA 1VBC2 2CSGA 4RR3A 2LEHA 4A3XA 5FY4A 5FZGA 1O5UA 4WVMA 4XZUG 4B3ST 1YLLA 4LF6T 4KMCA 5FKYA 5K0UA 5K3QA 3RZJA 5LA2A 5FJKA 4YADA 4GNEA 2R042 1XB9A 1XXNA 2ZM8A 1WD4A 3ZFFA 1LB2A 4QPIB 2FDIA 4LBQB 4QU2A 2QDNA 2LGVA 3L09A 5FOBB 5GZCA 4IW3A 1NKGA 1QMJA 4Q0VA 3EB5A 3PVNA 5I8TA 4Y4RA 4PDWA 2IVIB 2AREA 5IK7A 1D0HA 3CDZB 4JI7T 3H9AA 5LY1A 3AKQA 1ULPA 2UU9T 1HX8A 4OYKA 3WNNA 2K1JA 4D0QA 2KT9A 1WMEA 5JXIA 1AR83 5D8AB 1AR71 3ZX7A 4RD7A 4UBGA 3NBXX 4IDQA 1VPHA 5KH3A 1KFXL 4NWVA 3ZSLA 5LA6E 3V56A 3KVBA 3UKTA 4K3UA 5FP4A 4HN0A 3BTZA 2ECIA 4FQZA 3O0VA 4Y1VA 2MEV3 2EA6A 3HCTA 2KFTA 1Z78A 4O9EA 4AVVA 1UAIA 2P5BA 2WNOA 4D7SA 4R9AA 2QZ2A 3OBVE 1FOD1 3NNFA 4XFAA 3I1AA 2QNKA 2C9AA 1QH6A 4IEPA 3WXPA 4UXAA 5D1MB 4NPMA 2LS6A 4JI6T 4AGRA 4ARYA 4P0AA 2EIBA 2XVGA 1EV13 1XNKA 1FJGT 2YC4A 4M1PA 4RR3C 3WNMA 1AX0A 4UW4A 3QACA 5K8SA 1Z0PA 2BGPA 2I45A 3OPWA 2QVAA 1PZ8A 5C9AC 1IG3A 2CT2A 2Y6FA 4WM8A 4WBOA 4XXAA 2ZBJA 4U2ZA 3AE4A 4PNIA 3WVJA 2VBPA 3M3IA 2KWHA 3TB0A 4AVAA 4IEQA 3WW2A 1XE7A 3FHNA 1RUH3 3SC7X 2WBKA 2Q0AA 1WEQA 3I3EA 2IC6A 3T2PA 5JR2A 2ADEA 3CX8B 1N33T 2DDUA 1NG0A 4X20E 5LA0A 3ZVYA 3KT7A 2KE1A 2VQET 1H1IA 2RS33 3KF5A 4DZGA 2JD9A 2XAGB 4HWDA 3ZYBA 4HPKA 3JB8A 4AVXA 4FAGA 5AQLB 1QNWA 1DP0A 1V6NA 4XJAA 5J0ZA 1GP5A 4P09A 3VDDA 2WZIA 3M3OA 5LB6A 4QQLA 3DDTA 4IERA 1MS8A 2K46A 2JDKA 4YFZA 2X51A 3JCIA 4EYUA 5FO7B 4MBQA 2CRWA 2CBIA 4LFCT 1VBE2 5EHDA 1FNYA 5CA6A 1OLQA 1QLBA 4HFVA 3TRSB 2XG3A 4AGVA 4PHZA 1YI7A 4D94A 2QJVA 3A23A 3MHHA 2W92A 1Q5OA 5IYZE 1U5XA 2RM22 2FDKA 1YJKA 2V09A 5JAXA 1N47A 2M6IA 4F8AA 2WN2A 4ZKTB 5C4WA 1G25A 2HEVF 1DQ1A 4LE3A 1L0VA 4GB31 4QD2A 2A6ZA 2LDRA 1WMXA 2KR4A 1PO12 1GNHA 4Y5SA 1UF2C 2V72A 3LQCA 4IL9A 3ZYIB 3N7MA 1ZBA3 1BBT1 5I91A 4MOAA 3E5UA 1NOVA 1EY2A 4A4BA 4YWAA 5LHGB 2QQPA 4AHXA 3CQGB 4KI5M 2V6YA 4L9IA 2QQKA 4BA6A 2IXJA 2HWE2 4B1MA 2VKOA 1BORA 2K48A 3AMPA 5JREA 2VQ0A 4KHZF 3N2GE 2FHRA 4KU7A 3EYPA 5CG8A 2WSSV 1SEFA 4XF4A 3RFRA 2D6KA 4AGGA 5F2WA 1W2OA 3ZN6A 3POBA 2BV4A 3LOIA 3VBFB 4N43C 3RMYA 2CSYA 3M63A 5JWPA 5FZFA 5LA9A 2CLYC 5GONE 2P37A 2R0HA 5CFCA 1S55A 4XFFA 5DDJ1 3OGGA 4AI6A 2X66A 1AX2A 3AXDA 2MPFA 3AKRA 2WNVB 3LEGA 3ALQA 3FL2A 1DBNA 3KHCA 4YT0A 5FPXA 4CDQB 2HDPA 4PDWC 1OWAA 5LK5A 1PX4A 3MLJA 2QIZA 1K45A 5A6QA 2LHRA 3F2EA 1ZA7A 1EV11 1VBA1 4NHKA 3RIAA 4CYDA 2OZ6A 4CP9A 4V2VA 3K48A 4K1YA 2XASB 2IW5B 1RUJ2 2ARCA 4YW5A 1YC61 4B6XA 3N9LA 2E53A 1JH5A 5GZDA 3D6EA 2DVGA 5LKTA 4XFCA 1Q8PA 5EYAF 2DCKA 4K9SA 3BB6A 4GJYA 2MEV1 4JQRA 1N1VA 2XQ5A 1O3TA 3OPTA 4C0HA 2XTLA 5FL1A 4URTA 2UY8A 1ENRA 3S7EA 1MZ5A 3JD72 2LGLA 1E5RA 4CDUA 1T2XA 2YHNA 4XEZA 1GOGA 5H6RB 3ES1A 1IS3A 4JGZA 4LLOA 2OXQC 1JZ3A 3EJKA 4EEDA 5FYYA 3WQ1A 2WQ8A 3KWVA 3NKTA 1PIV1 2XOYA 3E1F1 3ZNIA 3MGUA 1H8TB 5CU1A 1W6OA 1OLMA 2E7QA 2Q30A 4DQAA 5FBJA 4UV9B 2YN6A 4EAHA 3UNPA 4LO7A 3QUJA 3VBOA 2XLFA 3CJIB 2I59A 1MQTA 5KXDA 1PO23 4TN7B 1K5MB 4CCNA 3N36A 2JMJA 3MF9A 1RITA 1DG6A 2VP7A 2DWGA 1L7RA 5FZDA 2AENA 2WT0A 5ADXL 1OUSA 3UQ7A 3RYFE 2ZX4A 3OG2A 3GHNA 1JN2P 5ABJB 2CM0A 3I2FA 2JECA 1PNFA 4Y22A 2IDOB 1FMWA 1XU2A 4N9IA 1J5WA 4YM2A 5DABA 5JCTA 3ACIA 2FUIA 1R092 1UGOA 3HBZA 1V9U3 4TZ4C 2B9VA 1YQCA 2W87A 4DXTA 4CI3B 1RMU2 2KLQA 4DV2T 1RUJ1 4LHNA 3IIAA 2VZPA 5SVIA 3A7MA 1QJU1 4HKAA 4LT5A 3I2GA 2CU5A 1SCRA 2RJ2A 1O5LA 2KA3A 3PHDA 5HWYA 2M85A 4DO0A 2JDZA 2J47A 4IEVA 4AYCB 1Z7S2 2AACA 4XAAA 5HI0A 3LPGA 3ZN4A 4CDWA 4D69A 3KCCA 5FLHA 5A6XA 2CL2A 1LHOA 4O2AE 1EUTA 3NAPC 5FZOB 5FXZA 3TLWA 4IE4A 3BQLA 5CA1E 3KCYA 3QB5A 3N3HA 