1WILA

Solution structure of the ring finger domain of the human kiaa1045 protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
89
structure length
89
Chain Sequence
GSSGSSGPREPVVNDEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTEMAHTETGWSCHYCDNINLLLTEESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords KIAA1045 protein
publication title Solution Structure of the RING Finger Domain of the Human KIAA1045 Protein
rcsb
source organism Homo sapiens
total genus 4
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16744 Zf_RING KIAA1045 RING finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wilA00
2FUUA 2QICA 4LKAA 4GNGA 2BAYA 4I7BA 3KV5A 3L1XA 3EB5A 4GNDA 3T6RA 2YUCA 1FBVA 2YREA 4AYCA 3ZNIA 3NG2A 3RPGB 1WEVA 5KH9A 5FB0A 2KE1A 4A4CA 5H1VA 5D1LB 2JMJA 5FB1A 1WEEA 2JMDA 3U5MA 2FSAA 4GNEA 2KREA 4YBMA 5H1UA 1WEQA 2VNFA 3SHBA 4ZUXU 2MNYA 4R7EA 2KR4A 5G0FA 2RI7A 3PURA 4XI1A 3PUQA 3SOUA 1BORA 2CSYA 4GNFA 5KH7A 2EA6A 3GV4A 2YSJA 1X4JA 3LQHA 3T7LA 1N87A 4WZ0A 4YBTA 2LGLA 2RSDA 1JOCA 1WEOA 3O36A 2KWNA 2VPDA 5LKXA 1RMDA 2YU4A 4L58A 1WESA 1G25A 5AIUA 3N9NA 2LN0A 5H1TA 2F6NA 2KU3A 3DPLR 1XWHA 2C2LA 1WEMA 4PTBA 2VPBA 4B7YC 2HYED 3KNVA 2G6QA 4LADB 1X4UA 5I3LA 4L7XA 4O64A 5LCWB 1WFKA 4IC2A 2K1JA 3O70A 3GL6A 4A4BA 5B77A 4YAXA 2OXQC 5LKZA 4W4UA 3N9OA 2M6MA 2KIZA 2YYRA 4V3KC 2YSMA 2KGIA 3HCTA 5B75A 3C5KA 4BBQA 1HYJA 4AYCB 1MM2A 4YC9A 2LRIC 2LXPC 3HCUA 4S3OB 2JRJA 3KV6A 2LGVA 1K2FA 2VP7A 1HYIA 2G43A 1VD4A 5B78A 4MVTA 4N3WA 4YABA 4UP0A 3KQIA 2KFTA 4F52B 4FK5A 1LDJB 5DKAA 3ZYQA 4UP5A 1VFYA 4WZ2A 1WGMA 2CKLB 2VPEA 3L11A 2CSZA 2MUMA 1WIMA 2G45A 2M3HA 2YHNA 1WILA 3C6WA 3QZVA 3O34A 3ZVYA 5G04B 4WZ3B 5G05B 1Z60A 3FL2A 4R8PK 5TBNA 3V43A 2ECVA 1MM3A 4B86C 3VK6A 4BHWA 1E4UA 1FP0A 1DVPA 2XB1A 4QF3A 2VJFA 4FIPA 5C11A 1WEPA 4QF2A 2LXHC 4S3OC 2H0DB 2MD8C 2L5UA 2KWOA 4A0CD 4YATA 1WENA 1ZBDB 5TABA 3SOWA 3I2DA 4V3LC 5DINA 1JM7B 2UZGA 1Z6UA 5H9MA 4C9ZA 2VJEA 3N9MA 3M63A 3LQJA 3PHDA 3MHHA 2AN6A 1LDKC 5B79A 4LLBA 4A49A 2ECTA 2KYUA 4GB0A 1WEUA 1WE9A 5FEYA 2FUIA 4N4FA 3M99A 2L75A 2YW8A 2L80A 5LKTA 4PPEA 4FO9A 2MNZA 5TRBA 2QJ0A 2JMIA 2NAAA 2VPGA 4ZDTA 2L0BA 4YADA 5KH3A 2Y1NA 5EYAF 2IDAA 4CCGX 2M1RA 2XEUA 4LJNA 3N9QA 2QIZA 3ZPV1 3RTRB 3IHPA 2EODA 4UI9B 2LV9A 3DQVR 3HCSA 2PNXA 2F42A 2ZETC 3EB6A 4R2YA 2L43A 2E6RA 4X3GA 2ECJA 2PUYA 5JG6A 1VYXA 3ZTGA 5FERA 2YQLA 3LRQA 5AITA 5TDWA 4AVXA 5B76A 1V87A 1T1HA 4I7DA 4Q6FA 