1WILA

Solution structure of the ring finger domain of the human kiaa1045 protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
89
structure length
89
Chain Sequence
GSSGSSGPREPVVNDEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTEMAHTETGWSCHYCDNINLLLTEESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1045 protein
publication title Solution Structure of the RING Finger Domain of the Human KIAA1045 Protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 4
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16744 Zf_RING KIAA1045 RING finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wilA00
2L80A 5EYAF 1WEEA 1WFKA 2G6QA 3O7AA 2LV9A 3HCUA 1XWHA 5H1TA 3M63A 3KV6A 5KH7A 5TRBA 4A4BA 4BHWA 4I7DA 2KWNA 2ECVA 3L11A 3FL2A 3KQIA 2LXPC 2MNYA 1HYIA 3RPGB 3ZNIA 3EB5A 4AYCA 2YYRA 2LQ6A 4PTBA 2KIZA 1WE9A 5B78A 5B77A 2LGKA 2FSAA 2L75A 5C13A 1BORA 2L43A 4PPEA 3U5MA 2JMIA 3DQVR 2YUCA 5TABA 2OXQC 3C6WA 1MM2A 2KU3A 5LCWB 1F62A 3N9OA 2LDRA 4I7CA 2K4DA 3O33A 1WEWA 5D1LB 3LQIA 2E6RA 5AITA 1JM7B 2MA5A 1CHCA 3ZTGA 1WGMA 4I7BA 3I2DA 1WEPA 2LGVA 2H0DB 2YQLA 4L58A 5B8DA 5D1KB 4AVXA 4UP0A 2MUMA 2Y1MA 1V87A 4Q6FA 2KWKA 3KNVA 2HYED 2Y43A 4FO9A 5FB0A 4V3LC 1VD4A 5TBNA 2VJEB 4YBTA 2XEUA 4MSXA 2VP7A 2ZETC 2QIZA 2BAYA 5LKZA 1WEUA 4LK9A 3PURA 4W4UA 5DINA 2G45A 1HYJA 2RI7A 1DVPA 4GB0A 1Z60A 2VPBA 4IC3A 2KFTA 4ZDTA 3O70A 3QZVA 5TDWA 4WZ0A 1VYXA 2YURA 2VPGA 2VPDA 1WILA 4A49A 1U6GB 3SHBA 1VFYA 1K2FA 1G25A 5G05B 2M85A 2KR4A 2MA6A 4YAXA 4CA1A 4C9ZA 1ZBDB 2VJFA 4AYCB 3O36A 4YBSA 2CSYA 2CSZA 2YHOA 4WZ3B 5FERA 1X4JA 2ECGA 4TKPB 3ZPVE 4IC2A 4P5OB 2ECWA 2LN0A 3T7LA 3LQHA 3ZPV1 2FUIA 3LRQA 2C2LA 1IYMA 1MM3A 1X4IA 2AN6A 3KV5A 2YT5A 2IDAA 2YSJA 5G0FA 3NG2A 4FJCA 4O64A 2KE1A 4GNFA 4S3OC 2CKLA 4ZUXU 4MVTA 3HTKC 2KWJA 3V43A 1RMDA 3PUQA 3L1ZB 4QF3A 3SOUA 2JMDA 2K16A 4R2YA 5I3LA 2MIQA 2F42A 2M3HA 4LADB 2KWOA 2UZGA 3GL6A 5B75A 3T6RA 5JG6A 3ZVYA 2YW8A 4GNGA 4LJNA 2L0BA 3HCSA 1WENA 5FB1A 4YC9A 2YU4A 5FEYA 3HCTA 4WZ2A 2F6NA 4R8PK 1Z6UA 3RPGC 2MD8C 2MD7B 1WEMA 3N9LA 2VPEA 4X3GA 3MHHA 2ECJA 2I50A 4NN2A 4YABA 4LKAA 4LLBA 5G04B 2ECTA 2LXHC 5TDRA 3C5KA 5LKUA 5AIUA 2QICA 4BBQA 4ZQLA 1T1HA 2KGGA 4AP4A 2VNFA 3GV4A 2VJFB 3M99A 2LGLA 3VK6A 4YBMA 2KREA 1N87A 2EGPA 3PHDA 1X4UA 4GNEA 2E6SA 4XI1A 3L1XA 2L5UA 2MT5A 2K1JA 2FUUA 3EB6A 2KYUA 2PUYA 3M62A 1WIMA 2ECIA 3IHPA 4YADA 3ZYQA 2QJ0A 2F6JA 4YATA 3ZVZB 2EODA 3MHSA 4R7EA 4GNDA 3O34A 2DX8A 