4DBRA 4JKLA 2J1SA 2R041 2OUHA 5FZAA 4AI0A 2ZGTA 2W63A 4PK6A 1WE9A 3ROUA 4JX0A 1W0AA 3MV01 4B86C 5JDGA 3PVBB 5F5QA 1LU1A 5FV3A 1PK6B 5KHKA 4QX0A 1VE0A 3V65A 3U3IA 2PHDA 2E51A 1TVGA 4DS0A 1N36T 4D6RA 2XHNA 4C0BA 4Z91A 2UXNB 1GQGA 4YJ3E 1CZVA 3ZMNA 4RR3B 2ZGPA 1NX9A 2D6MA 2KWKA 3EVYA 3OTOT 2QQNA 3J26N 4IE5A 2JQ9A 3UK9A 1ENSA 1W9RA 4LK7A 4N90A 3WX5A 5FZ7A 4GMP3 4BAYB 5FMDA 1AR72 4DR2T 1ZM1A 2XQ9A 3J7HA 1HRV3 3TWIA 3ZFFB 2ZM6T 2E9XC 4Q1PA 4LBQA 3O33A 4EOZB 3BALA 3UU8A 4X62T 1YIFA 3X29B 1MIWA 4CEWB 5K0UC 4PQ9A 2KXPB 2VZ1A 3RZKA 3M8LA 2JIGA 2YG0A 3ACLA 1SDWA 4I0BA 2LUWA 2WP9A 2C2VS 4QHZA 3CHXA 3N2KE 1ZZ8A 1ONAA 3GN5B 5LY2A 2LSKA 1QDOA 1ZV4X 4LBQD 4HTEA 1HTJF 2A3YA 2XQ3A 1HKDA 3KS7A 4HWCA 3ZM8A 5SVXA 3ZXAC 2W3JA 1J1LA 1BMV1 2CDPA 2R0FA 3CMLA 2CA5A 2FJDA 3KV6A 4OK0A 1MNEA 2WA4A 3KLSA 1AR63 4EWEA 5G05L 4H63V 1XE0A 2ETEA 4IXLA 3N4MA 2JWPA 1H2NA 3K46A 3D0SA 4ASMB 1DGWA 4O4IE 1VRBA 1CESA 2OIIA 2L9LA 4CXXA 1MEC2 2C24A 5AQMB 1EZ3A 3LSVA 1GQPA 4HK9A 4XF3A 1XSRA 2VCBA 1RMU3 3CK6A 5HEOA 1IG0A 2BVMA 4CZSA 4U7YA 1L3JA 5F1RA 3T1MA 4I01A 4RQPA 5FO8B 1W04A 4DMIA 1W2NA 5ACA2 2BEOA 3QLQA 2VL0A 1UURA 1JUHA 2JEMA 3SMHA 2GC1A 4NIGA 5LNKA 4GB32 4YZ2A 1ACCA 4XIOA 3CX7B 3D8CA 1IPJA 3OOXA 1URXA 1CVNA 4NHMA 4D7TA 3EHZA 1GQHA 2W46A 5JXJA 1CD3G 4XVHA 2WO7A 3O35A 5L9VA 2X68A 3AP7A 2VCAA 3NRUA 2HH9A 5FKCA 2B7YA 3UU4A 5BNOC 3VKHA 1UWWA 3OYWA 3VBHC 4M3CE 3WNLA 2GAUA 3MACA 4I09A 3L39A 5FK8A 4S3OC 2H0DA 1FPN1 2K0GA 4N43B 4AVBA 5L3CB 5FMBA 1BVVA 4COVA 2VKHA 4EZ4A 1RVF1 1SPPB 5L7OB 1LRHA 1Y9GA 2JB8A 3E2DA 4KNCA 1CWPA 4FPHA 1XYOA 5LRRA 4ES9A 1S94A 1H1AA 2V5CA 4ISQA 3ZSMA 5F7UA 3ANWB 3CX6B 5E16A 4DVDA 3FHIB 4NRQA 1NE4A 2MAWA 4LKEA 2BDRA 3VKOA 1COV1 4HONA 3KDEC 5DUWA 1JYVA 3AMMA 1PMHX 1HDKA 1BBT2 4UI9B 2C0SA 1XDOA 4QDQA 4AL9A 4JAAA 3A22A 4WVZA 2F4LA 2VJFB 3T7LA 1QF3A 4CPBA 2P1BA 2M1RA 3SWHA 5AQIB 4B3MT 3AAAB 3GV4A 4AF9A 3B9CA 3VDDC 3I2JA 5LRSA 3MBWA 4Q4W2 4IV1B 1Z6UA 5DAXA 3TEWA 5JVVA 5HAXA 4ZI3D 4X8NA 1UOFA 1VBA2 1S2EA 1CAXB 1RGSA 3AE5A 5C71A 5J36A 4QGLA 2RDNA 4FXKB 3NWIA 5DZFA 3DYPA 5CKQA 1DYPA 2XJTA 3C7FA 1LEMA 2DWKA 3JCFA 4FPLA 3SOLA 1ZZCA 4UFKA 2P6CA 2WSVA 1GZWA 1OQEA 4YG0A 4LOTA 4HMZA 3S7IA 2I74A 4ASKA 2QQLA 4Z8XA 2HN1A 1WW7A 3AYCA 3EXUA 1WUVA 3LEKA 4K7JA 3C5KA 3RG0A 4UW3A 1JZ6A 3SITA 1JUIA 2KM2A 4NPLA 4L5GA 4GMP0 5FUPA 5IJRA 5LGNB 1OLME 2VE1A 2VQTA 3SOUA 4A7YA 2YUCA 1HX6A 2D9DA 4R9CA 1K12A 3VHLA 1PIV2 4AK3A 1AJOA 1BCXA 3AEFA 1PVC3 4COZA 2GMPA 2XOCA 2E6VA 3BTAA 1ULEA 1FPN2 2W1UA 5L7OC 3WAKA 3O7OA 4ZUXU 1ZBA2 2BW8A 4AAPA 3U5NA 5B79A 1M4WA 1QEXA 2ES3A 3KV9A 5IYYA 5DMYA 4JI0T 4XW3A 1W0PA 3U07A 3JXSA 1NYWA 3AKTA 4KWLA 5JMOA 3IF8B 1AZDA 3RWKX 1E2AA 1SA0E 1UX5A 1DYOA 1OPOA 4Z2WA 2WAOA 2ARAA 3A8YC 5BNQA 5AQSB 2A6WA 3AP6A 3VBFC 3C4WA 1Y43B 3W20A 1OHFA 1AJKA 1GU3A 3VRBA 4LO4B 2JG8C 4BQ4A 2PMWB 4LK9A 5FP8A 4QXKA 3HKEE 4F8HA 1FMD3 1NAFA 1OOPB 4JC1A 3JC6C 1SLIA 4IC2A 2QFEA 3SISA 3N9NA 4RGAA 2XXZA 1W0NA 3AP9A 4CVUA 2VNFA 4WW0A 2OYZA 2LSIA 5F6KA 2VK9A 4YTPA 3O1SA 4WZFA 4GALA 4YATA 2L7PA 1WLXA 1CIYA 4K21A 1PGW2 5F9TA 2GZWA 5E6HA 1JI6A 4I3GA 3ZC1A 4JGZB 2CPTA 3RI9A 1GYKA 5HBAA 4DUXA 4B7EA 2VU9A 2XQRA 3KF3A 4JGYB 1HB3A 3THCA 4XPVA 4V2WA 3DQVR 5FQ0B 5GLUA 4QPYA 2VZQA 4AG4A 3LDBA 2VTFA 1W03A 1HLCA 5DZEA 5DDJ2 4G2AA 2IDAA 3I97A 1VBD2 2BRTA 1QJY3 2RJLA 3DXUA 2MD8C 2UUCT 3PTRB 2X8KA 3HPNA 3AYDA 3GGLA 4U36A 2FDFA 1TMF3 4TLGA 4CDUC 3HL6A 4BE3A 4DRVA 4UEMA 2JG8B 5KXEA 4CN1A 2JG9A 2G4IA 3UL2A 1W0BA 4A41A 1PVXA 4K8FA 3C2UA 4AEDC 