2YQMA 3L1ZB 2MD7B 2VJFB 2MA5A 4P5OB 2LDRA 3SOXA 4WA6A 4FJCA 2F6JA 2MA6A 2MIQA 4AUQB 2ECWA 2ECNA 3ZPVE 4LK9A 2YT5A 2ECIA 2CKLA 3U5NA 2HDPA 2ECGA 1Z2QA 3MHSA 3HTKC 2E6SA 2EGPA 2VJEB 3ASLA 5D1KB 2LGGA 2KGGA 4NN2A 3O7AA 4CA1A 1X4IA 3N9PA 3O35A 5LKUA 2LGKA 2KWKA 2YHOA 3LQIA 5D1MB 5C13A 3RPGC 2M85A 1IYMA 2H0DA 2MT5A 3M62A 3O33A 2Y1MA 4I7CA 2CT2A 2I50A 4YBSA 2K17A 5J3XA 1CHCA 2Y43A 3ZVZB 2YURA 2KWJA 5TDRA 4ZQLA 1JM7A 3O37A 3N9LA 3U5PA 2C2VS 4TKPB 1WEWA 2K4DA 1F62A 1U6GB 4MSXA 2K16A 3U5OA 2DX8A 4AP4A 2LQ6A 2D8SA 4IC3A 5B8DA
chains in the Genus database with same CATH superfamily
2FUUA 5SVIB 2QICA 4LKAA 4GNGA 2BAYA 4I7BA 3KV5A 3L1XA 3EB5A 4GNDA 3T6RA 2YUCA 1FBVA 2YREA 4AYCA 3ZNIA 3NG2A 3RPGB 1WEVA 4OGCA 5KH9A 2MKEA 5FB0A 2KE1A 2IQJA 4A4CA 5H1VA 5D1LB 2JMJA 5FB1A 3FM8C 1WEEA 2JMDA 3U5MA 2KKYA 3JUEA 2FSAA 4GNEA 2JUNA 2KREA 4YBMA 3LJUX 5H1UA 2M13A 1WEQA 2VNFA 3SHBA 2DJAA 3FANA 4ZUXU 2MNYA 2DSMA 4R7EA 2YVRA 2KR4A 5G0FA 2RI7A 3PURA 4XI1A 3PUQA 3SOUA 1BORA 2CRRA 2CSYA 4GNFA 5KH7A 2EA6A 3GV4A 2YSJA 1X4JA 3LQHA 3T7LA 1N87A 4WZ0A 4YBTA 2LGLA 2RSDA 1JOCA 1MBMA 2XP0A 1WEOA 1DCQA 3O36A 2KWNA 2VPDA 5LKXA 1RMDA 2YU4A 4L58A 1WESA 1G25A 5AIUA 3N9NA 2LN0A 2OWAA 5H1TA 2F6NA 2KU3A 3DPLR 1XWHA 2C2LA 1WEMA 4PTBA 2VPBA 4B7YC 2HYED 3KNVA 2G6QA 4LADB 1X4UA 5I3LA 4L7XA 4O64A 5LCWB 1WFKA 4IC2A 2K1JA 3O70A 2L7PA 3GL6A 4A4BA 5B77A 2CSVA 4YAXA 2OXQC 5LKZA 4W4UA 3N9OA 2M6MA 2KIZA 2YYRA 4V3KC 2YSMA 2KGIA 2KKXA 3HCTA 5B75A 3C5KA 4BBQA 1HYJA 4AYCB 1MM2A 4YC9A 2LRIC 2LXPC 3HCUA 4S3OB 2JRJA 3M7KA 3KV6A 2LGVA 2CRWA 1K2FA 3LVRE 2VP7A 1HYIA 2G43A 1VD4A 2LAUA 5B78A 4MVTA 4N3WA 4YABA 4UP0A 3KQIA 2KFTA 4F52B 4FK5A 1LDJB 5DKAA 3ZYQA 4UP5A 1VFYA 4WZ2A 1WGMA 2CKLB 2VPEA 3L11A 3KDEC 2CSZA 2MUMA 1WIMA 2G45A 2M3HA 2YHNA 1WILA 3C6WA 3QZVA 3O34A 3ZVYA 5G04B 4WZ3B 5G05B 5SVYA 1Z60A 3FL2A 4R8PK 5TBNA 3Q1DA 2ECVA 3V43A 1MM3A 4B86C 3VK6A 3FJUB 4BHWA 1E4UA 1FP0A 1DVPA 5K3QA 2XB1A 4QF3A 2VJFA 4FIPA 5C11A 1WEPA 4QF2A 2LXHC 4S3OC 2H0DB 2MD8C 2L5UA 2KWOA 4A0CD 4YATA 1WENA 1ZBDB 5TABA 3SOWA 3I2DA 4V3LC 5DINA 1JM7B 2UZGA 1Z6UA 2D8UA 2E61A 5H9MA 4C9ZA 2VJEA 2CONA 3N9MA 3M63A 3LQJA 3H7HA 3PHDA 3DDTA 3MHHA 2AN6A 1LDKC 2B0OE 5B79A 4LLBA 4O62A 4A49A 2ECTA 2KYUA 4GB0A 1WEUA 1WE9A 5FEYA 2FUIA 4N4FA 3M99A 2XOZA 2L75A 2YW8A 2L80A 5LKTA 2FD4A 4PPEA 4F1PA 4FO9A 2MNZA 5TRBA 2QJ0A 2JMIA 2NAAA 2VPGA 3FEHA 4ZDTA 2L0BA 4YADA 5KH3A 2Y1NA 5EYAF 2IDAA 3SUBA 4CCGX 2M1RA 2XEUA 