2D8SA 2ECNA 1Z2QA 3RTRB 3U5PA 5J3XA 2CKLB 4V3KC 2HDPA 1WEVA 2MNZA 5KH9A 2Y1NA 3SOXA 4QF2A 3U5NA 1LDJB 4A4CA 3U5OA 3N9QA 5B76A 2G43A 2XB1A 4N4FA 4A0CD 3DPLR 3N9PA 1LDKC 4CCGX 1WEQA 4FIPA 1WEOA 1WESA 5KH3A 4N3WA 3N9NA 3O37A 4UI9B 2YQMA 2M6MA 2YHNA 1E4UA 1JM7A 3ASLA 2K17A 4WA6A 4UP5A 3SOWA 2YSMA 5H9MA 5H1UA 2LRIC 4F52B 2PNXA 2NAAA 2M1RA 2RSDA 5B79A 2H0DA 4L7XA 5D1MB 2CT2A 3N9MA 3O35A 4FK5A 1JOCA 2KGIA 2EA6A 5DKAA 4B86C 2YREA 4S3OB 2JMJA 4AUQB 2C2VS 5LKXA 1FBVA 2VJEA 3LQJA 5H1VA 2JRJA 4B7YC 5LKTA 5C11A 2LGGA 1FP0A
chains in the Genus database with same CATH superfamily
2L80A 5EYAF 1WEEA 1WFKA 2G6QA 3O7AA 2LV9A 3HCUA 1XWHA 5H1TA 3FM8C 3M63A 3PLWA 3KV6A 5KH7A 5TRBA 2KKXA 4A4BA 4BHWA 4I7DA 2JUNA 2KWNA 2ECVA 3L11A 3FL2A 3KQIA 2LXPC 2MNYA 2E61A 1HYIA 2CRWA 3RPGB 3ZNIA 3EB5A 2RR4A 4AYCA 2YYRA 2LQ6A 4PTBA 2KIZA 1WE9A 5B78A 5B77A 2LGKA 2FSAA 2L75A 5C13A 1BORA 5SVIB 2L43A 4PPEA 3U5MA 2JMIA 3DQVR 2YUCA 5TABA 2OXQC 3C6WA 1MM2A 2KU3A 2LAUA 5LCWB 1F62A 3N9OA 2LDRA 4I7CA 2K4DA 3O33A 1WEWA 5D1LB 3LQIA 2E6RA 5AITA 1JM7B 2MA5A 1CHCA 2MKEA 3ZTGA 1WGMA 4I7BA 3I2DA 1WEPA 4O62A 1DCQA 2LGVA 2H0DB 2YQLA 4L58A 5B8DA 5D1KB 4AVXA 4UP0A 2MUMA 2Y1MA 1V87A 4Q6FA 2KWKA 3KNVA 2HYED 2Y43A 4FO9A 5FB0A 4V3LC 1VD4A 5TBNA 2VJEB 4YBTA 2XEUA 4MSXA 2VP7A 3FAOA 2ZETC 2QIZA 3SUBA 2BAYA 5LKZA 1WEUA 4LK9A 3PURA 4W4UA 5DINA 2G45A 1HYJA 2RI7A 1DVPA 4GB0A 2OWAA 1Z60A 2VPBA 4IC3A 4QQ4A 2KFTA 4ZDTA 3O70A 3QZVA 5TDWA 4WZ0A 1VYXA 2YURA 2VPGA 2VPDA 1WILA 4A49A 1U6GB 3SHBA 1VFYA 1K2FA 1G25A 5G05B 2KKYA 3DDTA 4Z0RA 2M85A 2KR4A 2MA6A 3M7KA 2L7PA 4YAXA 4CA1A 4C9ZA 1ZBDB 2DJAA 2VJFA 4AYCB 3O36A 4YBSA 2CSYA 2CSZA 2YHOA 4WZ3B 3LJUX 5FERA 1X4JA 2ECGA 4TKPB 3ZPVE 4IC2A 3FJUB 4P5OB 2ECWA 2LN0A 3T7LA 3LQHA 3ZPV1 2FUIA 3JUEA 3LRQA 2C2LA 1IYMA 1MM3A 1X4IA 2AN6A 3KV5A 2YT5A 2IDAA 2YSJA 5G0FA 3NG2A 4FJCA 4O64A 2KE1A 4GNFA 2XOZA 4S3OC 2CKLA 4ZUXU 4MVTA 3HTKC 2KWJA 3V43A 1RMDA 3FANA 2FFWA 3PUQA 3L1ZB 4QF3A 3SOUA 2JMDA 2K16A 4R2YA 5I3LA 2MIQA 2F42A 2M3HA 2XOCA 4LADB 2KWOA 2UZGA 3GL6A 5B75A 3T6RA 5JG6A 3ZVYA 2YW8A 4GNGA 4LJNA 2L0BA 3HCSA 1WENA 2CSVA 5FB1A 4YC9A 2YU4A 5FEYA 3DWDA 5SVXA 3HCTA 4WZ2A 2F6NA 4R8PK 3FEHA 1Z6UA 3E2DA 3RPGC 2MD8C 2MD7B 1WEMA 3N9LA 2YVRA 2VPEA 4X3GA 3MHHA 2ECJA 2I50A 4NN2A 4YABA 4LKAA 4LLBA 5G04B 2ECTA 2DSMA 3LVQE 2LXHC 5TDRA 2CONA 3C5KA 5LKUA 5AIUA 2QICA 4BBQA 4ZQLA 1T1HA 2KGGA 4AP4A 2VNFA 3GV4A 3H7HA 2VJFB 3M99A 2LGLA 2D8UA 3VK6A 4YBMA 