1OH3A 2I2SA 2WCAA 4DINB 2DYCA 1AR73 4IQPA 3GZAA 4ZONA 1KDKA 5J48A 4CEYB 1LOGA 5G0FA 5GKAC 2RS32 2OKXA 4K8RB 3NJZA 1AUYA 4LO8A 4DR7T 1JZ2A 1PMJX 3VL8A 4Y22B 2PXJA 2MUMA 2XJSA 4Y4YA 4CXYA 4PF5A 4YNIA 4BJ0A 3RKOA 2L5UA 4O4LE 3ZMZB 4O65A 5K4LA 4A5XA 2WKKA 5LKXA 4LR4A 3FUOA 4CA9A 3DPRB 2M6BA 1VMJA 3KT4A 4HFHA 1D0XA 5GZFA 4Y3OA 5DQ0A 3NW4A 4HKLA 2KGIA 1UYPA 5FP7A 2VOVA 1XYPA 4XF9A 4A98A 1PGL1 3E5QA 4Q4Y1 2QQVA 1UZ0A 5AQVB 4A4AA 2Z4FA 2JICA 1POV3 1NCQA 1W8NA 4UT5A 5A6ZA 2Q5TA 2Z69A 4ADZA 3NJYA 5IFTA 2TEPA 4YM1A 2NN8A 4UVAB 1RIRA 1RUG3 2W2IA 2X0YA 3M62A 5FYMA 1KDMA 2EICA 3SHBA 1AR91 2WA3A 2IFRA 2WLPA 3O9XA 5EK4A 3QB5K 3SNMA 4AISA 1SE7A 2V4AA 2G45A 4MH0E 4Y1ZA 1V70A 1DCQA 1PX3A 3VN4A 5FY5A 2HKXA 1RYYA 3I7DA 5KXBA 3VR8A 3F57A 1QOOA 2G43A 4F52B 4MLKA 3SUBA 2MPKA 5A6YA 1H30A 1LECA 1MM2A 4NIAA 2P9BA 2Y33A 1W6MA 2ZHMA 2RSDA 4W65A 3WNOA 2MA5A 3NJXA 2VKDA 3U78A 4FTBA 1WGMA 1OF3A 1AXYA 1R8IA 4OGEA 1TMF2 5LYJE 2XJVA 3ZYQA 2FFWA 4V1Av 2X29A 1YIPA 4AQTA 2ORZA 2WZR3 4PCRA 3WI3A 2FZ2A 3LCPA 5L3EB 3PJYA 1KD7A 3ONLC 3AECA 3FBYA 3HKBE 3AFGA 4W8JA 5ACA1 4NXNT 3LDQB 3VBRB 3ZFGB 4KGQA 4XFBA 4CEWA 3Q8FA 5GM0A 3WW3A 3AZZA 2ODVA 2CWMA 2JRKA 2JENA 5GLVA 4I43B 1RINA 4YW7A 4FOVA 3I59B 3LDKA 1NZIA 2PYTA 2P17A 4XCBA 5A3WA 3WW1A 4FOWA 4HFIA 2QZ3A 3AMNA 3B94A 4YGEA 2ZGKA 1GZTA 1XSQA 3BPZA 1UY2A 4YARA 3M7AA 1KNRA 4ITCA 1HCIA 4P9XA 1O4TA 4Q1RA 1QXJA 3HQXA 4Q4Y2 4L2NA 3LB9A 3H3UA 1KJRA 3K75B 2R062 3S57A 3DWDA 1HN0A 1D4VB 5FO9B 1BR1A 4WVWA 4KHPT 3PDYA 3ON7A 4OUEA 5FYTA 4L8QA 3GCXA 2VASA 2OXBA 5IK5A 2BGOA 3T6RA 3Q9OA 3H7YA 1NXD1 2YROA 1Y64B 5JDNA 2JJ9A 3ZXEA 4QGMA 3FEHA 1W05A 4ONUA 4UFHA 2LE8A 5JVDE 4X8PA 1UUSA 1NLSA 4MX3A 1N3OA 3WG2A 4HGAA 5LWBA 4U7IA 1T98A 2V73A 2VMFA 2VZOA 3OB8A 4JDNA 4N53B 3MHZA 4QXCA 1WMDA 1OFSA 2Z2SB 4CCGX 3FX3A 5I0DA 4A97A 2YB7A 1WEEA 1LOEA 3S6PA 4CU6A 2I6HA 4R4ZA 2CBJA 5GLTA 1U6GB 2E8IA 2FJEA 4GIWA 1W6QB 2KD7A 4DIQA 2BU9A 3AM2A 1YQ6A 2D0UA 1F31A 1ZX5A 1JM7B 2WNEA 2FMDA 1DIWA 1ND2C 5DUUA 3SOWA 4QX7B 1F15A 1TNRA 1PO11 1GKBA 2VL4A 3K4ZA 5FXWA 2WS91 5AQHB 2NLRA 2B4KA 4P5YA 3ZT7A 1U4QA 4XC9A 2LGKA 2E6SA 1YCIA 1YFWA 1SPPA 1TE1B 3VD5A 1QXPA 1RUE1 3NV1A 1GSLA 1H4HA 3C64A 5EPAA 4XYXA 3POFA 4QXHB 4K0KT 2ZX0A 4AXPA 2W0XA 4WVMB 3HA4A 4BWOA 2YSMA 2OLTA 3VBHA 2L75A 2A70A 4CEWC 4Q26A 1LEDA 1UZVA 3NRYA 3PUIA 1STMA 4KX6A 5I0SA 4AHWA 1DQ0A 3ZMUB 3J8F1 5C8CC 2DJAA 5FYZA 5T55A 2NM1A 3CQXC 4JYAT 4GD4A 5LBQB 1KRIA 1MMAA 1HQWA 5EJZB 2IC1A 4TZDA 5F8PA 4UELA 3QH6A 5DKAA 3WG4A 5T5JA 1RVF3 3K77A 3WLUA 3AEDA 1XC6A 3ZJ1A 1X4UA 4R8PK 2R1DA 2R49A 5LJMA 2C5DA 5I0RA 5CB7A 1CUNA 2YSJA 5D21A 5LBMA 1CPMA 3P3PA 3AJYA 3MIEA 3OUJA 3JAEA 2ZM2A 3MIDA 2EHOD 1NZCA 4QDSA 1QIQA 4R52A 1DLCA 2P34A 2D3PA 1FYUA 3J7Yq 3DYOA 3M3ZB 5I3LA 2WFF3 1GZWB 5A3MA 3VRAA 4XILA 5C8WA 1BK1A 2L9QA 1WGPA 3H50A 2RI7A 1B7TA 2YDQA 2KINB 5I93A 2GALA 4PI0A 2BVLA 1LGCA 5GALA 3MZKB 2JQHA 3D5OA 2CKLB 3EI0A 1AHSA 1H2KA 2XH6A 3PMSA 3NAPA 4PJMA 1VALA 2Q8DA 1IPKA 1F9KA 4AWDA 2XKPA 1TZOA 2SLIA 1ZRIA 3H7HA 2ZZJA 3RC8A 5G05B 1JU3A 5JSOA 3OCPA 5LEKA 1WBLA 5FERA 3UKNA 1VB2A 2QQIA 1GNYA 3C7OA 1JHJA 4W50A 1PO13 2YK0A 1W99A 3AXJA 2VJEA 4K20A 2PFVA 4IEOA 5C6CA 5C9AB 5AQKB 2DL1A 4MGTA 3ZPYA 5C8CA 1TME1 3A4UA 5FRAA 3NKGA 1WA6X 2BYVE 4E7ZA 3P7IA 2XOZA 2LW8A 2QQOA 1P8JA 1PGW1 4K0UA 4QX8B 1DZTA 2HYED 1YI9A 1VMFA 1W8UA 2X9YA 1RJ8A 4IDZA 5LW9A 2VD7A 2BWAA 3THPA 1W3XA 2HWD3 2HWB2 5FCCA 2YGLA 5FZMA 3T0DA 2LSGA 4GIQA 2TBVA 4HPKB 4DXZA 3C7HA 1IPSA 3B02A 1R093 5CKMA 3AE9A 3OPCA 