4B7YC

Crystal structure of the msl1-msl2 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Msl1-Mediated Dimerization of the Dosage Compensation Complex is Essential for Male X-Chromosome Regulation in Drosophila.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords MALE-SPECIFIC LETHAL 1 HOMOLOG
total genus 33
structure length 115
sequence length 115
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16685 zf-RING_10 zinc RING finger of MSL2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4b7yC00
3U5PA 3MHHA 1WILA 2H0DB 2YREA 3L11A 4MSXA 2XEUA 2LRIC 2C2LA 2L5UA 1X4UA 4GB0A 5H1VA 1V87A 4F52B 1Z6UA 1CHCA 4L7XA 4QF3A 2L80A 4AYCA 1HYIA 2KREA 5TBNA 4I7DA 2QIZA 1FP0A 5B75A 1X4JA 3LQJA 3EB5A 4YATA 3M62A 3ZPV1 5KH9A 4WZ3B 2G45A 4AYCB 1G25A 4GNGA 2KWKA 2UZGA 5FB1A 2MUMA 2YHNA 4R8PK 1LDKC 1WFKA 5C13A 2MIQA 4UP5A 4FJCA 4GNEA 2MD8C 2ECIA 2F6JA 4L58A 4AUQB 5KH3A 2M85A 4LK9A 3T7LA 2QICA 4R7EA 2YW8A 5EYAF 5TABA 4PTBA 4ZUXU 3ZPVE 3ZYQA 2YSMA 4WZ0A 2YQMA 5B79A 1VFYA 1IYMA 5J3XA 4MVTA 3C5KA 2ECVA 5D1MB 2LGLA 3M99A 2VPGA 3C6WA 4I7BA 4NN2A 2DX8A 2KR4A 5TDRA 2YURA 4YADA 2VPBA 2YT5A 2LXPC 1WENA 3RPGB 3VK6A 2JMIA 1WESA 3HCUA 1WEOA 2CKLB 5B77A 2M6MA 2YUCA 4O64A 2RI7A 1ZBDB 4LLBA 3GV4A 4A4BA 1WEMA 3EB6A 3N9PA 3MHSA 5C11A 4YBMA 5DINA 2KYUA 2LGGA 2EGPA 3RTRB 2KE1A 2ECJA 3O35A 4IC3A 4V3LC 2EA6A 4FIPA 4AP4A 2KU3A 2PNXA 2ECNA 4N3WA 4I7CA 4WA6A 2MA5A 2M1RA 2ECGA 1WEQA 3HCTA 1WIMA 3ZVYA 1F62A 3SOWA 2L75A 3DPLR 5I3LA 3L1ZB 3QZVA 2LXHC 3U5NA 1VD4A 5B76A 4UI9B 5FEYA 1JM7A 4LKAA 4FO9A 3ZNIA 4V3KC 3ZVZB 1WEPA 2KWNA 2M3HA 5TDWA 1T1HA 2CKLA 2LV9A 1DVPA 4A4CA 5JG6A 1HYJA 2KWOA 4QF2A 4A0CD 5DKAA 2YQLA 3N9MA 4PPEA 2ECTA 5G05B 2ECWA 4LADB 5H1TA 1WEVA 2VJFB 4W4UA 2CSZA 4A49A 1XWHA 3FL2A 2LGVA 1K2FA 4IC2A 1Z2QA 4BHWA 4S3OB 4B86C 2K16A 5FB0A 4R2YA 4N4FA 2K17A 4X3GA 2H0DA 4YC9A 2ZETC 2D8SA 4TKPB 2QJ0A 5TRBA 2HDPA 2VP7A 3LQHA 3SOXA 3T6RA 3N9OA 2RSDA 1WEEA 5LCWB 