4LJNA 3N9QA 2QIZA 3ZPV1 3RTRB 3IHPA 2EGMA 2EODA 4UI9B 2LV9A 3DQVR 3HCSA 2PNXA 2F42A 2ZETC 2P57A 3T9KA 4OGEA 3EB6A 4R2YA 2XOCA 5SVIA 2L43A 2E6RA 4X3GA 3MDBC 2ECJA 2PUYA 5JG6A 1VYXA 3ZTGA 5FERA 2YQLA 3LRQA 5AITA 5TDWA 2JM3A 4AVXA 5B76A 1V87A 1T1HA 4I7DA 4Q6FA 2YQMA 4Z0RA 3L1ZB 2MD7B 2VJFB 2MA5A 4P5OB 2LDRA 3SOXA 4WA6A 4FJCA 2F6JA 2MA6A 2MIQA 4AUQB 2ECWA 2ECNA 3ZPVE 4LK9A 2YT5A 2ECIA 2CKLA 3U5NA 2RR4A 2HDPA 3PLWA 2ECGA 1Z2QA 3MHSA 3HTKC 2EXUA 2E6SA 2EGPA 2VJEB 3ASLA 5D1KB 2LGGA 2KGGA 4NN2A 3O7AA 4CA1A 1X4IA 3LVQE 3N9PA 3O35A 5LKUA 2LGKA 2KWKA 2YHOA 4H9DA 3LQIA 3FAOA 4QQ4A 5D1MB 3DWDA 5C13A 3RPGC 2M85A 1IYMA 2H0DA 2MT5A 3M62A 3O33A 3E2DA 2Y1MA 4I7CA 2CT2A 2I50A 4YBSA 2K17A 5J3XA 1CHCA 2Y43A 3ZVZB 2YURA 2KWJA 5TDRA 4ZQLA 3LDYA 1JM7A 3O37A 3N9LA 3U5PA 2C2VS 4TKPB 1WEWA 2K4DA 1F62A 2FFWA 5SVXA 1U6GB 4MSXA 2K16A 3U5OA 2DX8A 4AP4A 2LQ6A 2D8SA 4Z0OA 2XOYA 3O47A 4IC3A 5B8DA
chains in the Genus database with same CATH topology
2FUUA 2QICA 4LKAA 4GNGA 2BAYA 4I7BA 3KV5A 3L1XA 3EB5A 4GNDA 3T6RA 2YUCA 1FBVA 2YREA 4AYCA 3ZNIA 3NG2A 3RPGB 1WEVA 5KH9A 5FB0A 2KE1A 4A4CA 5H1VA 5D1LB 2JMJA 5FB1A 1WEEA 2JMDA 3U5MA 2FSAA 4GNEA 2KREA 4YBMA 5H1UA 1WEQA 2VNFA 3SHBA 4ZUXU 2MNYA 4R7EA 2KR4A 5G0FA 2RI7A 3PURA 4XI1A 3PUQA 3SOUA 1BORA 2CSYA 4GNFA 5KH7A 2EA6A 3GV4A 2YSJA 1X4JA 3LQHA 3T7LA 1N87A 4WZ0A 4YBTA 2LGLA 2RSDA 1JOCA 1WEOA 3O36A 2KWNA 2VPDA 5LKXA 1RMDA 2YU4A 4L58A 1WESA 1G25A 5AIUA 3N9NA 2LN0A 5H1TA 2F6NA 2KU3A 3DPLR 1XWHA 2C2LA 1WEMA 4PTBA 2VPBA 4B7YC 2HYED 3KNVA 2G6QA 4LADB 1X4UA 5I3LA 4L7XA 4O64A 5LCWB 1WFKA 4IC2A 2K1JA 3O70A 3GL6A 4A4BA 5B77A 4YAXA 2OXQC 5LKZA 4W4UA 3N9OA 2M6MA 2KIZA 2YYRA 4V3KC 2YSMA 2KGIA 3HCTA 5B75A 3C5KA 4BBQA 1HYJA 4AYCB 1MM2A 4YC9A 2LRIC 2LXPC 3HCUA 4S3OB 2JRJA 3KV6A 2LGVA 1K2FA 2VP7A 1HYIA 2G43A 1VD4A 5B78A 4MVTA 4N3WA 4YABA 4UP0A 3KQIA 2KFTA 4F52B 4FK5A 1LDJB 5DKAA 3ZYQA 4UP5A 1VFYA 4WZ2A 1WGMA 2CKLB 2VPEA 3L11A 2CSZA 2MUMA 1WIMA 2G45A 2M3HA 2YHNA 1WILA 3C6WA 3QZVA 3O34A 3ZVYA 5G04B 4WZ3B 5G05B 1Z60A 3FL2A 4R8PK 5TBNA 3V43A 2ECVA 1MM3A 4B86C 3VK6A 4BHWA 1E4UA 1FP0A 1DVPA 2XB1A 4QF3A 2VJFA 4FIPA 5C11A 1WEPA 4QF2A 2LXHC 4S3OC 2H0DB 2MD8C 2L5UA 2KWOA 4A0CD 4YATA 1WENA 1ZBDB 5TABA 3SOWA 3I2DA 4V3LC 5DINA 1JM7B 2UZGA 1Z6UA 5H9MA 4C9ZA 2VJEA 3N9MA 3M63A 3LQJA 3PHDA 3MHHA 2AN6A 1LDKC 5B79A 4LLBA 4A49A 2ECTA 2KYUA 4GB0A 1WEUA 1WE9A 5FEYA 2FUIA 4N4FA 3M99A 2L75A 2YW8A 2L80A 5LKTA 4PPEA 4FO9A 2MNZA 