2KREA 1N87A 2EGPA 3PHDA 3LVRE 1X4UA 4GNEA 2E6SA 4XI1A 3L1XA 2P57A 2L5UA 2MT5A 2K1JA 2FUUA 3EB6A 2KYUA 3T9KA 2PUYA 3M62A 1WIMA 2ECIA 3IHPA 4OGCA 2B0OE 4YADA 3ZYQA 2QJ0A 2EXUA 2F6JA 1MBMA 4YATA 3ZVZB 2EODA 3MHSA 2M13A 4R7EA 2IQJA 4GNDA 3O34A 2DX8A 2D8SA 2ECNA 1Z2QA 3RTRB 2JM3A 3LDYA 5SVIA 3U5PA 5J3XA 2CKLB 4V3KC 2HDPA 3MDBC 1WEVA 2MNZA 5KH9A 2Y1NA 3SOXA 5K3QA 4QF2A 3U5NA 1LDJB 4A4CA 4Z0OA 3U5OA 3N9QA 2EGMA 5B76A 2G43A 2XB1A 4N4FA 4A0CD 3DPLR 3N9PA 3Q1DA 1LDKC 4CCGX 1WEQA 4FIPA 1WEOA 2XOYA 1WESA 5KH3A 4N3WA 3N9NA 3O37A 4UI9B 2YQMA 2M6MA 2YHNA 1E4UA 4OGEA 1JM7A 3ASLA 2K17A 4WA6A 4UP5A 3SOWA 2YSMA 5H9MA 5H1UA 3KDEC 4F1PA 2LRIC 4F52B 2PNXA 2NAAA 2M1RA 2RSDA 5B79A 2H0DA 4L7XA 5D1MB 2FD4A 2CT2A 3N9MA 3O35A 4FK5A 1JOCA 2KGIA 2EA6A 5SVYA 5DKAA 4B86C 2YREA 2XP0A 4S3OB 2JMJA 4AUQB 2C2VS 3O47A 5LKXA 2CRRA 1FBVA 2VJEA 3LQJA 5H1VA 4H9DA 2JRJA 4B7YC 5LKTA 5C11A 2LGGA 1FP0A
chains in the Genus database with same CATH topology
2L80A 5EYAF 1WEEA 1WFKA 2G6QA 3O7AA 2LV9A 3HCUA 1XWHA 5H1TA 3M63A 3KV6A 5KH7A 5TRBA 4A4BA 4BHWA 4I7DA 2KWNA 2ECVA 3L11A 3FL2A 3KQIA 2LXPC 2MNYA 1HYIA 3RPGB 3ZNIA 3EB5A 4AYCA 2YYRA 2LQ6A 4PTBA 2KIZA 1WE9A 5B78A 5B77A 2LGKA 2FSAA 2L75A 5C13A 1BORA 2L43A 4PPEA 3U5MA 2JMIA 3DQVR 2YUCA 5TABA 2OXQC 3C6WA 1MM2A 2KU3A 5LCWB 1F62A 3N9OA 2LDRA 4I7CA 2K4DA 3O33A 1WEWA 5D1LB 3LQIA 2E6RA 5AITA 1JM7B 2MA5A 1CHCA 3ZTGA 1WGMA 4I7BA 3I2DA 1WEPA 2LGVA 2H0DB 2YQLA 4L58A 5B8DA 5D1KB 4AVXA 4UP0A 2MUMA 2Y1MA 1V87A 4Q6FA 2KWKA 3KNVA 2HYED 2Y43A 4FO9A 5FB0A 4V3LC 1VD4A 5TBNA 2VJEB 4YBTA 2XEUA 4MSXA 2VP7A 2ZETC 2QIZA 2BAYA 5LKZA 1WEUA 4LK9A 3PURA 4W4UA 5DINA 2G45A 1HYJA 2RI7A 1DVPA 4GB0A 1Z60A 2VPBA 4IC3A 2KFTA 4ZDTA 3O70A 3QZVA 5TDWA 4WZ0A 1VYXA 2YURA 2VPGA 2VPDA 1WILA 4A49A 1U6GB 3SHBA 1VFYA 1K2FA 1G25A 5G05B 2M85A 2KR4A 2MA6A 4YAXA 4CA1A 4C9ZA 1ZBDB 2VJFA 4AYCB 3O36A 4YBSA 2CSYA 2CSZA 2YHOA 4WZ3B 5FERA 1X4JA 2ECGA 4TKPB 3ZPVE 4IC2A 4P5OB 2ECWA 2LN0A 3T7LA 3LQHA 3ZPV1 2FUIA 3LRQA 2C2LA 1IYMA 1MM3A 1X4IA 2AN6A 3KV5A 2YT5A 2IDAA 2YSJA 5G0FA 3NG2A 4FJCA 4O64A 2KE1A 4GNFA 4S3OC 2CKLA 4ZUXU 4MVTA 3HTKC 2KWJA 3V43A 1RMDA 3PUQA 3L1ZB 4QF3A 3SOUA 2JMDA 2K16A 4R2YA 5I3LA 2MIQA 2F42A 2M3HA 4LADB 2KWOA 2UZGA 3GL6A 5B75A 3T6RA 5JG6A 3ZVYA 2YW8A 4GNGA 4LJNA 2L0BA 3HCSA 1WENA 5FB1A 4YC9A 2YU4A 5FEYA 3HCTA 4WZ2A 2F6NA 4R8PK 1Z6UA 3RPGC 2MD8C 2MD7B 1WEMA 3N9LA 2VPEA 4X3GA 3MHHA 2ECJA 2I50A 4NN2A 4YABA 4LKAA 4LLBA 5G04B 