1WILA

Solution structure of the ring finger domain of the human kiaa1045 protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
89
structure length
89
Chain Sequence
b'GSSGSSGPREPVVNDEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTEMAHTETGWSCHYCDNINLLLTEESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1045 protein
publication title Solution Structure of the RING Finger Domain of the Human KIAA1045 Protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 4
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16744 Zf_RING KIAA1045 RING finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wilA00
4IC3A 1FBVA 1FP0A 1WGMA 5C13A 2YHNA 2YSMA 1WENA 5LCWB 4N3WA 2MNZA 1WFKA 3LRQA 2EA6A 2QIZA 4LADB 2KIZA 4BHWA 1VFYA 1WEWA 1X4JA 2JRJA 4MVTA 3O7AA 3ZVZB 5B75A 2FUIA 3RTRB 5FB1A 1X4IA 2LQ6A 3N9QA 2MD8C 2XB1A 1JM7B 2CSZA 2VJEA 2L5UA 3I2DA 2LGLA 4GNDA 1F62A 3ZYQA 1Z60A 2K1JA 3N9MA 5D1KB 2YURA 3C5KA 2BAYA 3N9OA 4CA1A 3RPGC 4A0CD 4GNFA 3HCUA 4L58A 2KREA 4WZ0A 2KYUA 3L1XA 2YHOA 5FEYA 1WESA 3L1ZB 4ZUXU 4PPEA 4QF2A 4B86C 2ECTA 1WEVA 2JMJA 2KWJA 2YQMA 4YAXA 4B7YC 2M3HA 3N9NA 5EYAF 3SHBA 2ECWA 3O70A 4LK9A 2LDRA 3KQIA 2JMIA 2KE1A 2H0DB 1XWHA 2G43A 1WILA 5FERA 3U5MA 2MT5A 4W4UA 2CT2A 2LXPC 3U5OA 3O34A 2KWKA 3ZTGA 5D1LB 2ECNA 4S3OB 2YQLA 3U5NA 3HCTA 3SOWA 2E6SA 4IC2A 4ZDTA 2LV9A 4UP5A 1WEPA 4WZ3B 3M63A 3PUQA 1VD4A 3KV5A 3O35A 4AP4A 4N4FA 2VPEA 4Q6FA 2RI7A 2CKLA 4GB0A 2PNXA 4QF3A 1JM7A 3DQVR 1WEUA 2YUCA 5C11A 1K2FA 4FIPA 5D1MB 2VPDA 5TABA 2KU3A 2VP7A 4P5OB 4V3LC 3ZVYA 1MM2A 3KNVA 3N9PA 4YABA 1T1HA 4UI9B 5G0FA 4WA6A 1WE9A 3O36A 3EB5A 4A49A 5LKUA 3U5PA 3HTKC 3KV6A 4FO9A 1IYMA 2M6MA 2F42A 3LQHA 2VJFB 2FUUA 2L75A 2FSAA 3L11A 3PHDA 1WEOA 2KR4A 2G6QA 5H9MA 2VPBA 1WEQA 4AYCA 4LLBA 5B76A 2G45A 2RSDA 2LRIC 4X3GA 2MUMA 2YREA 2ECGA 3ZPV1 5TDWA 4CCGX 1E4UA 4FK5A 2KGIA 2PUYA 3GV4A 4S3OC 1HYJA 1V87A 4YC9A 4YADA 4MSXA 1Z2QA 2MIQA 1WEMA 2F6JA 1JOCA 3ASLA 5FB0A 4ZQLA 4I7CA 5DKAA 3C6WA 2OXQC 5G05B 1HYIA 4YBTA 1X4UA 3HCSA 1U6GB 3O33A 2YU4A 1MM3A 5B8DA 3O37A 5H1UA 2EGPA 2IDAA 3IHPA 4YBMA 4R7EA 5DINA 2LGVA 5LKZA 4XI1A 4L7XA 4I7BA 4LKAA 2NAAA 2C2LA 1ZBDB 1DVPA 1N87A 5H1VA 4C9ZA 2YT5A 2MA6A 2LXHC 3SOUA 3MHSA 3GL6A 5LKTA 4UP0A 5AITA 2LGGA 3M99A 4YBSA 1WEEA 2YSJA 1WIMA 2L80A 2K16A 2K17A 5B79A 5KH3A 3MHHA 2ZETC 2AN6A 5TDRA 3ZPVE 1VYXA 2Y1MA 2DX8A 2L43A 3PURA 2KGGA 2Y43A 4TKPB 2ECVA 5LKXA 2F6NA 3T7LA 3FL2A 5KH9A 2QICA 5I3LA 