5TRBA 2QJ0A 2JMIA 2NAAA 2VPGA 4ZDTA 2L0BA 4YADA 5KH3A 2Y1NA 5EYAF 2IDAA 4CCGX 2M1RA 2XEUA 4LJNA 3N9QA 2QIZA 3ZPV1 3RTRB 3IHPA 2EODA 4UI9B 2LV9A 3DQVR 3HCSA 2PNXA 2F42A 2ZETC 3EB6A 4R2YA 2L43A 2E6RA 4X3GA 2ECJA 2PUYA 5JG6A 1VYXA 3ZTGA 5FERA 2YQLA 3LRQA 5AITA 5TDWA 4AVXA 5B76A 1V87A 1T1HA 4I7DA 4Q6FA 2YQMA 3L1ZB 2MD7B 2VJFB 2MA5A 4P5OB 2LDRA 3SOXA 4WA6A 4FJCA 2F6JA 2MA6A 2MIQA 4AUQB 2ECWA 2ECNA 3ZPVE 4LK9A 2YT5A 2ECIA 2CKLA 3U5NA 2HDPA 2ECGA 1Z2QA 3MHSA 3HTKC 2E6SA 2EGPA 2VJEB 3ASLA 5D1KB 2LGGA 2KGGA 4NN2A 3O7AA 4CA1A 1X4IA 3N9PA 3O35A 5LKUA 2LGKA 2KWKA 2YHOA 3LQIA 5D1MB 5C13A 3RPGC 2M85A 1IYMA 2H0DA 2MT5A 3M62A 3O33A 2Y1MA 4I7CA 2CT2A 2I50A 4YBSA 2K17A 5J3XA 1CHCA 2Y43A 3ZVZB 2YURA 2KWJA 5TDRA 4ZQLA 1JM7A 3O37A 3N9LA 3U5PA 2C2VS 4TKPB 1WEWA 2K4DA 1F62A 1U6GB 4MSXA 2K16A 3U5OA 2DX8A 4AP4A 2LQ6A 2D8SA 4IC3A 5B8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUU A;  2QIC A;  4LKA A;  4GNG A;  2BAY A;  4I7B A;  3KV5 A;  3L1X A;  3EB5 A;  4GND A;  3T6R A;  2YUC A;  1FBV A;  2YRE A;  4AYC A;  3ZNI A;  3NG2 A;  3RPG B;  1WEV A;  5KH9 A;  5FB0 A;  2KE1 A;  4A4C A;  5H1V A;  5D1L B;  2JMJ A;  5FB1 A;  1WEE A;  2JMD A;  3U5M A;  2FSA A;  4GNE A;  2KRE A;  4YBM A;  5H1U A;  1WEQ A;  2VNF A;  3SHB A;  4ZUX U;  2MNY A;  4R7E A;  2KR4 A;  5G0F A;  2RI7 A;  3PUR A;  4XI1 A;  3PUQ A;  3SOU A;  1BOR A;  2CSY A;  4GNF A;  5KH7 A;  2EA6 A;  3GV4 A;  2YSJ A;  1X4J A;  3LQH A;  3T7L A;  1N87 A;  4WZ0 A;  4YBT A;  2LGL A;  2RSD A;  1JOC A;  1WEO A;  3O36 A;  2KWN A;  2VPD A;  5LKX A;  1RMD A;  2YU4 A;  4L58 A;  1WES A;  1G25 A;  5AIU A;  3N9N A;  2LN0 A;  5H1T A;  2F6N A;  2KU3 A;  3DPL R;  1XWH A;  2C2L A;  1WEM A;  4PTB A;  2VPB A;  4B7Y C;  2HYE D;  3KNV A;  2G6Q A;  4LAD B;  1X4U A;  5I3L A;  4L7X A;  4O64 A;  5LCW B;  1WFK A;  4IC2 A;  2K1J A;  3O70 A;  3GL6 A;  4A4B A;  5B77 A;  4YAX A;  2OXQ C;  5LKZ A;  4W4U A;  3N9O A;  2M6M A;  2KIZ A;  2YYR A;  4V3K C;  2YSM A;  2KGI A;  3HCT A;  5B75 A;  3C5K A;  4BBQ A;  1HYJ A;  4AYC B;  1MM2 A;  4YC9 A;  2LRI C;  2LXP C;  3HCU A;  4S3O B;  2JRJ A;  3KV6 A;  2LGV A;  1K2F A;  2VP7 A;  1HYI A;  2G43 A;  1VD4 A;  5B78 A;  4MVT A;  4N3W A;  4YAB A;  4UP0 A;  3KQI A;  2KFT A;  4F52 B;  4FK5 A;  1LDJ B;  5DKA A;  3ZYQ A;  4UP5 A;  1VFY A;  4WZ2 A;  1WGM A;  2CKL B;  2VPE A;  3L11 A;  2CSZ A;  2MUM A;  1WIM A;  2G45 A;  2M3H A;  2YHN A;  1WIL A;  3C6W A;  3QZV A;  