2F42A 2OXQC 2XB1A 3PHDA 3KV5A 4AVXA 3U5OA 5AIUA 5H1UA 2VPDA 3O37A 1WEWA 2EODA 2NAAA 3NG2A 4BBQA 1MM3A 3HCSA 3LQIA 2FSAA 3O34A 3LRQA 4FK5A 4XI1A 2FUIA 2C2VS 3M63A 4P5OB 2VJFA 2L0BA 5KH7A 2K4DA 2CSYA 3N9LA 3O36A 2JMJA 1WE9A 4YAXA 5AITA 5LKXA 2VNFA 3O7AA 2VJEB 3ZTGA 2LDRA 2KGIA 1JM7B 2AN6A 3PUQA 1FBVA 2G6QA 2G43A 5FERA 4UP0A 3GL6A 3ASLA 1Z60A 5B78A 4LJNA 3KQIA 5H9MA 1RMDA 1MM2A 2YYRA 5G0FA 4YBSA 3V43A 1JOCA 3RPGC 4GNFA 5D1LB 4ZQLA 4CA1A 2KIZA 4WZ2A 2FUUA 2YSJA 3PURA 2KWJA 2Y43A 1VYXA 3O70A 2YU4A 4YABA 3KV6A 2Y1NA 2JMDA 2K1JA 3KNVA 4ZDTA 3IHPA 4S3OC 2VJEA 2LN0A 1X4IA 2E6SA 3L1XA 5LKTA 2F6NA 3SOUA 2KGGA 2MT5A 3HTKC 2E6RA 3SHBA 5LKZA 2HYED 3N9NA 2MNYA 5G04B 2BAYA 2PUYA 2YHOA 3U5MA 3I2DA 3N9QA 5LKUA 2I50A 2KFTA 1E4UA 4GNDA 5D1KB 1U6GB 4YBTA 4B7YC 1WGMA 4Q6FA 2VPEA 2LGKA 4C9ZA 1WEUA 2MNZA 1BORA 5B8DA 3DQVR 2Y1MA 2JRJA 2CT2A 2MD7B 2IDAA 2LQ6A 2MA6A 1N87A 4CCGX 3O33A 2L43A 1LDJB
chains in the Genus database with same CATH superfamily
3U5PA 3MHHA 1WILA 2L7PA 2H0DB 3Q1DA 2YREA 3L11A 4MSXA 2DSMA 2XEUA 2LRIC 2C2LA 2L5UA 2JUNA 1X4UA 4GB0A 5H1VA 5SVXA 1V87A 4F52B 1Z6UA 2XP0A 1CHCA 4L7XA 4QF3A 2L80A 4AYCA 1HYIA 2KREA 2OWAA 5TBNA 4I7DA 2QIZA 2D8UA 1FP0A 5B75A 1X4JA 3LQJA 3EB5A 4YATA 3M62A 3ZPV1 5KH9A 2M13A 4WZ3B 2G45A 4AYCB 1G25A 4GNGA 2KWKA 2UZGA 5FB1A 2KKXA 2MUMA 2YHNA 4R8PK 1LDKC 1WFKA 5C13A 2MIQA 3FAOA 4UP5A 4FJCA 4GNEA 2MD8C 2ECIA 2F6JA 4L58A 4AUQB 5KH3A 2M85A 4LK9A 3T7LA 2QICA 4R7EA 2YW8A 5EYAF 5TABA 4PTBA 4ZUXU 3ZPVE 3ZYQA 2YSMA 4WZ0A 2YQMA 5B79A 1VFYA 1IYMA 5J3XA 4MVTA 3C5KA 5D1MB 2ECVA 2LGLA 3M99A 2VPGA 3C6WA 3H7HA 4I7BA 5SVIA 4NN2A 2DX8A 2KR4A 5TDRA 2XOCA 2YURA 4YADA 2VPBA 2YT5A 2LXPC 3T9KA 1WENA 3RPGB 3VK6A 2JMIA 1WESA 3HCUA 1WEOA 2CKLB 2P57A 5B77A 2M6MA 2YUCA 3DWDA 4O64A 2CSVA 2RI7A 1ZBDB 4LLBA 1MBMA 3GV4A 4A4BA 1WEMA 3EB6A 3N9PA 3MHSA 5C11A 4YBMA 5DINA 2KYUA 2LGGA 2EGPA 4Z0RA 4OGCA 3RTRB 2EXUA 2KE1A 2ECJA 3O35A 3LVQE 4IC3A 4V3LC 2EA6A 4FIPA 