5EP9A 2PAEA 2ZGOA 3EABA 5HCHA 1CN1A 5HXVA 1NUKA 3GDBA 5F32A 2BZBA 4I7DA 5A7OA 4Q8KA 2ERFA 1TG7A 1W90A 1JW6A 4BBQA 5J3UA 3ZYKA 3M99A 1DF0A 1JHNA 1MS9A 2IUBA 5I0UA 3K4AA 5JXGA 1DHKB 3GALA 4RGGA 3POYA 4X1KE 2PAKA 1OEDB 3FXDB 4AEMA 3C4ZA 4FPCA 2V7IA 3J4UH 4QPGB 4OYUA 2D6PA 1VJ2A 2IXKA 3BCWA 3DGTA 3NNMA 2XBO1 4FVVA 2HWC3 5A32A 4BQ2A 5E88A 1J58A 3ETQA 2RMU2 3WNKA 2GH8A 3A7QA 2OWAA 5B77A 2Y34A 1IAPA 4Q4V1 1QJU2 4H3WA 3CEWA 2JG9C 3POWA 1RB8G 3T3YA 2I0MA 4JEHB 4YVSA 1K2FA 3BIEA 2JG8A 5T52A 4MADA 4QB1A 4ZXEA 1LODA 3TLVA 1MZFA 1ND3A 4CCKA 3N5LA 2PG8A 2WSUA 3AVRA 3T0BA 2J7MA 1NLQA 2CXLA 2WDRA 1YFYA 4O9GA 4Z0OA 3KSCA 3R6NA 4PDWB 5FZHA 2L3LA 4X66T 1E1HB 2V6YB 1VCTA 2XPKA 2DHRA 4C9ZA 4ES8A 4LIVA 3AE1A 1NAEA 3VB9A 1KFUL 1TME2 1U5YA 3HMYA 5F3IA 1J3QA 2Y43A 4UAPA 4IGOA 4U33A 1ZZ7A 4RSUA 4O62A 5JIAA 2WO3A 3DPRA 4OHYA 2VVDA 5J1XA 2VMCA 3T4HB 3MO4A 3GF6A 1ZOYA 1CAUA 1HQLA 1Q8VA 2X05A 4YBTA 1EPZA 2ZKNA 5BNNB 5FNVE 5A3TA 3S5AA 3LFMA 1VAKA 4FOQA 3HQRA 1D0ZA 2X53S 2K4DA 4KG8A 1UZWA 3FC0A 3ZEFB 1FMVA 2B5HA 2OQ7A 4JI2T 1S0IA 4V1PA 3UUMA 5JMCA 3IT8A 4YW6A 5IVBA 4XIKA 2O8OA 2XQ7A 5DN2A 1O8PA 4EZHA 4UXNB 3ENRA 2BOIA 1GLHA 1D2SA 3RGBA 3FJUB 2C9KA 3LBXA 5BV6A 2MYSA 4CDQC 3B93A 4YFSA 1CX1A 1W9SA 1HX1B 4XF0A 2HBUA 2WDBA 1GZCA 3JUUA 2Y0OA 5FZ6A 3OEBA 4RS5C 2W5FA 1J3RA 2PLV1 2ODUA 3HAGA 4U72A 3ZSJA 1PK6C 2W47A 2R071 1MMDA 4N7UA 1W2UA 1A34A 2FMYA 5C3QA 2YOEA 5CFCC 5JIUA 4ZZ5A 4CUGA 3KZ4C 2KZ7B 3LK42 2ZX1A 3WUCA 4GJZA 1KGYA 2RE9A 3S0MA 5HXCA 4L58A 5FPUA 1DGWX 3V5SA 1BVP1 1DCSA 1R1A1 4FFHA 4NPRA 4DEQA 1ND3C 4MGQA 2HWE3 1IGOA 2YFZA 4YABA 1ULCA 2NTYA 3PUWF 1WEMA 3E08A 1J3PA 5ACA3 3NV3A 1TEIA 1PGSA 5B4NA 2Y0IA 1G9CA 4BQ1A 3LFIA 4N53C 4YAXA 3RJRA 3FZFB 3SH4A 1X36A 3RTRB 2EALA 4CU7A 2WO1A 2CWSA 1ZVFA 4HSJA 2X10A 2R061 3O36A 1US3A 2VMDA 2XJ7A 3ZFGA 5TDWA 3LWCA 3OF1A 2Y64A 3VDDB 3MLLA 4LMJA 4PI2A 2Y38A 4IGPA 4Q4Y3 2BG9B 2XL7A 3AP5A 3ATGA 3RZLA 4Z8BA 4P9GA 2EGMA 3KQRA 5KXJA 3VBOB 2BS2A 1POV0 1H7CA 1XNCA 4BMEA 4OX9T 1UU4A 2JIJA 4B7KA 3UKVA 1WIMA 2EXIA 1LOFC 4KG0A 5HEJA 4GYSA 4QX2A 3AC0A 5IVJA 4B1LA 3PUSA 4QT6A 2EHOA 1OEDE 3T30A 1QJFA 3KB5A 4OUSA 3ZKYA 2XM1A 1QJY1 4QGNA 4YTMA 1Y9QA 1BKZA 1CJDA 3IDBB 4PW8A 3B5LB 3FFZA 3MKDA 2XOMA 4PIZA 5A7WB 1YUDA 3UFGA 1C8NA 1LVKA 3UETA 5ABJA 5CVRA 3UYJA 5A70A 1AR93 3H1YA 2VULA 3LAGA 5AVAA 1UO9A 2JDHA 3O1VA 4GOUA 1HJGA 3TEYA 2RS53 2P2KA 3FZKB 1RVF2 3ZTGA 2PLV2 1HV1A 1WWYA 4CCOA 2LXPC 2FCTA 3WG1A 5A1AA 3RYKA 2GNDA 1MMGA 2ZMLA 5HWXA 2BGCA 5ABFA 4AOCA 4GNDA 5D1KB 1MBMA 3FJSA 3OBTA 2ZAHA 4TWFA 3H3AA 4YSYA 2WIIB 3SLIA 1I5ZA 2DUQA 2W94A 3DKWA 4H9DA 1Y9MA 1AYN3 3LG7A 1W9WA 1CIWA 3FMGA 2LLYA 4YRDA 1F2NA 5C3OA 4RGKA 1AL23 5LA1A 2PFWA 5EJ3A 2GDFA 1YKEB 3BOWA 1CHCA 4P1NA 3ZYFA 2KIZA 3AXEA 3VHRA 4UP5A 2W00A 1AL0G 1DGLA 3MIGA 2DSMA 4GH4C 3Q5WA 1I6ZA 4RS5A 3E0ZA 2JQQA 3U0ZA 2W52A 5C8YE 2IUWA 1QOTA 1PK6A 1JZ8A 2HWB3 2VG9A 2QQWA 2Y1MA 2RM21 3NO8A 2XL9A 2HJIA 4IEXA 2YYOA 4GWMA 2AYHA 1H2LA 4XCAA 5B76A 2LALA 1VD4A 3LVQE 3O47A 3AMQA 4PIXA 3U4SA 4Z82A 1O91A 3T1YT 5TAOA 5A3LA 3OBRA 5EYYA 3AVSA 2W1SA 4PJJA 3I3QA 4MO3M 3L3PA 4AKHA 2W4XA 4A7ZA 1C28A 1LCLA 3M1HA 1VBD3 4TLFA 2E7TA 2VR4A 1QJY2 3UJOA 5IW0A 4D6QA 3VHOA 5FDBA 2X9HA 1VR3A 3RPGB 2EA7A 1O3RA 5DINA 5FZ8A 2OV9A 1PVC1 5FVKA 4NJ4A 4G4FA 1IS6A 2GC3A 1UZYA 2VBBA 4CDUB 4FCAA 3A0NA 4JI5T 1D2QA 4YW3A 4YM3A 1S0BA 4WYVA 1H8TC 2GNTA 2QDRA 4F6RC 2BTVC 2IFWA 3APBA 5FTTC 4AEKA 5AC93 2XUEA 3JAFA 4MXVA 5EK2A 4Y5Z0 4IV3B 4BXSV 2MA6A 4BHWA 3IMNA 1QWRA 3H1MA 2ZHLA 