3O34 A;  3ZVY A;  5G04 B;  4WZ3 B;  5G05 B;  1Z60 A;  3FL2 A;  4R8P K;  5TBN A;  3V43 A;  2ECV A;  1MM3 A;  4B86 C;  3VK6 A;  4BHW A;  1E4U A;  1FP0 A;  1DVP A;  2XB1 A;  4QF3 A;  2VJF A;  4FIP A;  5C11 A;  1WEP A;  4QF2 A;  2LXH C;  4S3O C;  2H0D B;  2MD8 C;  2L5U A;  2KWO A;  4A0C D;  4YAT A;  1WEN A;  1ZBD B;  5TAB A;  3SOW A;  3I2D A;  4V3L C;  5DIN A;  1JM7 B;  2UZG A;  1Z6U A;  5H9M A;  4C9Z A;  2VJE A;  3N9M A;  3M63 A;  3LQJ A;  3PHD A;  3MHH A;  2AN6 A;  1LDK C;  5B79 A;  4LLB A;  4A49 A;  2ECT A;  2KYU A;  4GB0 A;  1WEU A;  1WE9 A;  5FEY A;  2FUI A;  4N4F A;  3M99 A;  2L75 A;  2YW8 A;  2L80 A;  5LKT A;  4PPE A;  4FO9 A;  2MNZ A;  5TRB A;  2QJ0 A;  2JMI A;  2NAA A;  2VPG A;  4ZDT A;  2L0B A;  4YAD A;  5KH3 A;  2Y1N A;  5EYA F;  2IDA A;  4CCG X;  2M1R A;  2XEU A;  4LJN A;  3N9Q A;  2QIZ A;  3ZPV 1;  3RTR B;  3IHP A;  2EOD A;  4UI9 B;  2LV9 A;  3DQV R;  3HCS A;  2PNX A;  2F42 A;  2ZET C;  3EB6 A;  4R2Y A;  2L43 A;  2E6R A;  4X3G A;  2ECJ A;  2PUY A;  5JG6 A;  1VYX A;  3ZTG A;  5FER A;  2YQL A;  3LRQ A;  5AIT A;  5TDW A;  4AVX A;  5B76 A;  1V87 A;  1T1H A;  4I7D A;  4Q6F A;  2YQM A;  3L1Z B;  2MD7 B;  2VJF B;  2MA5 A;  4P5O B;  2LDR A;  3SOX A;  4WA6 A;  4FJC A;  2F6J A;  2MA6 A;  2MIQ A;  4AUQ B;  2ECW A;  2ECN A;  3ZPV E;  4LK9 A;  2YT5 A;  2ECI A;  2CKL A;  3U5N A;  2HDP A;  2ECG A;  1Z2Q A;  3MHS A;  3HTK C;  2E6S A;  2EGP A;  2VJE B;  3ASL A;  5D1K B;  2LGG A;  2KGG A;  4NN2 A;  3O7A A;  4CA1 A;  1X4I A;  3N9P A;  3O35 A;  5LKU A;  2LGK A;  2KWK A;  2YHO A;  3LQI A;  5D1M B;  5C13 A;  3RPG C;  2M85 A;  1IYM A;  2H0D A;  2MT5 A;  3M62 A;  3O33 A;  2Y1M A;  4I7C A;  2CT2 A;  2I50 A;  4YBS A;  2K17 A;  5J3X A;  1CHC A;  2Y43 A;  3ZVZ B;  2YUR A;  2KWJ A;  5TDR A;  4ZQL A;  1JM7 A;  3O37 A;  3N9L A;  3U5P A;  2C2V S;  4TKP B;  1WEW A;  2K4D A;  1F62 A;  1U6G B;  4MSX A;  2K16 A;  3U5O A;  2DX8 A;  4AP4 A;  2LQ6 A;  2D8S A;  4IC3 A;  5B8D A; 
#chains in the Genus database with same CATH topology
 2FUU A;  5SVI B;  2QIC A;  4LKA A;  4GNG A;  2BAY A;  4I7B A;  3KV5 A;  3L1X A;  3EB5 A;  4GND A;  3T6R A;  2YUC A;  1FBV A;  2YRE A;  4AYC A;  3ZNI A;  3NG2 A;  3RPG B;  1WEV A;  4OGC A;  5KH9 A;  2MKE A;  5FB0 A;  2KE1 A;  2IQJ A;  4A4C A;  5H1V A;  5D1L B;  2JMJ A;  5FB1 A;  3FM8 C;  1WEE A;  2JMD A;  3U5M A;  2KKY A;  3JUE A;  2FSA A;  4GNE A;  2JUN A;  2KRE A;  4YBM A;  3LJU X;  5H1U A;  