2MNYA 2YW8A 5KH7A 4WZ2A 2QJ0A 2H0DA 2CKLB 4PTBA 1RMDA 4BBQA 2YYRA 5TRBA 5JG6A 5J3XA 2D8SA 4O64A 4R2YA 1CHCA 1G25A 2LN0A 3V43A 2M85A 3LQIA 4AUQB 2KFTA 3LQJA 4A4BA 1LDJB 2KWOA 4NN2A 3VK6A 2HYED 2UZGA 3M62A 2Y1NA 2MD7B 2VJEB 4FJCA 3RPGB 4GNGA 2ECJA 5TBNA 2ECIA 2VNFA 2CSYA 1Z6UA 3QZVA 2VPGA 2KWNA 2E6RA 4F52B 3DPLR 4V3KC 4R8PK 1LDKC 4AYCB 1BORA 3SOXA 3N9LA 2LGKA 4GNEA 5H1TA 2JMDA 5AIUA 4LJNA 2I50A 2XEUA 4AVXA 4A4CA 2EODA 2M1RA 3EB6A 2K4DA 4YATA 2C2VS 2L0BA 3ZNIA 5G04B 3T6RA 2VJFA 5B77A 2MA5A 2HDPA 3NG2A 5B78A 4I7DA
chains in the Genus database with same CATH superfamily
3E2DA 4IC3A 1FBVA 1FP0A 1WGMA 5C13A 2CSVA 2YHNA 2XOYA 2CRRA 2YSMA 1WENA 5LCWB 4N3WA 2MNZA 2KKXA 1WFKA 3LRQA 2EA6A 2QIZA 4LADB 2KIZA 4BHWA 1VFYA 1WEWA 1X4JA 2JRJA 4MVTA 3O7AA 3ZVZB 5B75A 2FUIA 3RTRB 3PLWA 5FB1A 1X4IA 2LQ6A 3N9QA 2MD8C 2XB1A 1JM7B 2CSZA 2VJEA 3H7HA 2L5UA 3I2DA 2JUNA 2LGLA 2FFWA 4GNDA 1F62A 3ZYQA 1Z60A 2K1JA 2D8UA 3N9MA 5D1KB 2YURA 3C5KA 2BAYA 3N9OA 4CA1A 3RPGC 4A0CD 4GNFA 3HCUA 4L58A 5SVIB 2KREA 4WZ0A 2KYUA 3L1XA 2YHOA 5FEYA 1WESA 3L1ZB 4ZUXU 4PPEA 4QF2A 4B86C 2ECTA 2DJAA 1WEVA 2JMJA 2KWJA 2YQMA 4YAXA 4B7YC 2M3HA 3N9NA 3FEHA 5EYAF 3SHBA 2ECWA 3O70A 4LK9A 2LDRA 3KQIA 2JMIA 2KE1A 2H0DB 1XWHA 2G43A 1WILA 5FERA 3U5MA 2MT5A 4W4UA 2CT2A 2LXPC 3U5OA 2CONA 3O34A 2KWKA 3ZTGA 2LAUA 5D1LB 2ECNA 4S3OB 2YQLA 3U5NA 3HCTA 3SOWA 2E6SA 2MKEA 4IC2A 4ZDTA 2LV9A 2EXUA 4UP5A 1WEPA 4WZ3B 3M63A 3PUQA 3LDYA 1VD4A 3DWDA 2RR4A 3KV5A 3O35A 4AP4A 4N4FA 2VPEA 4Q6FA 2RI7A 2CKLA 4GB0A 2PNXA 4QF3A 1JM7A 3DQVR 4O62A 1WEUA 3LJUX 2E61A 2YUCA 3JUEA 5C11A 1K2FA 4FIPA 5D1MB 1DCQA 2L7PA 2VPDA 5TABA 2KU3A 2VP7A 4P5OB 4V3LC 3ZVYA 1MM2A 3KNVA 3N9PA 3FJUB 4YABA 1T1HA 4UI9B 5G0FA 4WA6A 1WE9A 4F1PA 3O36A 3EB5A 4A49A 5LKUA 3U5PA 3HTKC 3KV6A 3DDTA 4FO9A 1IYMA 2M6MA 2F42A 3LQHA 4H9DA 2VJFB 3FM8C 2FUUA 2OWAA 1MBMA 4Z0RA 2L75A 2FSAA 3L11A 3PHDA 1WEOA 2KR4A 2G6QA 2EGMA 5H9MA 3LVRE 2VPBA 2XOCA 1WEQA 4AYCA 4LLBA 5B76A 3Q1DA 2CRWA 2YVRA 2G45A 2RSDA 2P57A 2LRIC 4X3GA 2MUMA 2YREA 2ECGA 3ZPV1 5TDWA 4CCGX 1E4UA 4FK5A 2KGIA 2PUYA 3GV4A 4S3OC 1HYJA 2KKYA 1V87A 4YC9A 4YADA 4MSXA 1Z2QA 2MIQA 1WEMA 2F6JA 1JOCA 3ASLA 2JM3A 5FB0A 4ZQLA 4I7CA 5DKAA 3C6WA 2OXQC 5G05B 3KDEC 1HYIA 4YBTA 1X4UA 3HCSA 1U6GB 3O33A 2IQJA 2YU4A 1MM3A 5B8DA 3O37A 5H1UA 2EGPA 2IDAA 3IHPA 4YBMA 4R7EA 5DINA 2LGVA 2M13A 5LKZA 4LKAA 4L7XA 4I7BA 4XI1A 4Z0OA 2NAAA 2C2LA 1ZBDB 1DVPA 1N87A 5H1VA 4C9ZA 2YT5A 2MA6A 