4AP4A 3FEHA 2KU3A 2PNXA 2ECNA 2CONA 4N3WA 4I7CA 3DDTA 3LJUX 4WA6A 2MA5A 2M1RA 2ECGA 1WEQA 3HCTA 3FJUB 1WIMA 3ZVYA 1F62A 3SOWA 2L75A 3DPLR 5I3LA 3L1ZB 3QZVA 2LXHC 4F1PA 3U5NA 1VD4A 5B76A 4UI9B 5FEYA 1JM7A 4LKAA 4FO9A 2FD4A 3ZNIA 4V3KC 3ZVZB 1WEPA 2IQJA 2KWNA 5K3QA 2M3HA 5TDWA 1T1HA 2CKLA 2LV9A 1DVPA 4A4CA 5JG6A 1HYJA 2FFWA 2KWOA 2E61A 4QF2A 4A0CD 5DKAA 2YQLA 3N9MA 5SVIB 4PPEA 2ECTA 5G05B 2ECWA 4LADB 5H1TA 1WEVA 2VJFB 4W4UA 2CSZA 5SVYA 4A49A 4QQ4A 1XWHA 3FL2A 2LGVA 1K2FA 4IC2A 1Z2QA 4BHWA 4S3OB 4B86C 3MDBC 2K16A 5FB0A 4R2YA 4N4FA 2K17A 4X3GA 2H0DA 4YC9A 2ZETC 2D8SA 3SUBA 4TKPB 2QJ0A 5TRBA 2HDPA 2VP7A 3LQHA 3SOXA 3T6RA 3N9OA 2RSDA 2RR4A 1WEEA 4Z0OA 5LCWB 2CRRA 2F42A 2OXQC 2XB1A 3PHDA 3KV5A 4AVXA 3U5OA 5AIUA 5H1UA 2VPDA 3O37A 2KKYA 1WEWA 2EODA 2NAAA 3NG2A 2B0OE 4BBQA 1MM3A 3HCSA 3LQIA 2FSAA 3O34A 3LRQA 4FK5A 4XI1A 2FUIA 2C2VS 3M63A 4P5OB 2VJFA 2L0BA 5KH7A 2K4DA 2CRWA 2CSYA 3N9LA 3O36A 2JMJA 1WE9A 3LVRE 3JUEA 1DCQA 4YAXA 5AITA 5LKXA 2VNFA 4OGEA 3O7AA 2VJEB 3ZTGA 2LDRA 2KGIA 1JM7B 2AN6A 3PUQA 1FBVA 2G6QA 2G43A 5FERA 4UP0A 3GL6A 3ASLA 1Z60A 5B78A 4LJNA 3KQIA 5H9MA 1RMDA 1MM2A 2YYRA 5G0FA 4YBSA 3V43A 3KDEC 1JOCA 3RPGC 4GNFA 5D1LB 4ZQLA 4CA1A 2YVRA 2KIZA 4WZ2A 2FUUA 2YSJA 3PURA 2KWJA 2Y43A 1VYXA 3O70A 2YU4A 4YABA 3KV6A 2Y1NA 2JMDA 2K1JA 3KNVA 2JM3A 4ZDTA 3M7KA 3IHPA 4S3OC 2LAUA 2VJEA 2LN0A 1X4IA 2E6SA 3L1XA 5LKTA 2F6NA 3LDYA 3SOUA 2MKEA 2KGGA 2MT5A 3HTKC 2E6RA 3SHBA 5LKZA 2EGMA 3PLWA 4O62A 2HYED 3N9NA 2MNYA 5G04B 3O47A 2BAYA 2PUYA 3FANA 2YHOA 3U5MA 3I2DA 3N9QA 5LKUA 2I50A 2XOZA 2KFTA 1E4UA 4GNDA 5D1KB 1U6GB 4YBTA 4B7YC 1WGMA 4Q6FA 2VPEA 4H9DA 2LGKA 3E2DA 4C9ZA 1WEUA 2MNZA 1BORA 5B8DA 3DQVR 2DJAA 2Y1MA 2JRJA 2CT2A 2MD7B 2IDAA 2LQ6A 2MA6A 2XOYA 3FM8C 1N87A 4CCGX 3O33A 2L43A 1LDJB
chains in the Genus database with same CATH topology