2M13 A;  1WEQ A;  2VNF A;  3SHB A;  2DJA A;  3FAN A;  4ZUX U;  2MNY A;  2DSM A;  4R7E A;  2YVR A;  2KR4 A;  5G0F A;  2RI7 A;  3PUR A;  4XI1 A;  3PUQ A;  3SOU A;  1BOR A;  2CRR A;  2CSY A;  4GNF A;  5KH7 A;  2EA6 A;  3GV4 A;  2YSJ A;  1X4J A;  3LQH A;  3T7L A;  1N87 A;  4WZ0 A;  4YBT A;  2LGL A;  2RSD A;  1JOC A;  1MBM A;  2XP0 A;  1WEO A;  1DCQ A;  3O36 A;  2KWN A;  2VPD A;  5LKX A;  1RMD A;  2YU4 A;  4L58 A;  1WES A;  1G25 A;  5AIU A;  3N9N A;  2LN0 A;  2OWA A;  5H1T A;  2F6N A;  2KU3 A;  3DPL R;  1XWH A;  2C2L A;  1WEM A;  4PTB A;  2VPB A;  4B7Y C;  2HYE D;  3KNV A;  2G6Q A;  4LAD B;  1X4U A;  5I3L A;  4L7X A;  4O64 A;  5LCW B;  1WFK A;  4IC2 A;  2K1J A;  3O70 A;  2L7P A;  3GL6 A;  4A4B A;  5B77 A;  2CSV A;  4YAX A;  2OXQ C;  5LKZ A;  4W4U A;  3N9O A;  2M6M A;  2KIZ A;  2YYR A;  4V3K C;  2YSM A;  2KGI A;  2KKX A;  3HCT A;  5B75 A;  3C5K A;  4BBQ A;  1HYJ A;  4AYC B;  1MM2 A;  4YC9 A;  2LRI C;  2LXP C;  3HCU A;  4S3O B;  2JRJ A;  3M7K A;  3KV6 A;  2LGV A;  2CRW A;  1K2F A;  3LVR E;  2VP7 A;  1HYI A;  2G43 A;  1VD4 A;  2LAU A;  5B78 A;  4MVT A;  4N3W A;  4YAB A;  4UP0 A;  3KQI A;  2KFT A;  4F52 B;  4FK5 A;  1LDJ B;  5DKA A;  3ZYQ A;  4UP5 A;  1VFY A;  4WZ2 A;  1WGM A;  2CKL B;  2VPE A;  3L11 A;  3KDE C;  2CSZ A;  2MUM A;  1WIM A;  2G45 A;  2M3H A;  2YHN A;  1WIL A;  3C6W A;  3QZV A;  3O34 A;  3ZVY A;  5G04 B;  4WZ3 B;  5G05 B;  5SVY A;  1Z60 A;  3FL2 A;  4R8P K;  5TBN A;  3Q1D A;  2ECV A;  3V43 A;  1MM3 A;  4B86 C;  3VK6 A;  3FJU B;  4BHW A;  1E4U A;  1FP0 A;  1DVP A;  5K3Q A;  2XB1 A;  4QF3 A;  2VJF A;  4FIP A;  5C11 A;  1WEP A;  4QF2 A;  2LXH C;  4S3O C;  2H0D B;  2MD8 C;  2L5U A;  2KWO A;  4A0C D;  4YAT A;  1WEN A;  1ZBD B;  5TAB A;  3SOW A;  3I2D A;  4V3L C;  5DIN A;  1JM7 B;  2UZG A;  1Z6U A;  2D8U A;  2E61 A;  5H9M A;  4C9Z A;  2VJE A;  2CON A;  3N9M A;  3M63 A;  3LQJ A;  3H7H A;  3PHD A;  3DDT A;  3MHH A;  2AN6 A;  1LDK C;  2B0O E;  5B79 A;  4LLB A;  4O62 A;  4A49 A;  2ECT A;  2KYU A;  4GB0 A;  1WEU A;  1WE9 A;  5FEY A;  2FUI A;  4N4F A;  3M99 A;  2XOZ A;  2L75 A;  2YW8 A;  2L80 A;  5LKT A;  2FD4 A;  4PPE A;  4F1P A;  4FO9 A;  2MNZ A;  5TRB A;  2QJ0 A;  2JMI A;  2NAA A;  2VPG A;  3FEH A;  4ZDT A;  2L0B A;  4YAD A;  5KH3 A;  2Y1N A;  5EYA F;  2IDA A;  3SUB A;  4CCG X;  2M1R A;  2XEU A;  4LJN A;  3N9Q A;  2QIZ A;  3ZPV 1;  3RTR B;  3IHP A;  2EGM A;  2EOD A;  4UI9 B;  2LV9 A;  3DQV R;  