2LXHC 3SOUA 3MHSA 3GL6A 5LKTA 4UP0A 5AITA 2LGGA 2DSMA 3M99A 4YBSA 2XP0A 1WEEA 4OGEA 2YSJA 1WIMA 2L80A 2K16A 2K17A 5B79A 5KH3A 3MHHA 2ZETC 2AN6A 5TDRA 5SVIA 3ZPVE 1VYXA 2Y1MA 5K3QA 2DX8A 2L43A 3PURA 2KGGA 2Y43A 4TKPB 2ECVA 5LKXA 2F6NA 3T7LA 3FL2A 5KH9A 2QICA 5I3LA 2MNYA 2YW8A 3M7KA 5KH7A 4WZ2A 2QJ0A 2H0DA 3SUBA 2CKLB 2FD4A 4PTBA 1RMDA 4BBQA 2YYRA 5TRBA 5JG6A 5J3XA 4QQ4A 2D8SA 3FANA 5SVXA 4O64A 4R2YA 1CHCA 3FAOA 1G25A 2LN0A 3V43A 2M85A 3LQIA 4AUQB 2KFTA 3LQJA 4A4BA 1LDJB 2KWOA 4NN2A 3VK6A 2HYED 2UZGA 3M62A 2Y1NA 3MDBC 2MD7B 2VJEB 4FJCA 3RPGB 2XOZA 4GNGA 2ECJA 5TBNA 2ECIA 3T9KA 2VNFA 2CSYA 1Z6UA 3QZVA 2VPGA 2KWNA 2E6RA 4F52B 3DPLR 4V3KC 4R8PK 4OGCA 1LDKC 4AYCB 1BORA 3SOXA 3N9LA 2LGKA 4GNEA 5H1TA 2JMDA 5AIUA 3O47A 4LJNA 2I50A 2B0OE 2XEUA 4AVXA 5SVYA 4A4CA 2EODA 2M1RA 3EB6A 2K4DA 4YATA 2C2VS 2L0BA 3ZNIA 5G04B 3T6RA 2VJFA 5B77A 2MA5A 3LVQE 2HDPA 3NG2A 5B78A 4I7DA
chains in the Genus database with same CATH topology
4IC3A 1FBVA 1FP0A 1WGMA 5C13A 2YHNA 2YSMA 1WENA 5LCWB 4N3WA 2MNZA 1WFKA 3LRQA 2EA6A 2QIZA 4LADB 2KIZA 4BHWA 1VFYA 1WEWA 1X4JA 2JRJA 4MVTA 3O7AA 3ZVZB 5B75A 2FUIA 3RTRB 5FB1A 1X4IA 2LQ6A 3N9QA 2MD8C 2XB1A 1JM7B 2CSZA 2VJEA 2L5UA 3I2DA 2LGLA 4GNDA 1F62A 3ZYQA 1Z60A 2K1JA 3N9MA 5D1KB 2YURA 3C5KA 2BAYA 3N9OA 4CA1A 3RPGC 4A0CD 4GNFA 3HCUA 4L58A 2KREA 4WZ0A 2KYUA 3L1XA 2YHOA 5FEYA 1WESA 3L1ZB 4ZUXU 4PPEA 4QF2A 4B86C 2ECTA 1WEVA 2JMJA 2KWJA 2YQMA 4YAXA 4B7YC 2M3HA 3N9NA 5EYAF 3SHBA 2ECWA 3O70A 4LK9A 2LDRA 3KQIA 2JMIA 2KE1A 2H0DB 1XWHA 2G43A 1WILA 5FERA 3U5MA 2MT5A 4W4UA 2CT2A 2LXPC 3U5OA 3O34A 2KWKA 3ZTGA 5D1LB 2ECNA 4S3OB 2YQLA 3U5NA 3HCTA 3SOWA 2E6SA 4IC2A 4ZDTA 2LV9A 4UP5A 1WEPA 4WZ3B 3M63A 3PUQA 1VD4A 3KV5A 3O35A 4AP4A 4N4FA 2VPEA 4Q6FA 2RI7A 2CKLA 4GB0A 2PNXA 4QF3A 1JM7A 3DQVR 1WEUA 2YUCA 5C11A 1K2FA 4FIPA 5D1MB 2VPDA 5TABA 2KU3A 2VP7A 4P5OB 4V3LC 3ZVYA 1MM2A 3KNVA 3N9PA 4YABA 1T1HA 4UI9B 5G0FA 4WA6A 1WE9A 3O36A 3EB5A 4A49A 5LKUA 3U5PA 3HTKC 3KV6A 4FO9A 1IYMA 2M6MA 2F42A 3LQHA 2VJFB 2FUUA 2L75A 2FSAA 3L11A 3PHDA 1WEOA 2KR4A 2G6QA 5H9MA 2VPBA 1WEQA 4AYCA 4LLBA 5B76A 2G45A 2RSDA 2LRIC 4X3GA 2MUMA 2YREA 2ECGA 3ZPV1 5TDWA 4CCGX 1E4UA 4FK5A 2KGIA 2PUYA 3GV4A 4S3OC 1HYJA 1V87A 4YC9A 4YADA 4MSXA 1Z2QA 2MIQA 1WEMA 2F6JA 1JOCA 3ASLA 5FB0A 4ZQLA 4I7CA 5DKAA 3C6WA 2OXQC 5G05B 1HYIA 4YBTA 1X4UA 3HCSA 1U6GB 3O33A 2YU4A 1MM3A 5B8DA 3O37A 5H1UA 2EGPA 2IDAA 3IHPA 4YBMA 4R7EA 5DINA 2LGVA 5LKZA 4XI1A 