2ECTA 2LXHC 5TDRA 3C5KA 5LKUA 5AIUA 2QICA 4BBQA 4ZQLA 1T1HA 2KGGA 4AP4A 2VNFA 3GV4A 2VJFB 3M99A 2LGLA 3VK6A 4YBMA 2KREA 1N87A 2EGPA 3PHDA 1X4UA 4GNEA 2E6SA 4XI1A 3L1XA 2L5UA 2MT5A 2K1JA 2FUUA 3EB6A 2KYUA 2PUYA 3M62A 1WIMA 2ECIA 3IHPA 4YADA 3ZYQA 2QJ0A 2F6JA 4YATA 3ZVZB 2EODA 3MHSA 4R7EA 4GNDA 3O34A 2DX8A 2D8SA 2ECNA 1Z2QA 3RTRB 3U5PA 5J3XA 2CKLB 4V3KC 2HDPA 1WEVA 2MNZA 5KH9A 2Y1NA 3SOXA 4QF2A 3U5NA 1LDJB 4A4CA 3U5OA 3N9QA 5B76A 2G43A 2XB1A 4N4FA 4A0CD 3DPLR 3N9PA 1LDKC 4CCGX 1WEQA 4FIPA 1WEOA 1WESA 5KH3A 4N3WA 3N9NA 3O37A 4UI9B 2YQMA 2M6MA 2YHNA 1E4UA 1JM7A 3ASLA 2K17A 4WA6A 4UP5A 3SOWA 2YSMA 5H9MA 5H1UA 2LRIC 4F52B 2PNXA 2NAAA 2M1RA 2RSDA 5B79A 2H0DA 4L7XA 5D1MB 2CT2A 3N9MA 3O35A 4FK5A 1JOCA 2KGIA 2EA6A 5DKAA 4B86C 2YREA 4S3OB 2JMJA 4AUQB 2C2VS 5LKXA 1FBVA 2VJEA 3LQJA 5H1VA 2JRJA 4B7YC 5LKTA 5C11A 2LGGA 1FP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L80 A;  5EYA F;  1WEE A;  1WFK A;  2G6Q A;  3O7A A;  2LV9 A;  3HCU A;  1XWH A;  5H1T A;  3M63 A;  3KV6 A;  5KH7 A;  5TRB A;  4A4B A;  4BHW A;  4I7D A;  2KWN A;  2ECV A;  3L11 A;  3FL2 A;  3KQI A;  2LXP C;  2MNY A;  1HYI A;  3RPG B;  3ZNI A;  3EB5 A;  4AYC A;  2YYR A;  2LQ6 A;  4PTB A;  2KIZ A;  1WE9 A;  5B78 A;  5B77 A;  2LGK A;  2FSA A;  2L75 A;  5C13 A;  1BOR A;  2L43 A;  4PPE A;  3U5M A;  2JMI A;  3DQV R;  2YUC A;  5TAB A;  2OXQ C;  3C6W A;  1MM2 A;  2KU3 A;  5LCW B;  1F62 A;  3N9O A;  2LDR A;  4I7C A;  2K4D A;  3O33 A;  1WEW A;  5D1L B;  3LQI A;  2E6R A;  5AIT A;  1JM7 B;  2MA5 A;  1CHC A;  3ZTG A;  1WGM A;  4I7B A;  3I2D A;  1WEP A;  2LGV A;  2H0D B;  2YQL A;  4L58 A;  5B8D A;  5D1K B;  4AVX A;  4UP0 A;  2MUM A;  2Y1M A;  1V87 A;  4Q6F A;  2KWK A;  3KNV A;  2HYE D;  2Y43 A;  4FO9 A;  5FB0 A;  4V3L C;  1VD4 A;  5TBN A;  2VJE B;  4YBT A;  2XEU A;  4MSX A;  2VP7 A;  2ZET C;  2QIZ A;  2BAY A;  5LKZ A;  1WEU A;  4LK9 A;  3PUR A;  4W4U A;  5DIN A;  2G45 A;  1HYJ A;  2RI7 A;  1DVP A;  4GB0 A;  1Z60 A;  2VPB A;  4IC3 A;  2KFT A;  4ZDT A;  3O70 A;  3QZV A;  5TDW A;  4WZ0 A;  1VYX A;  2YUR A;  2VPG A;  2VPD A;  1WIL A;  4A49 A;  1U6G B;  3SHB A;  1VFY A;  1K2F A;  1G25 A;  5G05 B;  2M85 A;  2KR4 A;  2MA6 A;  4YAX A;  4CA1 A;  4C9Z A;  1ZBD B;  2VJF A;  4AYC B;  3O36 A;  4YBS A;  2CSY A;  2CSZ A;  2YHO A;  4WZ3 B;  5FER A;  1X4J A;  2ECG A;  4TKP B;  3ZPV E;  4IC2 A;  4P5O B;  2ECW A;  2LN0 A;  3T7L A;  3LQH A;  3ZPV 1;  2FUI A;  3LRQ A;  2C2L