3I2OA 4YYOA 4YSXA 3HCSA 3P8CD 1L7LA 2PHWA 4LMLA 4NIHA 3EUHA 1HNZT 2QYWA 1FAYA 3B7MA 3Q5DA 3TLUA 1XPWA 3ZT6A 3SH5A 2DVDA 5FXXA 3NVOA 3UT0A 1W8FA 2VVNA 2V6XA 5FUIA 2A9UA 2BKNA 4BQWA 2PHLA 5F37A 4QHOA 4M01A 1V6LA 3Q5EA 5FY1A 1W9FA 4E4HA 1Y7BA 4TN7A 2GP5A 2OX0A 1Y4WA 4EQVA 1YXWA 3E22E 4NROA 3CBNA 1RUF1 3WHUA 1KNZA 4A6SA 3GMIA 2DCTA 4IHJE 3LQIA 1QUUA 5H6QB 4I4TE 5DG1A 3NJVA 3WCRA 5JR7B 4Q4V2 2OA2A 2K16A 1UL9A 2TNFA 3MICA 2E6RA 2VJEB 2WAUA 3INAA 3RYPA 2PN5A 5T50A 3IN9A 3S30A 3RI5A 4P08A 4B3NA 3USSA 3JQXA 4CXWA 3VDAA 5EV7A 3B3QE 5TDRA 3MUZ1 3EHKA 3OPZA 4XFHA 2EODA 4XFGA 4B4PA 1GANA 1J5ET 4L0PA 2UUBT 3PVOA 4YZ1A 2XAQB 2ZEXA 1JMUB 2VCCA 3AZWA 3ETUA 3CZUA 3MDBC 4LF5T 2BG9E 1FI2A 2HHHT 3O70A 4Y33A 5F3EA 1MS5A 4ZY9A 4HFDA 2NOXA 5FMOS 2W91A 3C50A 5A80A 2Q9QB 1XJAA 3O1OA 2G6QA 3AJZA 4ILCA 1IBMT 2WQ4A 2YBKA 5BNNC 4CDWB 4PLNA 2HWC1 3ZXJA 5IAVA 3WSOA 3IEEA 4MHUA 1JBCA 1WW4A 5FZOA 2NYYA 2KR2A 3O1IA 2WYFA 4IEUA 3ANWA 4NN0A 2Y6GA 5AQOB 3Q8EA 2BJSA 2ZHNA 4FPFA 5I0TA 3WQ0A 3SFDA 4QPGA 4CP2A 1WESA 1XYNA 4YPJA 3B69A 1EAH1 5M4YA 1IZNB 2VJFA 1PGL2 3H8RA 2RDSA 4M0HA 3VBRC 2Y48B 5BYNA 3LIGA 4Z07A 1PM7A 5L4EA 4A3ZA 5A33B 4DV3T 3ZLIA 4CCDA 5JDMA 2WS3A 3M7KA 2UUAT 4P00B 1CAXA 2YT5A 5L47A 2DTWA 3CLPA 4JCKA 3DUIA 2R072 3BQIA 1DQ6A 2XJPA 3GHMA 2PNXA 4LHKA 4X3GA 2VPBA 5JOYA 1ZRRA 4EWAA 2JB4A 1ND3B 5EXOA 5AFEA 1UXXX 5J37A 2XJQA 4INDA 5BNPA 4LIUA 4MVTA 4ZS3A 2GNMA 3LQHA 4BISA 3GL6A 3G6JB 4Q27A 1XWMA 2RR13 3CQOA 4OHZA 4OFGA 3O0WA 4R7EA 1V6JA 4LULA 2E9QA 1IZ3A 3KGZA 2UZGA 1W28A 3RYRA 4OVEA 1SLAA 4GKYA 4OCTA 5GLZA 3GN5A 2DUPA 2G0UA 4NHXA 5FJHA 4AUQB 2VKJA 1OD5A 2RDRA 2VNGA 1T7SA 3P50A 1ULGA 1GZ9A 2A73B 5BNNA 3VD9A 3AE2A 4IV3C 4OI4A 3UTKA 1GOFA 2Z6EA 4WZXA 1JYIA 3G7DA 1LRZA 4DBQA 2IXLA 1U12A 2Q8OA 3PUQA 5L3GB 1Y01A 1IOAA 2UU8A 4OZXA 1WYCA 4KH9A 5LCWB 2K17A 3FZMB 1DFQA 1VRH1 4HKWA 3JUEA 3SKVA 2CEAA 3PJAA 4JTOA 4YBMA 4A0CD 3C7GA 4P9WA 4GWJA 5JH7E 3AKSA 3B5MA 4RFT0 3I4IA 3HEIA 1CX4A 5J2TE 4XJUA 2JMKA 3CJIC 2CAUA 2D43A 1WEVA 5FYBA 1JOCA 4YJ2E 2P6HA 4Q0UA 2NW8A 1AR62 4NOTA 1RJ7A 2DF7A 4GKXA 3HOBA 2WQYA 5K7PA 2WU2A 3K3NA 2XVKA 4DMWA 4H9RC 1LENA 2P3IA 2FD8A 3WV6A 5JI9A 3VZNA 5FB1A 1D7PM 5FYIA 5DAWA 5F5AA 2E7AA 2ECJA 3OD4A 3SEPA 3M3QA 2JPFA 3I3MA 3TBDA 3AKPA 5JOWA 3TEXA 1PO22 1W9TA 4LF8T 3JADA 3HJRA 4DR3T 4JHTA 5KH9A 5L7OA 3ZXFA 4FFFA 4O7XA 1HJFA 4HK8A 5F5IA 4L7XA 2RP4A 3MYXA 1GQEA 1NXMA 3ACFA 4FT8A 5G04L 5C33A 2E26A 1OVPA 4HVRA 3RQ0A 1WCSA 3OGRA 5F3JA 1MZEA 5DUVA 4EEBA 3ZYMA 1Y3TA 4YW1A 3W9AA 5FFOC 1UU5A 4LBJA 2R7EB 1H1MA 2JG9B 1REDA 4RHV3 3WW4A 2H88A 3VZJA 4A45A 3V0AB 4QQHA 2EHOB 2WT2A 3HBKA 4KUMB 3P4PA 3WDVA 1DZRA 3ZXLA 3LOBA 3A5XA 4O8SA 2BWCA 4MYEA 4PTBA 3TAYA 2DTYA 1VFYA 2J1RA 1J59A 3WQBA 4FFGA 3PMEA 3S4UA 2WC2A 2OW4A 3PV0F 5JDLA 4AQFC 5FY0A 3KD4A 4EV0A 1XE8A 3ESLA 5D8AA 1YFXA 3NV4A 5JDHA 1RUE2 4RFRB 2C1FA 3DCQA 4BLJA 2HLEA 2CSVA 3T8OA 3LJCA 5ABFB 1DYKA 1EPWA 1YQ2A 1NCQB 3NV2A 3ABVA 1RL3A 3WDXA 4WZ2A 4TWDA 3J8F2 4CRQA 3H8UA 3RHWA 4COYA 4NWWA 1PZ7A 4QWNA 4LA2A 1WBFA 1CQ9A 1X82A 3A21A 3O1MA 3T2TA 1VBB1 3PURA 5DAQA 4H9NC 1U5PA 1VBA3 2GMEA 4PIYA 2WBLA 1XRUA 5AIUA 4YXDA 3SKJE 3BGAA 1LDJB 3AEEA 3VBSB 1S0GA 2JDYA 4FBFA 2IAKA 3WP6A 2YV8A 4CZZB 2J1UA 1COV2 1XZYA 4YVWB 3MPBA 1PO21 3JB4C 1V9DA 2E61A 1JYCA 2YURA 1IJ5A 1W39A 1W6MB 2A3XA 1MEC3 3FBLA 5FWEA 4NHLA 2MTQA 4XE9A 5T54A 5FK7A 3S5QA 2ZXQA 4N7IA 1I5PA 2N7GA 1CHUA 4F83A 3JBG3 4CN4A 1HRI1 3EBRA 2EGPA 3QBQA 4D8MA 5CADA 1G8XA 3ZMVB 3VD4A 2WINB 1YRZA 5JR9A 3GA8A 3KNVA 