3HCS A;  2PNX A;  2F42 A;  2ZET C;  2P57 A;  3T9K A;  4OGE A;  3EB6 A;  4R2Y A;  2XOC A;  5SVI A;  2L43 A;  2E6R A;  4X3G A;  3MDB C;  2ECJ A;  2PUY A;  5JG6 A;  1VYX A;  3ZTG A;  5FER A;  2YQL A;  3LRQ A;  5AIT A;  5TDW A;  2JM3 A;  4AVX A;  5B76 A;  1V87 A;  1T1H A;  4I7D A;  4Q6F A;  2YQM A;  4Z0R A;  3L1Z B;  2MD7 B;  2VJF B;  2MA5 A;  4P5O B;  2LDR A;  3SOX A;  4WA6 A;  4FJC A;  2F6J A;  2MA6 A;  2MIQ A;  4AUQ B;  2ECW A;  2ECN A;  3ZPV E;  4LK9 A;  2YT5 A;  2ECI A;  2CKL A;  3U5N A;  2RR4 A;  2HDP A;  3PLW A;  2ECG A;  1Z2Q A;  3MHS A;  3HTK C;  2EXU A;  2E6S A;  2EGP A;  2VJE B;  3ASL A;  5D1K B;  2LGG A;  2KGG A;  4NN2 A;  3O7A A;  4CA1 A;  1X4I A;  3LVQ E;  3N9P A;  3O35 A;  5LKU A;  2LGK A;  2KWK A;  2YHO A;  4H9D A;  3LQI A;  3FAO A;  4QQ4 A;  5D1M B;  3DWD A;  5C13 A;  3RPG C;  2M85 A;  1IYM A;  2H0D A;  2MT5 A;  3M62 A;  3O33 A;  3E2D A;  2Y1M A;  4I7C A;  2CT2 A;  2I50 A;  4YBS A;  2K17 A;  5J3X A;  1CHC A;  2Y43 A;  3ZVZ B;  2YUR A;  2KWJ A;  5TDR A;  4ZQL A;  3LDY A;  1JM7 A;  3O37 A;  3N9L A;  3U5P A;  2C2V S;  4TKP B;  1WEW A;  2K4D A;  1F62 A;  2FFW A;  5SVX A;  1U6G B;  4MSX A;  2K16 A;  3U5O A;  2DX8 A;  4AP4 A;  2LQ6 A;  2D8S A;  4Z0O A;  2XOY A;  3O47 A;  4IC3 A;  5B8D A; 
#chains in the Genus database with same CATH homology
 2FUU A;  2QIC A;  4LKA A;  4GNG A;  2BAY A;  4I7B A;  3KV5 A;  3L1X A;  3EB5 A;  4GND A;  3T6R A;  2YUC A;  1FBV A;  2YRE A;  4AYC A;  3ZNI A;  3NG2 A;  3RPG B;  1WEV A;  5KH9 A;  5FB0 A;  2KE1 A;  4A4C A;  5H1V A;  5D1L B;  2JMJ A;  5FB1 A;  1WEE A;  2JMD A;  3U5M A;  2FSA A;  4GNE A;  2KRE A;  4YBM A;  5H1U A;  1WEQ A;  2VNF A;  3SHB A;  4ZUX U;  2MNY A;  4R7E A;  2KR4 A;  5G0F A;  2RI7 A;  3PUR A;  4XI1 A;  3PUQ A;  3SOU A;  1BOR A;  2CSY A;  4GNF A;  5KH7 A;  2EA6 A;  3GV4 A;  2YSJ A;  1X4J A;  3LQH A;  3T7L A;  1N87 A;  4WZ0 A;  4YBT A;  2LGL A;  2RSD A;  1JOC A;  1WEO A;  3O36 A;  2KWN A;  2VPD A;  5LKX A;  1RMD A;  2YU4 A;  4L58 A;  1WES A;  1G25 A;  5AIU A;  3N9N A;  2LN0 A;  5H1T A;  2F6N A;  2KU3 A;  3DPL R;  1XWH A;  2C2L A;  1WEM A;  4PTB A;  2VPB A;  4B7Y C;  2HYE D;  3KNV A;  2G6Q A;  4LAD B;  1X4U A;  5I3L A;  4L7X A;  4O64 A;  5LCW B;  1WFK A;  4IC2 A;  2K1J A;  3O70 A;  3GL6 A;  4A4B A;  5B77 A;  4YAX A;  2OXQ C;  5LKZ A;  4W4U A;  3N9O A;  2M6M A;  2KIZ A;  2YYR A;  4V3K C;  2YSM A;  2KGI A;  3HCT A;  5B75 A;  3C5K A;  4BBQ A;  1HYJ A;  4AYC B;  1MM2 A;  4YC9 A;  2LRI C;  2LXP C;  3HCU A;  4S3O B;  2JRJ A;  3KV6 A;  2LGV A;  1K2F A;  2VP7 A;  1HYI A;  2G43 A;  1VD4 A;  5B78 A;  4MVT A;  4N3W A;  4YAB A;  4UP0 A;  3KQI A;  2KFT A;  4F52 B;  4FK5 A;  1LDJ B;  5DKA A;  3ZYQ A;  4UP5 A;  1VFY A;  4WZ2 A;  1WGM A;  2CKL B;  2VPE A;  3L11 A;  2CSZ A;  2MUM A;  1WIM A;  2G45 A;  2M3H A;  2YHN A;  1WIL A;  3C6W A;  3QZV A;  3O34 A;  3ZVY A;  5G04 B;  4WZ3 B;  5G05 B;  1Z60 A;  3FL2 A;  4R8P K;  5TBN A;  3V43 A;  2ECV A;  1MM3 A;  4B86 C;  3VK6 A;  4BHW A;  1E4U A;  1FP0 A;  1DVP A;  2XB1 A;  4QF3 A;  2VJF A;  4FIP A;  5C11 A;  1WEP A;  4QF2 A;  2LXH C;  4S3O C;  2H0D B;  2MD8 C;  2L5U A;  2KWO A;  4A0C D;  4YAT A;  1WEN A;  1ZBD B;  5TAB A;  3SOW A;  3I2D A;  4V3L C;  5DIN A;  1JM7 B;  2UZG A;  1Z6U A;  5H9M A;  4C9Z A;  2VJE A;  3N9M A;  3M63 A;  3LQJ A;  3PHD A;  3MHH A;  2AN6 A;  1LDK C;  5B79 A;  4LLB A;  4A49 A;  2ECT A;  2KYU A;  4GB0 A;  1WEU A;  1WE9 A;  5FEY A;  2FUI A;  4N4F A;  3M99 A;  2L75 A;  2YW8 A;  2L80 A;  5LKT A;  4PPE A;  4FO9 A;  2MNZ A;  5TRB A;  2QJ0 A;  2JMI A;  2NAA A;  2VPG A;  4ZDT A;  2L0B A;  4YAD A;  5KH3 A;  2Y1N A;  5EYA F;  2IDA A;  4CCG X;  2M1R A;  2XEU A;  4LJN A;  3N9Q A;  2QIZ A;  3ZPV 1;  3RTR B;  3IHP A;  2EOD A;  4UI9 B;  2LV9 A;  3DQV R;  3HCS A;  2PNX A;  2F42 A;  2ZET C;  3EB6 A;  4R2Y A;  2L43 A;  2E6R A;  4X3G A;  2ECJ A;  2PUY A;  5JG6 A;  1VYX A;  3ZTG A;  5FER A;  2YQL A;  3LRQ A;  5AIT A;  5TDW A;  4AVX A;  5B76 A;  1V87 A;  1T1H A;  4I7D A;  4Q6F A;  2YQM A;  3L1Z B;  2MD7 B;  2VJF B;  2MA5 A;  4P5O B;  2LDR A;  3SOX A;  4WA6 A;  4FJC A;  2F6J A;  2MA6 A;  2MIQ A;  4AUQ B;  2ECW A;  2ECN A;  3ZPV E;  4LK9 A;  2YT5 A;  2ECI A;  2CKL A;  3U5N A;  2HDP A;  2ECG A;  1Z2Q A;  3MHS A;  3HTK C;  2E6S A;  2EGP A;  2VJE B;  3ASL A;  5D1K B;  2LGG A;  2KGG A;  4NN2 A;  3O7A A;  4CA1 A;  1X4I A;  3N9P A;  3O35 A;  5LKU A;  2LGK A;  2KWK A;  2YHO A;  3LQI A;  5D1M B;  5C13 A;  3RPG C;  2M85 A;  1IYM A;  2H0D A;  2MT5 A;  3M62 A;  3O33 A;  2Y1M A;  4I7C A;  2CT2 A;  2I50 A;  4YBS A;  2K17 A;  5J3X A;  1CHC A;  2Y43 A;  3ZVZ B;  2YUR A;  2KWJ A;  5TDR A;  4ZQL A;  1JM7 A;  3O37 A;  3N9L A;  3U5P A;  2C2V S;  4TKP B;  1WEW A;  2K4D A;  1F62 A;  1U6G B;  4MSX A;  2K16 A;  3U5O A;  2DX8 A;  4AP4 A;  2LQ6 A;  2D8S A;  4IC3 A;  5B8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...