A;  1IYM A;  1MM3 A;  1X4I A;  2AN6 A;  3KV5 A;  2YT5 A;  2IDA A;  2YSJ A;  5G0F A;  3NG2 A;  4FJC A;  4O64 A;  2KE1 A;  4GNF A;  4S3O C;  2CKL A;  4ZUX U;  4MVT A;  3HTK C;  2KWJ A;  3V43 A;  1RMD A;  3PUQ A;  3L1Z B;  4QF3 A;  3SOU A;  2JMD A;  2K16 A;  4R2Y A;  5I3L A;  2MIQ A;  2F42 A;  2M3H A;  4LAD B;  2KWO A;  2UZG A;  3GL6 A;  5B75 A;  3T6R A;  5JG6 A;  3ZVY A;  2YW8 A;  4GNG A;  4LJN A;  2L0B A;  3HCS A;  1WEN A;  5FB1 A;  4YC9 A;  2YU4 A;  5FEY A;  3HCT A;  4WZ2 A;  2F6N A;  4R8P K;  1Z6U A;  3RPG C;  2MD8 C;  2MD7 B;  1WEM A;  3N9L A;  2VPE A;  4X3G A;  3MHH A;  2ECJ A;  2I50 A;  4NN2 A;  4YAB A;  4LKA A;  4LLB A;  5G04 B;  2ECT A;  2LXH C;  5TDR A;  3C5K A;  5LKU A;  5AIU A;  2QIC A;  4BBQ A;  4ZQL A;  1T1H A;  2KGG A;  4AP4 A;  2VNF A;  3GV4 A;  2VJF B;  3M99 A;  2LGL A;  3VK6 A;  4YBM A;  2KRE A;  1N87 A;  2EGP A;  3PHD A;  1X4U A;  4GNE A;  2E6S A;  4XI1 A;  3L1X A;  2L5U A;  2MT5 A;  2K1J A;  2FUU A;  3EB6 A;  2KYU A;  2PUY A;  3M62 A;  1WIM A;  2ECI A;  3IHP A;  4YAD A;  3ZYQ A;  2QJ0 A;  2F6J A;  4YAT A;  3ZVZ B;  2EOD A;  3MHS A;  4R7E A;  4GND A;  3O34 A;  2DX8 A;  2D8S A;  2ECN A;  1Z2Q A;  3RTR B;  3U5P A;  5J3X A;  2CKL B;  4V3K C;  2HDP A;  1WEV A;  2MNZ A;  5KH9 A;  2Y1N A;  3SOX A;  4QF2 A;  3U5N A;  1LDJ B;  4A4C A;  3U5O A;  3N9Q A;  5B76 A;  2G43 A;  2XB1 A;  4N4F A;  4A0C D;  3DPL R;  3N9P A;  1LDK C;  4CCG X;  1WEQ A;  4FIP A;  1WEO A;  1WES A;  5KH3 A;  4N3W A;  3N9N A;  3O37 A;  4UI9 B;  2YQM A;  2M6M A;  2YHN A;  1E4U A;  1JM7 A;  3ASL A;  2K17 A;  4WA6 A;  4UP5 A;  3SOW A;  2YSM A;  5H9M A;  5H1U A;  2LRI C;  4F52 B;  2PNX A;  2NAA A;  2M1R A;  2RSD A;  5B79 A;  2H0D A;  4L7X A;  5D1M B;  2CT2 A;  3N9M A;  3O35 A;  4FK5 A;  1JOC A;  2KGI A;  2EA6 A;  5DKA A;  4B86 C;  2YRE A;  4S3O B;  2JMJ A;  4AUQ B;  2C2V S;  5LKX A;  1FBV A;  2VJE A;  3LQJ A;  5H1V A;  2JRJ A;  4B7Y C;  5LKT A;  5C11 A;  2LGG A;  1FP0 A; 
#chains in the Genus database with same CATH topology
 2L80 A;  5EYA F;  1WEE A;  1WFK A;  2G6Q A;  3O7A A;  2LV9 A;  3HCU A;  1XWH A;  5H1T A;  3FM8 C;  3M63 A;  3PLW A;  3KV6 A;  5KH7 A;  5TRB A;  2KKX A;  4A4B A;  4BHW A;  4I7D A;  2JUN A;  2KWN A;  2ECV A;  3L11 A;  3FL2 A;  3KQI A;  2LXP C;  2MNY A;  2E61 A;  1HYI A;  2CRW A;  3RPG B;  3ZNI A;  3EB5 A;  2RR4 A;  4AYC A;  2YYR A;  2LQ6 A;  4PTB A;  2KIZ A;  1WE9 A;  5B78 A;  5B77 A;  2LGK A;  