5C7GA 2CHNA 1QJU3 4YLZA 5ANQA 2YVRA 2D98A 3AE3A 3QD6A 5HCMA 2L8KA 2ZGNA 3LSDA 2VOXA 1J1TA 5KH7A 4NRPA 2C5JA 2V7KA 5HYAA 1AR82 3TN92 3UESA 4PPEA 5B8DA 1WLCA 1G73A 4HZFA 4Z1VA 2F4VT 4CTEA 5JSPA 1AX1A 4TV8E 1I6XA 4YM0A 5IK4A 5B4XA 2VVEA 2VUDA 4UYBA 4PAGA 1G9BA 2VJXA 4F1PA 4JGYA 4CUBA 2XQYA 2G1MA 4C91A 1UQXA 1H6YA 5CGMA 3O12A 1PZ9A 4FPKA 2P3YA 1WLTA 2FJAA 1LU2A 3V0BB 3I9WA 2OS2A 4ASLA 4KGGA 3LA3A 4NIDA 1D1BA 1ZRFA 2HWB1 1HG5A 1UOBA 2VBDA 3IDAA 1POV1 3VHPA 4QXBB 3P4QA 3K4DA 3VBUB 3EO6A 4BM8A 4MHRA 4TWHA 5DJQC 4K6BA 4NUBA 2XONA 5L3BB 3NWKA 3R4DB 5F5CA 4CCLA 3CWZB 3GZTB 3ZSSA 4QDRA 2EAAA 3VV1A 1KF6A 4AQFA 1EAH2 5C70A 5DPNA 4SBVA 4CCJA 4HVQA 3FUQA 2X0HA 4NMIA 5C3RA 1YJLA 3E5XA 2XAJB 3HR0A 2LJLA 4IDNA 4X65T 4Y20A 4YGCA 1N3PA 5AQPB 1ALYA 3RVHA 3BODA 5FY9A 4QM9A 4JDOA 3EMRA 3DN7A 1UX6A 4FI5A 4XF1A 3OBZA 3RYHE 2WZHA 2EIEA 4YLHA 3BIWE 1HF8A 3VBFA 5FLIA 4G3YC 2NMNA 1ND2A 1DLLA 2GN7A 3C3VA 2VPGA 3AMHA 5CFCB 4K40A 3QOPA 4HWFA 4SLIA 4I0WB 4IDOA 3M65A 1IKQA 2WNVA 4XJZA 4B8EA 2AR6A 2ZX2A 1AYM2 2LRPA 1B09A 3ZMOA 1OURA 2LHNA 1LKXA 4AEJA 2C6SA 3WP5A 5LATA 2ACZA 3O1JA 4JV5T 1BQPA 5KHGA 1GMMA 5ANNA 1VBD1 2ET7A 3TN91 4GZ9A 1KK7A 3VLBB 2XWBB 4JTNA 5FP9A 3AZYA 2R6QA 5SV8A 4MLOA 4QXHA 2VNVA 2ARXA 1T72A 4LTAA 5H9QA 3TYJA 1NE6A 4QX3A 2X5IA 1RUNA 1IQDC 1HB1A 4KMQA 1G9FA 4IETA 1LJ7A 4FK5A 3PLQA 1UX7A 3UGFA 2VO5A 1JS9A 4E2GA 4S2GA 3DYMA 4E7SA 2RS12 1O3XA 1LESA 4J1WA 5LMNT 4XURA 4LUMA 4KI0F 3PHMA 2A3DA 4JGYC 4LA3A 4DR5T 2YHOA 3FZLB 4OHWA 2BP6A 1OQDA 1RUI2 4R9DA 4JI8T 3AB0A 2VUJA 1QDCA 1V0AA 3DPLR 4M4PA 1G7YA 1GR3A 2VXRA 4HFBA 1V6IA 4UFJA 4QAWA 5H1UA 3VBRA 4TXWA 1QKQA 5JZGB 4IEZA 4O64A 4HEAA 1AXKA 3VKMA 1C5IA 3NQHA 4EYYR 1UPSA 3JZVA 1BHGA 4TX5A 3HQUA 2RS52 3I59A 1I1EA 3KCXA 1MS1A 1GFF2 1RHI3 2VZUA 3NNJA 3UGHA 2BBVA 5H9PA 3BI3A 4A2UA 2R073 1VRH2 2XVLA 3K2OA 4DR6T 3GCWA 2UXXB 1PNGA 1K5MA 3HIFA 3ZVZB 4CDXA 4YG6A 4Q6FA 3NKZA 5FPZA 1DQ4A 3FB2A 4QPGC 3AP4A 2HBTA 4MSXA 2O8QA 2XGXA 3BTYA 1SLLA 4RYDA 5C5TA 2J1DG 2AEYA 2AXDS 2H89A 4MHCA 4M3CA 3X1DA 4H7MA 4I55E 1FT9A 3CJXA 3R6SA 1FOD3 3DV8A 3RZMA 5TABA 5SV5A 3HI2A 5C9AA 2Q8EA 4OYJA 3LD8A 3VDCA 2FSAA 1RTVA 1E57A 1NLRA 1QQP3 1TMF1 1X9TA 2WZ8A 2YBPA 3T9KA 4WBNE 4AFAA 1NENA 2BPA2 4UF0A 2C5KT 1I3HA 2WDQA 4PK4A 3O1PA 2XJRA 3GXUA 5SVIB 3EB6A 2SBAA 3ZR5A 1ZP0A 4N53A 3T4VA 2H6CA 4B4RA 2WQZC 4PFPA 4CSWA 2YGMA 2WWJA 5KXCA 1YEWA 4W6YA 2RS11 2R063 2CXDA 3RIUA 1HYJA 3D4KA 4AQYT 2KKXA 3I2HA 4AE2A 4UOJA 1SHZC 3O37A 1VB4A 4LNVA 5E89A 3UU5A 1W6QA 1WMFA 3GJBA 1XQNA 5AQNB 3ZDVA 4JV4A 3ZXGA 4BZ4A 3NRXA 3U11A 3H37A 3UU6A 2XKOA 2DVAA 4FFIA 2XAHB 1T1HA 1A8DA 2RDQA 4YHHT 3H1WA 4WA6A 4PQQA 4COWA 3JU9A 5A32B 4PF1A 1REFA 2Z79A 3POEA 1MS4A 4QF2A 2YMZA 3LZZA 2F42A 1WCDJ 3RYIE 1UX4A 4CDXC 1VBB2 4ILUA 4UVCB 2IIUA 5KHHA 3ZYJB 2LM9A 4QKBA 1UU6A 4DMVA 2UXDT 3ME2A 1CZSA 3T2QA 1ZEEA 3TKLB 1OF4A 1N3QA 1X4IA 1O7FA 1O6UA 1MACA 1TQ5A 5LCYA 4O4HE 5HXRA 1BR2A 4XMIA 4COUA 2VURA 2WR9A 4K1ZA 4CPBD 3AA1B 1UY0A 3POSA 3AX4A 4PJLA 4E4SA 4IE7A 2ZLYA 3MIHA 2O1QA 4IDPA 1UYZA 2J1AA 3AK0A 1S0JA 1HRI2 1RHI2 4BB3A 3IKWA 5JRCA 1FATA 1LULA 1IS4A 3W15B 4FPOB 3R0RA 3L11A 1CAUB 5T5PA 2DNXA 2VTXA 3ELNA 4H14A 5DG2A 5T5LA 4ZPIA 4A42A 1CAVB 1APNA 3GM8A 3ZKRA 2LV9A 4EV6A 3GNEA 1MNDA 2Q4SA 2HYXA 3RS6A 3RWNA 2DCYA 2PBIA 3CQCB 5LHIB 3MA9A 4QH4A 4FPGA 4TNWA 1MIVA 2WS92 4QWNB 5D1LB 1XNBA 5IVYA 1JNRA 4AI1A 1JOBA 2LROA 2ATFA 2ECVA 3IIIA 1W8ZA 5L73A 1LKNA 4X6QB 3NAPB 2NW9A 3UV9A 2LXHC 2DLRA 5LGUB 3VBSA 4ATFA 1K42A 4LKDA 3GJAA 