4L7XA 4I7BA 4LKAA 2NAAA 2C2LA 1ZBDB 1DVPA 1N87A 5H1VA 4C9ZA 2YT5A 2MA6A 2LXHC 3SOUA 3MHSA 3GL6A 5LKTA 4UP0A 5AITA 2LGGA 3M99A 4YBSA 1WEEA 2YSJA 1WIMA 2L80A 2K16A 2K17A 5B79A 5KH3A 3MHHA 2ZETC 2AN6A 5TDRA 3ZPVE 1VYXA 2Y1MA 2DX8A 2L43A 3PURA 2KGGA 2Y43A 4TKPB 2ECVA 5LKXA 2F6NA 3T7LA 3FL2A 5KH9A 2QICA 5I3LA 2MNYA 2YW8A 5KH7A 4WZ2A 2QJ0A 2H0DA 2CKLB 4PTBA 1RMDA 4BBQA 2YYRA 5TRBA 5JG6A 5J3XA 2D8SA 4O64A 4R2YA 1CHCA 1G25A 2LN0A 3V43A 2M85A 3LQIA 4AUQB 2KFTA 3LQJA 4A4BA 1LDJB 2KWOA 4NN2A 3VK6A 2HYED 2UZGA 3M62A 2Y1NA 2MD7B 2VJEB 4FJCA 3RPGB 4GNGA 2ECJA 5TBNA 2ECIA 2VNFA 2CSYA 1Z6UA 3QZVA 2VPGA 2KWNA 2E6RA 4F52B 3DPLR 4V3KC 4R8PK 1LDKC 4AYCB 1BORA 3SOXA 3N9LA 2LGKA 4GNEA 5H1TA 2JMDA 5AIUA 4LJNA 2I50A 2XEUA 4AVXA 4A4CA 2EODA 2M1RA 3EB6A 2K4DA 4YATA 2C2VS 2L0BA 3ZNIA 5G04B 3T6RA 2VJFA 5B77A 2MA5A 2HDPA 3NG2A 5B78A 4I7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IC3 A;  1FBV A;  1FP0 A;  1WGM A;  5C13 A;  2YHN A;  2YSM A;  1WEN A;  5LCW B;  4N3W A;  2MNZ A;  1WFK A;  3LRQ A;  2EA6 A;  2QIZ A;  4LAD B;  2KIZ A;  4BHW A;  1VFY A;  1WEW A;  1X4J A;  2JRJ A;  4MVT A;  3O7A A;  3ZVZ B;  5B75 A;  2FUI A;  3RTR B;  5FB1 A;  1X4I A;  2LQ6 A;  3N9Q A;  2MD8 C;  2XB1 A;  1JM7 B;  2CSZ A;  2VJE A;  2L5U A;  3I2D A;  2LGL A;  4GND A;  1F62 A;  3ZYQ A;  1Z60 A;  2K1J A;  3N9M A;  5D1K B;  2YUR A;  3C5K A;  2BAY A;  3N9O A;  4CA1 A;  3RPG C;  4A0C D;  4GNF A;  3HCU A;  4L58 A;  2KRE A;  4WZ0 A;  2KYU A;  3L1X A;  2YHO A;  5FEY A;  1WES A;  3L1Z B;  4ZUX U;  4PPE A;  4QF2 A;  4B86 C;  2ECT A;  1WEV A;  2JMJ A;  2KWJ A;  2YQM A;  4YAX A;  4B7Y C;  2M3H A;  3N9N A;  5EYA F;  3SHB A;  2ECW A;  3O70 A;  4LK9 A;  2LDR A;  3KQI A;  2JMI A;  2KE1 A;  2H0D B;  1XWH A;  2G43 A;  1WIL A;  5FER A;  3U5M A;  2MT5 A;  4W4U A;  2CT2 A;  2LXP C;  3U5O A;  3O34 A;  2KWK A;  3ZTG A;  5D1L B;  2ECN A;  4S3O B;  2YQL A;  3U5N A;  3HCT A;  3SOW A;  2E6S A;  4IC2 A;  4ZDT A;  2LV9 A;  4UP5 A;  1WEP A;  4WZ3 B;  3M63 A;  3PUQ A;  1VD4 A;  3KV5 A;  3O35 A;  4AP4 A;  4N4F A;  2VPE A;  4Q6F A;  2RI7 A;  2CKL A;  4GB0 A;  2PNX A;  4QF3 A;  1JM7 A;  3DQV R;  1WEU A;  2YUC A;  5C11 A;  1K2F A;  4FIP A;  5D1M B;  2VPD A;  5TAB A;  2KU3 A;  2VP7 A;  4P5O B;  4V3L C;  3ZVY A;  1MM2 A;  3KNV A;  3N9P A;  4YAB A;  1T1H A;  4UI9 B;  5G0F A;  4WA6 A;  1WE9 A;  3O36 A;  3EB5 A;  4A49 A;  5LKU A;  3U5P A;  3HTK C;  3KV6 A;  4FO9 A;  1IYM A;  