2FSA A;  2L75 A;  5C13 A;  1BOR A;  5SVI B;  2L43 A;  4PPE A;  3U5M A;  2JMI A;  3DQV R;  2YUC A;  5TAB A;  2OXQ C;  3C6W A;  1MM2 A;  2KU3 A;  2LAU A;  5LCW B;  1F62 A;  3N9O A;  2LDR A;  4I7C A;  2K4D A;  3O33 A;  1WEW A;  5D1L B;  3LQI A;  2E6R A;  5AIT A;  1JM7 B;  2MA5 A;  1CHC A;  2MKE A;  3ZTG A;  1WGM A;  4I7B A;  3I2D A;  1WEP A;  4O62 A;  1DCQ A;  2LGV A;  2H0D B;  2YQL A;  4L58 A;  5B8D A;  5D1K B;  4AVX A;  4UP0 A;  2MUM A;  2Y1M A;  1V87 A;  4Q6F A;  2KWK A;  3KNV A;  2HYE D;  2Y43 A;  4FO9 A;  5FB0 A;  4V3L C;  1VD4 A;  5TBN A;  2VJE B;  4YBT A;  2XEU A;  4MSX A;  2VP7 A;  3FAO A;  2ZET C;  2QIZ A;  3SUB A;  2BAY A;  5LKZ A;  1WEU A;  4LK9 A;  3PUR A;  4W4U A;  5DIN A;  2G45 A;  1HYJ A;  2RI7 A;  1DVP A;  4GB0 A;  2OWA A;  1Z60 A;  2VPB A;  4IC3 A;  4QQ4 A;  2KFT A;  4ZDT A;  3O70 A;  3QZV A;  5TDW A;  4WZ0 A;  1VYX A;  2YUR A;  2VPG A;  2VPD A;  1WIL A;  4A49 A;  1U6G B;  3SHB A;  1VFY A;  1K2F A;  1G25 A;  5G05 B;  2KKY A;  3DDT A;  4Z0R A;  2M85 A;  2KR4 A;  2MA6 A;  3M7K A;  2L7P A;  4YAX A;  4CA1 A;  4C9Z A;  1ZBD B;  2DJA A;  2VJF A;  4AYC B;  3O36 A;  4YBS A;  2CSY A;  2CSZ A;  2YHO A;  4WZ3 B;  3LJU X;  5FER A;  1X4J A;  2ECG A;  4TKP B;  3ZPV E;  4IC2 A;  3FJU B;  4P5O B;  2ECW A;  2LN0 A;  3T7L A;  3LQH A;  3ZPV 1;  2FUI A;  3JUE A;  3LRQ A;  2C2L A;  1IYM A;  1MM3 A;  1X4I A;  2AN6 A;  3KV5 A;  2YT5 A;  2IDA A;  2YSJ A;  5G0F A;  3NG2 A;  4FJC A;  4O64 A;  2KE1 A;  4GNF A;  2XOZ A;  4S3O C;  2CKL A;  4ZUX U;  4MVT A;  3HTK C;  2KWJ A;  3V43 A;  1RMD A;  3FAN A;  2FFW A;  3PUQ A;  3L1Z B;  4QF3 A;  3SOU A;  2JMD A;  2K16 A;  4R2Y A;  5I3L A;  2MIQ A;  2F42 A;  2M3H A;  2XOC A;  4LAD B;  2KWO A;  2UZG A;  3GL6 A;  5B75 A;  3T6R A;  5JG6 A;  3ZVY A;  2YW8 A;  4GNG A;  4LJN A;  2L0B A;  3HCS A;  1WEN A;  2CSV A;  5FB1 A;  4YC9 A;  2YU4 A;  5FEY A;  3DWD A;  5SVX A;  3HCT A;  4WZ2 A;  2F6N A;  4R8P K;  3FEH A;  1Z6U A;  3E2D A;  3RPG C;  2MD8 C;  2MD7 B;  1WEM A;  3N9L A;  2YVR A;  2VPE A;  4X3G A;  3MHH A;  2ECJ A;  2I50 A;  4NN2 A;  4YAB A;  4LKA A;  4LLB A;  5G04 B;  2ECT A;  2DSM A;  3LVQ E;  2LXH C;  5TDR A;  2CON A;  3C5K A;  5LKU A;  5AIU A;  2QIC A;  4BBQ A;  4ZQL A;  1T1H A;  2KGG A;  4AP4 A;  2VNF A;  3GV4 A;  3H7H A;  2VJF B;  3M99 A;  2LGL A;  2D8U A;  3VK6 A;  4YBM A;  2KRE A;  1N87 A;  2EGP A;  3PHD A;  3LVR E;  1X4U A;  4GNE A;  2E6S A;  4XI1 A;  3L1X A;  