2UYAA 3BOPA 4H9SE 3OGVA 4JBWF 1BR0A 3OUHA 1V6KA 1B35C 5ETWA 1JODA 2XM2A 5APAA 4L99A 1WILA 4AKLA 2VQAA 2WJSA 1X4JA 4DXRA 2VOTA 1W6PA 3AB3B 2ZETC 1VBE3 3MK7C 1ZZBA 1WLDA 4LHLA 4ZZBA 4QX8A 1E4UA 2DVBA 1UD1A 5BUVA 4ILAA 2DUOA 2XQ6A 1W6NB 1LOAA 1F8VA 3I2DA 1H9PA 3PU3A 2MBGA 1W06A 3T09A 1ZHCA 3I54A 2TUNA 4XFIA 3AE8A 1AL22 1HV0A 2EAKA 3TEZA 1PMIA 3ASLA 2WY2A 2OZJA 4MG2A 2BERA 1RUF2 3I0QA 3ZPV1 3ZSEA 4ZZCA 1F4AA 4AEDB 3GBWA 2PLV3 3RIFA 2UWCA 4GXLA 4ZU5A 3C98B 1HXS3 3FM8C 3ETVA 3K1SA 3I8TA 5FP3A 4ZI3C 1SACA 5J96B 4N78D 4MUVA 4OHVA 4QX5A 2VW1A 2GSYA 4NIQA 1Z7S3 1AYM1 2R32A 3WF2A 2RVAA 1MPXA 3ZVXA 2KREA 3ZFGC 1NWMX 2XY8B 4LK6A 2LOPA 4FQ4A 1MM3A 4P9YA 4IV1A 5L9BA 3H8XA 2W0GA 1XDPA 2P4EA 2VZ3A 2JUNA 4BU2A 4Z92B 4RA0A 3ZKUA 2ZEYA 3DECA 2J1TA 4OLLA 1VIWB 4F7ZA 4C1XA 2ECNA 1HW5A 2E32A 1JYNA 2D8UA 2FCVA 1LDKC 2CHOA 3PUYF 2PHTA 4WBBA 1VAVA 5H1VA 4U31A 5AQGB 1J1JA 2A75A 4NPPA 5EFUA 2J1VA 2FUPA 2X0LB 1XNRT 2YQMA 2UXBT 1C1FA 4FP2A 4AFDA 2HWF3 1H6XA 4Y20B 3C8XA 4TWTA 3ORJA 4OZOA 1RUI1 5LMUT 4GK0E 3VBSC 5L2LA 2WNUB 1HQNA 5DQWA 1A8MA 3GBGA 5JZGC 1UN1A 5HCFA 3LK2B 3VZOA 4DUVA 3U4XA 1RXFA 1KJLA 4DR1T 5L4HA 5H1TA 2FBWA 1W2TA 2ZMNA 4DV5T 2RPAA 3FHAA 2XLAA 1C8M2 5IHYA 1BJQA 2EHOC 2W1WA 3T08A 3UQ4A 1WYBA 2JIWA 1IBLT 4MGKE 2YUEA 4QPWA 2ZEZA 2QGSA 1SDDB 4RL7A 4O61A 2XBO2 1QGLA 5FREA 2X67A 1VCSA 1FIOA 1BZWA 3J7LA 5FZKA 3LBXB 1PIV3 4IL4A 4H2AA 4RHV1 2B1EA 3OVUA 4E27A 3PUZF 2E9XD 2X5IC 2W39A 1UPIA 4J25A 5F2SA 4OHFA 2CHHA 1IHMA 4JI1T 2H6BA 2UWBA 2UURA 2WNVC 1H8VA 3H0OA 4QB6A 1BYHA 4NIIA 1JZ5A 4LF9T 3LE0A 1FPN3 5HXSA 4GULA 2YINA 3ZXDA 5JOZA 4QQ2A 2DVFA 3O4XE 5KX5E 4CI1B 3WF1A 4YC9A 5BNOB 1YQ4A 4KBZA 4HETA 4GNFA 2B39A 4IT4A 3MEPA 3N2OA 2D40A 4RN5A 3ECQA 3Q8CA 1JZ7A 5BPXA 4PT6A 1VMHA 2BNNA 5J09A 3RH3A 4L11A 5FEYA 5J98B 1PM4A 5FAXA 1ZNPA 3FBZA 1NQDA 2V7JA 1X8MA 1QHDA 3ZCJA 4MV2A 3IWZA 3IDCB 4Q25A 4N4FA 3M2MA 4CCEA 1WEWA 2WZPP 2FBEA 4N8MA 4DV0T 5JZGA 1XOYA 2QJ0A 4NO4A 4LLBA 2L0BA 2LM3A 4HL0A 3WDUA 2XMLA 4CP9B 3AZXA 2QKDA 3WDYA 2BG9A 3JBG1 4ZZ8A 5AC92 5J2UE 1N1SA 5LG3A 1ZBE1 1QOSA 2PHRA 3ZIXA 5KR7A 3N7KA 2FZ1A 2BNMA 1JOJA 1A78A 1CJPA 4X1IE 3I9YA 4U74A 5F39A 4ZU7A 5IVVA 5IWFA 4M3CF 5AFUL 4LJNA 2GK9A 4IEWA 1FOD2 4HWHA 2JMIA 4TSVA 5JPNB 4XHBA 4DNDA 4ILBA 3C4XA 3USUB 5LEJA 3BTXA 2DWRA 2CRBA 3FZHB 1SBFA 2D2SA 5HCAA 1BEV2 3FZ3A 4QKDA 4XUTA 2B0OE 1UZZA 3PL0A 5E8AA 4GWIA 4QU1A 4B3TT 3CF6E 1F5FA 4EWDA 3HCUA 4FJCA 2F6NA 3KBTA 1BBT3 5AQTB 1J84A 1AF9A 1DZQA 2NP9A 5FZIA 1VRH3 3RRCA 3VUOA 2A72A 4XQWA 4DNYA 4R4XA 4DV1T 4XDQA 1H8TA 4B3RT 1SCSA 1W6OB 3MDPA 2C0ZA 1KEYA 1H9WA 2CAVA 2WFF1 5CZKA 2ZJCA 2LN0A 4AVCA 3K3OA 1MQTB 5L9RA 2GH2A 4Z2AA 2HEYF 2DBIA 3LDYA 4Q4X1 4FI9A 4M4RA 1K5MC 2Q9QA 4GA9A 2H0VA 3OJAA 4BJMA 3WEZA 2ZGQA 3P6BA 1C8M3 4FOYA 5GLWA 3L9JT 2MIQA 5JTGA 5AQJB 2VNRA 1JYXA 4JQTA 4XZCA 2YW8A 4IUGA 5E1RA 5FZEA 3T1HT 1KQRA 4LBMA 3IHPA 3J7NA 4E2QA 4ZI7E 1ZZ9A 1ULOA 5EIYB 2WUHA 4XXPA 3J9X1 1WZXA 1X9BA 3VD3A 3IDEA 2EXJA 2CSZA 4ZHNA 5BY5A 1EAH3 3MV11 3GZUC 2EXHA 3RPQA 4XTMA 2WNUC 3E6CC 4LPLA 3MUY1 5A7SA 3VZLA 5A33A 4XAEA 4W4UA 2PHFA 1EP0A 5ABGA 2VPDA 3Q8BA 2G9GA 2QICA 2EIGA 4C1WA 3CZJA 1FEWA 2D44A 2IXHA 5DXDA 2B9UA 1AVBA 1OUXA 4AYCA 4JLEA 1Q8OA 2VZTA 3SH3A 2NAAA 2AC1A 3P4SA 3NSTA 3MLKA 2VUCA 4KBBA 4GWNA 3J7MA 3RNSA 1JYWA 2NZ9A 5CEHA 5AQRB 2JE8A 3CVRA 4HFSA 1BEV1 3CIRA 1OA3A 5J1GA 4DFSA 5IT6A 2BBAA 2P57A 3PNAA 4FPEA 2ZGMA 3O1TA 4UVBB 5C3JA 1POQA 3BN6A 1XBFA 2R6GF 3OYZA 1HXS1 2B42B 4GK5E 2Q1FA 3ZO0B 1FP0A 3ZPVE 2IMLA 1SZBA 