2M6M A;  2F42 A;  3LQH A;  2VJF B;  2FUU A;  2L75 A;  2FSA A;  3L11 A;  3PHD A;  1WEO A;  2KR4 A;  2G6Q A;  5H9M A;  2VPB A;  1WEQ A;  4AYC A;  4LLB A;  5B76 A;  2G45 A;  2RSD A;  2LRI C;  4X3G A;  2MUM A;  2YRE A;  2ECG A;  3ZPV 1;  5TDW A;  4CCG X;  1E4U A;  4FK5 A;  2KGI A;  2PUY A;  3GV4 A;  4S3O C;  1HYJ A;  1V87 A;  4YC9 A;  4YAD A;  4MSX A;  1Z2Q A;  2MIQ A;  1WEM A;  2F6J A;  1JOC A;  3ASL A;  5FB0 A;  4ZQL A;  4I7C A;  5DKA A;  3C6W A;  2OXQ C;  5G05 B;  1HYI A;  4YBT A;  1X4U A;  3HCS A;  1U6G B;  3O33 A;  2YU4 A;  1MM3 A;  5B8D A;  3O37 A;  5H1U A;  2EGP A;  2IDA A;  3IHP A;  4YBM A;  4R7E A;  5DIN A;  2LGV A;  5LKZ A;  4XI1 A;  4L7X A;  4I7B A;  4LKA A;  2NAA A;  2C2L A;  1ZBD B;  1DVP A;  1N87 A;  5H1V A;  4C9Z A;  2YT5 A;  2MA6 A;  2LXH C;  3SOU A;  3MHS A;  3GL6 A;  5LKT A;  4UP0 A;  5AIT A;  2LGG A;  3M99 A;  4YBS A;  1WEE A;  2YSJ A;  1WIM A;  2L80 A;  2K16 A;  2K17 A;  5B79 A;  5KH3 A;  3MHH A;  2ZET C;  2AN6 A;  5TDR A;  3ZPV E;  1VYX A;  2Y1M A;  2DX8 A;  2L43 A;  3PUR A;  2KGG A;  2Y43 A;  4TKP B;  2ECV A;  5LKX A;  2F6N A;  3T7L A;  3FL2 A;  5KH9 A;  2QIC A;  5I3L A;  2MNY A;  2YW8 A;  5KH7 A;  4WZ2 A;  2QJ0 A;  2H0D A;  2CKL B;  4PTB A;  1RMD A;  4BBQ A;  2YYR A;  5TRB A;  5JG6 A;  5J3X A;  2D8S A;  4O64 A;  4R2Y A;  1CHC A;  1G25 A;  2LN0 A;  3V43 A;  2M85 A;  3LQI A;  4AUQ B;  2KFT A;  3LQJ A;  4A4B A;  1LDJ B;  2KWO A;  4NN2 A;  3VK6 A;  2HYE D;  2UZG A;  3M62 A;  2Y1N A;  2MD7 B;  2VJE B;  4FJC A;  3RPG B;  4GNG A;  2ECJ A;  5TBN A;  2ECI A;  2VNF A;  2CSY A;  1Z6U A;  3QZV A;  2VPG A;  2KWN A;  2E6R A;  4F52 B;  3DPL R;  4V3K C;  4R8P K;  1LDK C;  4AYC B;  1BOR A;  3SOX A;  3N9L A;  2LGK A;  4GNE A;  5H1T A;  2JMD A;  5AIU A;  4LJN A;  2I50 A;  2XEU A;  4AVX A;  4A4C A;  2EOD A;  2M1R A;  3EB6 A;  2K4D A;  4YAT A;  2C2V S;  2L0B A;  3ZNI A;  5G04 B;  3T6R A;  2VJF A;  5B77 A;  2MA5 A;  2HDP A;  3NG2 A;  5B78 A;  4I7D A; 
#chains in the Genus database with same CATH topology
 3E2D A;  4IC3 A;  1FBV A;  1FP0 A;  1WGM A;  5C13 A;  2CSV A;  2YHN A;  2XOY A;  2CRR A;  2YSM A;  1WEN A;  5LCW B;  4N3W A;  2MNZ A;  2KKX A;  1WFK A;  3LRQ A;  2EA6 A;  2QIZ A;  4LAD B;  2KIZ A;  4BHW A;  1VFY A;  1WEW A;  1X4J A;  2JRJ A;  4MVT A;  3O7A A;  3ZVZ B;  5B75 A;  2FUI A;  3RTR B;  3PLW A;  5FB1 A;  1X4I A;  2LQ6 A;  3N9Q A;  2MD8 C;  2XB1 A;  1JM7 B;  2CSZ A;  2VJE A;  3H7H A;  