2P57 A;  2L5U A;  2MT5 A;  2K1J A;  2FUU A;  3EB6 A;  2KYU A;  3T9K A;  2PUY A;  3M62 A;  1WIM A;  2ECI A;  3IHP A;  4OGC A;  2B0O E;  4YAD A;  3ZYQ A;  2QJ0 A;  2EXU A;  2F6J A;  1MBM A;  4YAT A;  3ZVZ B;  2EOD A;  3MHS A;  2M13 A;  4R7E A;  2IQJ A;  4GND A;  3O34 A;  2DX8 A;  2D8S A;  2ECN A;  1Z2Q A;  3RTR B;  2JM3 A;  3LDY A;  5SVI A;  3U5P A;  5J3X A;  2CKL B;  4V3K C;  2HDP A;  3MDB C;  1WEV A;  2MNZ A;  5KH9 A;  2Y1N A;  3SOX A;  5K3Q A;  4QF2 A;  3U5N A;  1LDJ B;  4A4C A;  4Z0O A;  3U5O A;  3N9Q A;  2EGM A;  5B76 A;  2G43 A;  2XB1 A;  4N4F A;  4A0C D;  3DPL R;  3N9P A;  3Q1D A;  1LDK C;  4CCG X;  1WEQ A;  4FIP A;  1WEO A;  2XOY A;  1WES A;  5KH3 A;  4N3W A;  3N9N A;  3O37 A;  4UI9 B;  2YQM A;  2M6M A;  2YHN A;  1E4U A;  4OGE A;  1JM7 A;  3ASL A;  2K17 A;  4WA6 A;  4UP5 A;  3SOW A;  2YSM A;  5H9M A;  5H1U A;  3KDE C;  4F1P A;  2LRI C;  4F52 B;  2PNX A;  2NAA A;  2M1R A;  2RSD A;  5B79 A;  2H0D A;  4L7X A;  5D1M B;  2FD4 A;  2CT2 A;  3N9M A;  3O35 A;  4FK5 A;  1JOC A;  2KGI A;  2EA6 A;  5SVY A;  5DKA A;  4B86 C;  2YRE A;  2XP0 A;  4S3O B;  2JMJ A;  4AUQ B;  2C2V S;  3O47 A;  5LKX A;  2CRR A;  1FBV A;  2VJE A;  3LQJ A;  5H1V A;  4H9D A;  2JRJ A;  4B7Y C;  5LKT A;  5C11 A;  2LGG A;  1FP0 A; 
#chains in the Genus database with same CATH homology
 2L80 A;  5EYA F;  1WEE A;  1WFK A;  2G6Q A;  3O7A A;  2LV9 A;  3HCU A;  1XWH A;  5H1T A;  3M63 A;  3KV6 A;  5KH7 A;  5TRB A;  4A4B A;  4BHW A;  4I7D A;  2KWN A;  2ECV A;  3L11 A;  3FL2 A;  3KQI A;  2LXP C;  2MNY A;  1HYI A;  3RPG B;  3ZNI A;  3EB5 A;  4AYC A;  2YYR A;  2LQ6 A;  4PTB A;  2KIZ A;  1WE9 A;  5B78 A;  5B77 A;  2LGK A;  2FSA A;  2L75 A;  5C13 A;  1BOR A;  2L43 A;  4PPE A;  3U5M A;  2JMI A;  3DQV R;  2YUC A;  5TAB A;  2OXQ C;  3C6W A;  1MM2 A;  2KU3 A;  5LCW B;  1F62 A;  3N9O A;  2LDR A;  4I7C A;  2K4D A;  3O33 A;  1WEW A;  5D1L B;  3LQI A;  2E6R A;  5AIT A;  1JM7 B;  2MA5 A;  1CHC A;  3ZTG A;  1WGM A;  4I7B A;  3I2D A;  1WEP A;  2LGV A;  2H0D B;  2YQL A;  4L58 A;  5B8D A;  5D1K B;  4AVX A;  4UP0 A;  2MUM A;  2Y1M A;  1V87 A;  4Q6F A;  2KWK A;  3KNV A;  2HYE D;  2Y43 A;  4FO9 A;  5FB0 A;  4V3L C;  1VD4 A;  5TBN A;  2VJE B;  4YBT A;  2XEU A;  4MSX A;  2VP7 A;  2ZET C;  2QIZ A;  2BAY A;  5LKZ A;  1WEU A;  4LK9 A;  3PUR A;  4W4U A;  5DIN A;  2G45 A;  1HYJ A;  2RI7 A;  1DVP A;  4GB0 A;  1Z60 A;  2VPB A;  4IC3 A;  2KFT A;  4ZDT A;  3O70 