3Q9DA 2NTXA 2Y26A 3ZN5A 2RR12 5FB0A 1WCQA 4LO5B 2ZOEB 5FZCA 1AL21 1R082 1S0FA 2NPIA 5DUXA 2YKSA 5F3GA 3PIJA 3TN93 3AA6B 3MF6A 4KBMB 1U0AA 2VGDA 2ET1A 1FV2A 2JM3A 5IAXA 3DXTA 1QJX2 2ECGA 1RUC1 5CB4E 2DCZA 3EDUA 3SQOA 5LOVE 4U2YA 3V43A 2DFBA 3WF4A 1UNBA 3JD73 4W6XA 5HEHA 4FJOA 4YBSA 4YZ4A 3ZC0A 4B7YC 1M7KA 4YGDA 2YXSA 4XJ8A 2N2NA 1AR81 1C5HA 4JHZA 1OQ1A 1M06G 2RV9A 3IMMA 2D7FA 2WDVA 3WAJA 3N9OA 1SLCA 3V64A 1QH7A 2UWAA 1MMNA 2MD7B 2XB6C 3PUGA 1UCXA 3U14A 3AEGA 2YREA 4QXCB 3P1IA 4NRMA 1FX5A 4BQXA 1QJEA 4MGZE 4AVSA 5AFBA 4XQDA 5CFDB 3UUNA 3TLTA 1W6PB 2DV9A 3HR9A 4L92A 4OMDA 4B4QA 2N1GA 5KC5A 2XHEB 3QZVA 2CNAA 5EWSA 4LKSA 4Y26A 4XABA 3VU7H 1K5JA 3TNQA 1SMVA 3HN1A 5C4WC 1ENQA 1YYNA 5TSWA 4E8DA 4I0AA 3L2HA 4AQ6A 2WM9A 1SG3A 5KWRA 1UY3A 1B35A 4HOOA 1UMZA 1F62A 3N9MA 2AH2A 3PJQA 4AKIA 2KNDA 1WKYA 4DUWA 4ZQLA 2FDHA 2D5HA 2VMHA 3W5NA 1G9DA 2VMEA 3PUXF 2WB5A 5FMCA 2B76A 1FV3A 4AEDA 4I2OA 2Y6XA 3HT2A 4HN9A 2XR4A 2V4VA 2ZA9A 5D2AA 3VKGA 1OT5A 1OA4A 3AEBA 3WUDA 5FMOL 1ZBDB 1ZYBA 2VMIA 3OY8A 5FYHA 4XUQA 1A6CA 1G6NA 3VBHB 2XPJA 3VZMA 4WM7B 5FLJA 2W1QA 1RUG1 4FPYA 1QNYA 2V8SV 1WCKA 1VAMA 2UYBA 3LEIA 4COFA 3V0AA 3R4SA 3LKJA 4H9PC 1RXGA 3WP3A 3H3LA 4FP3A 3MIFA 3WD5A 2ADDA 3NNLA 4QPIC 2XSBA 1QJX1 1O4ZA 2YU1A 3K8PC 3U5MA 1SHWB 1O4YA 3O0XA 3LPFA 4YGBA 4GH4B 4ZS2A 1SBDA 4G9SB 3B9IA 1SBEA 4HFEA 5L19A 1OC1A 3VZKA 4CU9A 4QX1A 2J42A 1Q8QA 1SUMB 4MXWB 4XACA 3ONJA 1XMQT 4I7BA 4QQ4A 1NEKA 2OA5A 3VR9A 3WDWA 3ETPA 4BJNA 2RS13 2Z5WA 2K3WA 3D3AA 2YDEA 1Z60A 2VQFT 3MW2A 4NHYA 2ZMAA 5BNPB 5LXTE 2PTMA 3U37A 1TME3 4NAMA 1Z0HA 4LXLA 3KQ4B 3O34A 4AHZA 2QRXA 2W95A 4AR2A 1GWKA 1OI6A 4ZXKA 4L97A 2RHPA 4JRLA 3KBUA 2QA7A 3SOXA 3O5SA 3RJ2X 2WNUA 1QQP1 1BK0A 2HWC2 4EN9B 2W08A 5EJ1B 5KHJA 4E2SA 5F6LB 1MVQA 2NR4A 4QKFA 4EXTA 3C51A 1SLTA 4QH1A 4E9KA 3ZPOA 4LQRA 2PJQA 4IV1C 2QQUA 2WWVA 2BZDA 2J62A 1ODNA 3CL1A 4PLMA 2XDVA 4Q0QA 3Q1DA 2W2UA 1LHWA 1RUF3 3LJUX 4H63H 4AQSA 1DU2A 2VW2A 2JDUA 5AC91 4EIWA 1ODMA 2BAYA 5LBFA 2PA7A 1BXHA 1NCRB 1S0DA 2M13A 1YFUA 1GV9A 1QJZA 5FZ9A 3ZSKA 3IB3A 2RS51 2D6LX 2CDOA 2HH7A 4AFBA 3L1XA 5E0OA 4XQ4A 1OXCA 5CBLA 3FBMA 3U10A 2XUMA 2W9XA 1RUD1 2YPJA 1PHMA 5JR9B 2D97A 1H4GA 2LOSA 1UOGA 2VTXJ 4FXGB 5BNOA 4GKJT 2K2SA 3NZQA 1KEXA 4X6RB 1NA1A 5FPBA 2GP3A 2VVFA 1KITA 2WU5A 5IHRA 3HWJA 4LOSA 2YY1A 4XUPA 4G63A 3TLSA 3DL3A 2X9WA 4JKKA 3RKGA 1HNWT 2ZX3A 5FPAA 1LOFA 1XWHA 1WFDA 2MOZA 5JR9C 1D1AA 3IPVB 3BK9A 4BIFA 3L8RA 2WFF2 3MHSA 1G8WA 3M3CA 1OA2A 3HNYM 3WY6A 3RC3A 2FDGA 1X7NA 4BLIA 4WM8B 3LDRA 1HRV2 2K24A 3JQWA 4V3KC 4DV4T 2IXIA 4YTNA 4KU8A 3RSJA 2L43A 2XQ8A 2RG4A 4O2BE 2H0BA 4XHXA 3CU7A 4PBOA 3B13A 5H9SA 4URAA 4YVWC 4Q4X3 2VOKA 4IC3A 3N35A 4QXBA 2RR4A 5FXVA 1C4RA 5A3UA 1OBNA 2J22A 1UMHA 4UW6A 1I94T 1LOBA 3DF0A 4LJHA 2L80A 2JE7A 4WM7C 3ZN1B 5FVLA 4QQOA 5FOJB 2M3HA 3UFEA 1LOCA 4AP4A 4HFCA 1WCUA 2EXUA 1GWMA 1Q3EA 4ERRA 4TYSA 1LNSA 3OTFA 1RUH2 5FYVA 1REEA 1HIXA 1GBGA 2YEVC 1OKOA 2LAUA 2F17A 2E5VA 1WA4A 3PU8A 2LQ6A 3MW4A 3CIHA 1QXRA 2VUAA 3GZEA 3QC9A 4I3PA 4IE6A 1LAJA 4TV9E 2ZS6B 1FXZA 2X09A 3KFWX 1VLNA 3WT3A 2JE9A 5C4WB 2W62A 1HNXT 4Z0RA 5EQUA 3M4FA 1BR4A 1KNPA 3ZN0B 2E5LT 1ZRCA 2YPDA 1UY1A 4AHYA 1LHNA 4GNGA 1JTZX 5BMVE 2GC2A 5CKNA 4P0BA 2JX9A 4QPIA 2ZACA 3ITQA 1PVC2 1KFYA 5A3OA 5DZGA 5LBBA 5AITA 4JGZC 3BVCA 4IESA 4YFWA 3JBG2 3RF1A 1ZBE2 2P3KA 3LGRA 1WW6A 2MEV2 3AA0B 3NL1A 3UT5E 4AKRB 3NG2A 4XJWA 2RA1A 5AQUB 1VBB3 1VOMA 2X5IB 5TRBA 4YVWA 3VBUC 1Q56A 2ZTNA 4CCCA 4OULA 2ZGSA 3RLFF 1HS7A 3E97A 3A0KA 3RX6A