2L5U A;  3I2D A;  2JUN A;  2LGL A;  2FFW A;  4GND A;  1F62 A;  3ZYQ A;  1Z60 A;  2K1J A;  2D8U A;  3N9M A;  5D1K B;  2YUR A;  3C5K A;  2BAY A;  3N9O A;  4CA1 A;  3RPG C;  4A0C D;  4GNF A;  3HCU A;  4L58 A;  5SVI B;  2KRE A;  4WZ0 A;  2KYU A;  3L1X A;  2YHO A;  5FEY A;  1WES A;  3L1Z B;  4ZUX U;  4PPE A;  4QF2 A;  4B86 C;  2ECT A;  2DJA A;  1WEV A;  2JMJ A;  2KWJ A;  2YQM A;  4YAX A;  4B7Y C;  2M3H A;  3N9N A;  3FEH A;  5EYA F;  3SHB A;  2ECW A;  3O70 A;  4LK9 A;  2LDR A;  3KQI A;  2JMI A;  2KE1 A;  2H0D B;  1XWH A;  2G43 A;  1WIL A;  5FER A;  3U5M A;  2MT5 A;  4W4U A;  2CT2 A;  2LXP C;  3U5O A;  2CON A;  3O34 A;  2KWK A;  3ZTG A;  2LAU A;  5D1L B;  2ECN A;  4S3O B;  2YQL A;  3U5N A;  3HCT A;  3SOW A;  2E6S A;  2MKE A;  4IC2 A;  4ZDT A;  2LV9 A;  2EXU A;  4UP5 A;  1WEP A;  4WZ3 B;  3M63 A;  3PUQ A;  3LDY A;  1VD4 A;  3DWD A;  2RR4 A;  3KV5 A;  3O35 A;  4AP4 A;  4N4F A;  2VPE A;  4Q6F A;  2RI7 A;  2CKL A;  4GB0 A;  2PNX A;  4QF3 A;  1JM7 A;  3DQV R;  4O62 A;  1WEU A;  3LJU X;  2E61 A;  2YUC A;  3JUE A;  5C11 A;  1K2F A;  4FIP A;  5D1M B;  1DCQ A;  2L7P A;  2VPD A;  5TAB A;  2KU3 A;  2VP7 A;  4P5O B;  4V3L C;  3ZVY A;  1MM2 A;  3KNV A;  3N9P A;  3FJU B;  4YAB A;  1T1H A;  4UI9 B;  5G0F A;  4WA6 A;  1WE9 A;  4F1P A;  3O36 A;  3EB5 A;  4A49 A;  5LKU A;  3U5P A;  3HTK C;  3KV6 A;  3DDT A;  4FO9 A;  1IYM A;  2M6M A;  2F42 A;  3LQH A;  4H9D A;  2VJF B;  3FM8 C;  2FUU A;  2OWA A;  1MBM A;  4Z0R A;  2L75 A;  2FSA A;  3L11 A;  3PHD A;  1WEO A;  2KR4 A;  2G6Q A;  2EGM A;  5H9M A;  3LVR E;  2VPB A;  2XOC A;  1WEQ A;  4AYC A;  4LLB A;  5B76 A;  3Q1D A;  2CRW A;  2YVR A;  2G45 A;  2RSD A;  2P57 A;  2LRI C;  4X3G A;  2MUM A;  2YRE A;  2ECG A;  3ZPV 1;  5TDW A;  4CCG X;  1E4U A;  4FK5 A;  2KGI A;  2PUY A;  3GV4 A;  4S3O C;  1HYJ A;  2KKY A;  1V87 A;  4YC9 A;  4YAD A;  4MSX A;  1Z2Q A;  2MIQ A;  1WEM A;  2F6J A;  1JOC A;  3ASL A;  2JM3 A;  5FB0 A;  4ZQL A;  4I7C A;  5DKA A;  3C6W A;  2OXQ C;  5G05 B;  3KDE C;  1HYI A;  4YBT A;  1X4U A;  3HCS A;  1U6G B;  3O33 A;  2IQJ A;  2YU4 A;  1MM3 A;  5B8D A;  3O37 A;  5H1U A;  2EGP A;  2IDA A;  3IHP A;  4YBM A;  4R7E A;  5DIN A;  2LGV A;  2M13 A;  5LKZ A;  4LKA A;  4L7X A;  4I7B A;  4XI1 A;  4Z0O A;  2NAA A;  2C2L A;  1ZBD B;  1DVP A;  1N87 A;  5H1V A;  4C9Z A;  2YT5 A;  2MA6 A;  2LXH C;  3SOU A;  3MHS A;  3GL6 A;  5LKT A;  4UP0 A;  5AIT A;  2LGG A;  2DSM A;  3M99 A;  4YBS A;  2XP0 A;  1WEE A;  4OGE A;  2YSJ A;  1WIM A;  2L80 A;  2K16 A;  2K17 A;  5B79 A;  5KH3 A;  3MHH A;  2ZET C;  2AN6 A;  5TDR A;  5SVI A;  3ZPV E;  1VYX A;  2Y1M A;  5K3Q A;  2DX8 A;  2L43 A;  3PUR A;  2KGG A;  2Y43 A;  4TKP B;  2ECV A;  5LKX A;  2F6N A;  3T7L A;  3FL2 A;  5KH9 A;  2QIC A;  5I3L A;  2MNY A;  2YW8 A;  3M7K A;  5KH7 A;  4WZ2 A;  2QJ0 A;  2H0D A;  3SUB A;  2CKL B;  2FD4 A;  4PTB A;  1RMD A;  4BBQ A;  2YYR A;  5TRB A;  5JG6 A;  5J3X A;  4QQ4 A;  2D8S A;  3FAN A;  5SVX A;  4O64 A;  4R2Y A;  1CHC A;  3FAO A;  1G25 A;  2LN0 A;  3V43 A;  2M85 A;  3LQI A;  4AUQ B;  2KFT A;  3LQJ A;  4A4B A;  1LDJ B;  2KWO A;  4NN2 A;  3VK6 A;  2HYE D;  2UZG A;  3M62 A;  2Y1N A;  3MDB C;  2MD7 B;  2VJE B;  4FJC A;  3RPG B;  2XOZ A;  4GNG A;  2ECJ A;  5TBN A;  2ECI A;  3T9K A;  2VNF A;  2CSY A;  1Z6U A;  3QZV A;  2VPG A;  2KWN A;  2E6R A;  4F52 B;  3DPL R;  4V3K C;  4R8P K;  4OGC A;  1LDK C;  4AYC B;  1BOR A;  3SOX A;  3N9L A;  2LGK A;  4GNE A;  5H1T A;  2JMD A;  5AIU A;  3O47 A;  4LJN A;  2I50 A;  2B0O E;  2XEU A;  4AVX A;  5SVY A;  4A4C A;  2EOD A;  2M1R A;  3EB6 A;  2K4D A;  4YAT A;  2C2V S;  2L0B A;  3ZNI A;  5G04 B;  3T6R A;  2VJF A;  5B77 A;  2MA5 A;  3LVQ E;  2HDP A;  3NG2 A;  5B78 A;  4I7D A; 
#chains in the Genus database with same CATH homology
 4IC3 A;  1FBV A;  1FP0 A;  1WGM A;  5C13 A;  2YHN A;  2YSM A;  1WEN A;  5LCW B;  4N3W A;  2MNZ A;  1WFK A;  3LRQ A;  2EA6 A;  2QIZ A;  4LAD B;  2KIZ A;  4BHW A;  1VFY A;  1WEW A;  1X4J A;  2JRJ A;  4MVT A;  3O7A A;  3ZVZ B;  5B75 A;  2FUI A;  3RTR B;  5FB1 A;  1X4I A;  2LQ6 A;  3N9Q A;  2MD8 C;  2XB1 A;  1JM7 B;  2CSZ A;  2VJE A;  2L5U A;  3I2D A;  2LGL A;  4GND A;  1F62 A;  3ZYQ A;  1Z60 A;  2K1J A;  3N9M A;  5D1K B;  2YUR A;  3C5K A;  2BAY A;  3N9O A;  4CA1 A;  3RPG C;  4A0C D;  4GNF A;  3HCU A;  4L58 A;  2KRE A;  4WZ0 A;  2KYU A;  3L1X A;  2YHO A;  5FEY A;  1WES A;  3L1Z B;  4ZUX U;  4PPE A;  4QF2 A;  4B86 C;  2ECT A;  1WEV A;  2JMJ A;  2KWJ A;  2YQM A;  4YAX A;  4B7Y C;  2M3H A;  3N9N A;  5EYA F;  3SHB A;  2ECW A;  3O70 A;  4LK9 A;  2LDR A;  3KQI A;  2JMI A;  2KE1 A;  2H0D B;  1XWH A;  2G43 A;  1WIL A;  5FER A;  3U5M A;  2MT5 A;  4W4U A;  2CT2 A;  2LXP C;  3U5O A;  3O34 A;  2KWK A;  3ZTG A;  5D1L B;  2ECN A;  4S3O B;  2YQL A;  3U5N A;  3HCT A;  3SOW A;  2E6S A;  4IC2 A;  4ZDT A;  2LV9 A;  4UP5 A;  1WEP A;  4WZ3 B;  3M63 A;  3PUQ A;  1VD4 