A;  3QZV A;  5TDW A;  4WZ0 A;  1VYX A;  2YUR A;  2VPG A;  2VPD A;  1WIL A;  4A49 A;  1U6G B;  3SHB A;  1VFY A;  1K2F A;  1G25 A;  5G05 B;  2M85 A;  2KR4 A;  2MA6 A;  4YAX A;  4CA1 A;  4C9Z A;  1ZBD B;  2VJF A;  4AYC B;  3O36 A;  4YBS A;  2CSY A;  2CSZ A;  2YHO A;  4WZ3 B;  5FER A;  1X4J A;  2ECG A;  4TKP B;  3ZPV E;  4IC2 A;  4P5O B;  2ECW A;  2LN0 A;  3T7L A;  3LQH A;  3ZPV 1;  2FUI A;  3LRQ A;  2C2L A;  1IYM A;  1MM3 A;  1X4I A;  2AN6 A;  3KV5 A;  2YT5 A;  2IDA A;  2YSJ A;  5G0F A;  3NG2 A;  4FJC A;  4O64 A;  2KE1 A;  4GNF A;  4S3O C;  2CKL A;  4ZUX U;  4MVT A;  3HTK C;  2KWJ A;  3V43 A;  1RMD A;  3PUQ A;  3L1Z B;  4QF3 A;  3SOU A;  2JMD A;  2K16 A;  4R2Y A;  5I3L A;  2MIQ A;  2F42 A;  2M3H A;  4LAD B;  2KWO A;  2UZG A;  3GL6 A;  5B75 A;  3T6R A;  5JG6 A;  3ZVY A;  2YW8 A;  4GNG A;  4LJN A;  2L0B A;  3HCS A;  1WEN A;  5FB1 A;  4YC9 A;  2YU4 A;  5FEY A;  3HCT A;  4WZ2 A;  2F6N A;  4R8P K;  1Z6U A;  3RPG C;  2MD8 C;  2MD7 B;  1WEM A;  3N9L A;  2VPE A;  4X3G A;  3MHH A;  2ECJ A;  2I50 A;  4NN2 A;  4YAB A;  4LKA A;  4LLB A;  5G04 B;  2ECT A;  2LXH C;  5TDR A;  3C5K A;  5LKU A;  5AIU A;  2QIC A;  4BBQ A;  4ZQL A;  1T1H A;  2KGG A;  4AP4 A;  2VNF A;  3GV4 A;  2VJF B;  3M99 A;  2LGL A;  3VK6 A;  4YBM A;  2KRE A;  1N87 A;  2EGP A;  3PHD A;  1X4U A;  4GNE A;  2E6S A;  4XI1 A;  3L1X A;  2L5U A;  2MT5 A;  2K1J A;  2FUU A;  3EB6 A;  2KYU A;  2PUY A;  3M62 A;  1WIM A;  2ECI A;  3IHP A;  4YAD A;  3ZYQ A;  2QJ0 A;  2F6J A;  4YAT A;  3ZVZ B;  2EOD A;  3MHS A;  4R7E A;  4GND A;  3O34 A;  2DX8 A;  2D8S A;  2ECN A;  1Z2Q A;  3RTR B;  3U5P A;  5J3X A;  2CKL B;  4V3K C;  2HDP A;  1WEV A;  2MNZ A;  5KH9 A;  2Y1N A;  3SOX A;  4QF2 A;  3U5N A;  1LDJ B;  4A4C A;  3U5O A;  3N9Q A;  5B76 A;  2G43 A;  2XB1 A;  4N4F A;  4A0C D;  3DPL R;  3N9P A;  1LDK C;  4CCG X;  1WEQ A;  4FIP A;  1WEO A;  1WES A;  5KH3 A;  4N3W A;  3N9N A;  3O37 A;  4UI9 B;  2YQM A;  2M6M A;  2YHN A;  1E4U A;  1JM7 A;  3ASL A;  2K17 A;  4WA6 A;  4UP5 A;  3SOW A;  2YSM A;  5H9M A;  5H1U A;  2LRI C;  4F52 B;  2PNX A;  2NAA A;  2M1R A;  2RSD A;  5B79 A;  2H0D A;  4L7X A;  5D1M B;  2CT2 A;  3N9M A;  3O35 A;  4FK5 A;  1JOC A;  2KGI A;  2EA6 A;  5DKA A;  4B86 C;  2YRE A;  4S3O B;  2JMJ A;  4AUQ B;  2C2V S;  5LKX A;  1FBV A;  2VJE A;  3LQJ A;  5H1V A;  2JRJ A;  4B7Y C;  5LKT A;  5C11 A;  2LGG A;  1FP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...