A;  3KV5 A;  3O35 A;  4AP4 A;  4N4F A;  2VPE A;  4Q6F A;  2RI7 A;  2CKL A;  4GB0 A;  2PNX A;  4QF3 A;  1JM7 A;  3DQV R;  1WEU A;  2YUC A;  5C11 A;  1K2F A;  4FIP A;  5D1M B;  2VPD A;  5TAB A;  2KU3 A;  2VP7 A;  4P5O B;  4V3L C;  3ZVY A;  1MM2 A;  3KNV A;  3N9P A;  4YAB A;  1T1H A;  4UI9 B;  5G0F A;  4WA6 A;  1WE9 A;  3O36 A;  3EB5 A;  4A49 A;  5LKU A;  3U5P A;  3HTK C;  3KV6 A;  4FO9 A;  1IYM A;  2M6M A;  2F42 A;  3LQH A;  2VJF B;  2FUU A;  2L75 A;  2FSA A;  3L11 A;  3PHD A;  1WEO A;  2KR4 A;  2G6Q A;  5H9M A;  2VPB A;  1WEQ A;  4AYC A;  4LLB A;  5B76 A;  2G45 A;  2RSD A;  2LRI C;  4X3G A;  2MUM A;  2YRE A;  2ECG A;  3ZPV 1;  5TDW A;  4CCG X;  1E4U A;  4FK5 A;  2KGI A;  2PUY A;  3GV4 A;  4S3O C;  1HYJ A;  1V87 A;  4YC9 A;  4YAD A;  4MSX A;  1Z2Q A;  2MIQ A;  1WEM A;  2F6J A;  1JOC A;  3ASL A;  5FB0 A;  4ZQL A;  4I7C A;  5DKA A;  3C6W A;  2OXQ C;  5G05 B;  1HYI A;  4YBT A;  1X4U A;  3HCS A;  1U6G B;  3O33 A;  2YU4 A;  1MM3 A;  5B8D A;  3O37 A;  5H1U A;  2EGP A;  2IDA A;  3IHP A;  4YBM A;  4R7E A;  5DIN A;  2LGV A;  5LKZ A;  4XI1 A;  4L7X A;  4I7B A;  4LKA A;  2NAA A;  2C2L A;  1ZBD B;  1DVP A;  1N87 A;  5H1V A;  4C9Z A;  2YT5 A;  2MA6 A;  2LXH C;  3SOU A;  3MHS A;  3GL6 A;  5LKT A;  4UP0 A;  5AIT A;  2LGG A;  3M99 A;  4YBS A;  1WEE A;  2YSJ A;  1WIM A;  2L80 A;  2K16 A;  2K17 A;  5B79 A;  5KH3 A;  3MHH A;  2ZET C;  2AN6 A;  5TDR A;  3ZPV E;  1VYX A;  2Y1M A;  2DX8 A;  2L43 A;  3PUR A;  2KGG A;  2Y43 A;  4TKP B;  2ECV A;  5LKX A;  2F6N A;  3T7L A;  3FL2 A;  5KH9 A;  2QIC A;  5I3L A;  2MNY A;  2YW8 A;  5KH7 A;  4WZ2 A;  2QJ0 A;  2H0D A;  2CKL B;  4PTB A;  1RMD A;  4BBQ A;  2YYR A;  5TRB A;  5JG6 A;  5J3X A;  2D8S A;  4O64 A;  4R2Y A;  1CHC A;  1G25 A;  2LN0 A;  3V43 A;  2M85 A;  3LQI A;  4AUQ B;  2KFT A;  3LQJ A;  4A4B A;  1LDJ B;  2KWO A;  4NN2 A;  3VK6 A;  2HYE D;  2UZG A;  3M62 A;  2Y1N A;  2MD7 B;  2VJE B;  4FJC A;  3RPG B;  4GNG A;  2ECJ A;  5TBN A;  2ECI A;  2VNF A;  2CSY A;  1Z6U A;  3QZV A;  2VPG A;  2KWN A;  2E6R A;  4F52 B;  3DPL R;  4V3K C;  4R8P K;  1LDK C;  4AYC B;  1BOR A;  3SOX A;  3N9L A;  2LGK A;  4GNE A;  5H1T A;  2JMD A;  5AIU A;  4LJN A;  2I50 A;  2XEU A;  4AVX A;  4A4C A;  2EOD A;  2M1R A;  3EB6 A;  2K4D A;  4YAT A;  2C2V S;  2L0B A;  3ZNI A;  5G04 B;  3T6R A;  2VJF A;  5B77 A;  2MA5 A;  2HDP A;  3NG2 A;  5B78 A;  4I7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...