3U5PA 3MHHA 1WILA 2H0DB 2YREA 3L11A 4MSXA 2XEUA 2LRIC 2C2LA 2L5UA 1X4UA 4GB0A 5H1VA 1V87A 4F52B 1Z6UA 1CHCA 4L7XA 4QF3A 2L80A 4AYCA 1HYIA 2KREA 5TBNA 4I7DA 2QIZA 1FP0A 5B75A 1X4JA 3LQJA 3EB5A 4YATA 3M62A 3ZPV1 5KH9A 4WZ3B 2G45A 4AYCB 1G25A 4GNGA 2KWKA 2UZGA 5FB1A 2MUMA 2YHNA 4R8PK 1LDKC 1WFKA 5C13A 2MIQA 4UP5A 4FJCA 4GNEA 2MD8C 2ECIA 2F6JA 4L58A 4AUQB 5KH3A 2M85A 4LK9A 3T7LA 2QICA 4R7EA 2YW8A 5EYAF 5TABA 4PTBA 4ZUXU 3ZPVE 3ZYQA 2YSMA 4WZ0A 2YQMA 5B79A 1VFYA 1IYMA 5J3XA 4MVTA 3C5KA 2ECVA 5D1MB 2LGLA 3M99A 2VPGA 3C6WA 4I7BA 4NN2A 2DX8A 2KR4A 5TDRA 2YURA 4YADA 2VPBA 2YT5A 2LXPC 1WENA 3RPGB 3VK6A 2JMIA 1WESA 3HCUA 1WEOA 2CKLB 5B77A 2M6MA 2YUCA 4O64A 2RI7A 1ZBDB 4LLBA 3GV4A 4A4BA 1WEMA 3EB6A 3N9PA 3MHSA 5C11A 4YBMA 5DINA 2KYUA 2LGGA 2EGPA 3RTRB 2KE1A 2ECJA 3O35A 4IC3A 4V3LC 2EA6A 4FIPA 4AP4A 2KU3A 2PNXA 2ECNA 4N3WA 4I7CA 4WA6A 2MA5A 2M1RA 2ECGA 1WEQA 3HCTA 1WIMA 3ZVYA 1F62A 3SOWA 2L75A 3DPLR 5I3LA 3L1ZB 3QZVA 2LXHC 3U5NA 1VD4A 5B76A 4UI9B 5FEYA 1JM7A 4LKAA 4FO9A 3ZNIA 4V3KC 3ZVZB 1WEPA 2KWNA 2M3HA 5TDWA 1T1HA 2CKLA 2LV9A 1DVPA 4A4CA 5JG6A 1HYJA 2KWOA 4QF2A 4A0CD 5DKAA 2YQLA 3N9MA 4PPEA 2ECTA 5G05B 2ECWA 4LADB 5H1TA 1WEVA 2VJFB 4W4UA 2CSZA 4A49A 1XWHA 3FL2A 2LGVA 1K2FA 4IC2A 1Z2QA 4BHWA 4S3OB 4B86C 2K16A 5FB0A 4R2YA 4N4FA 2K17A 4X3GA 2H0DA 4YC9A 2ZETC 2D8SA 4TKPB 2QJ0A 5TRBA 2HDPA 2VP7A 3LQHA 3SOXA 3T6RA 3N9OA 2RSDA 1WEEA 5LCWB 2F42A 2OXQC 2XB1A 3PHDA 3KV5A 4AVXA 3U5OA 5AIUA 5H1UA 2VPDA 3O37A 1WEWA 2EODA 2NAAA 3NG2A 4BBQA 1MM3A 3HCSA 3LQIA 2FSAA 3O34A 3LRQA 4FK5A 4XI1A 2FUIA 2C2VS 3M63A 4P5OB 2VJFA 2L0BA 5KH7A 2K4DA 2CSYA 3N9LA 3O36A 2JMJA 1WE9A 4YAXA 5AITA 5LKXA 2VNFA 3O7AA 2VJEB 3ZTGA 2LDRA 2KGIA 1JM7B 2AN6A 3PUQA 1FBVA 2G6QA 2G43A 5FERA 4UP0A 3GL6A 3ASLA 1Z60A 5B78A 4LJNA 3KQIA 5H9MA 1RMDA 1MM2A 2YYRA 5G0FA 4YBSA 3V43A 1JOCA 3RPGC 4GNFA 5D1LB 4ZQLA 4CA1A 2KIZA 4WZ2A 2FUUA 2YSJA 3PURA 2KWJA 2Y43A 1VYXA 3O70A 2YU4A 4YABA 3KV6A 2Y1NA 2JMDA 2K1JA 3KNVA 4ZDTA 3IHPA 4S3OC 2VJEA 2LN0A 1X4IA 2E6SA 3L1XA 5LKTA 2F6NA 3SOUA 2KGGA 2MT5A 3HTKC 2E6RA 3SHBA 5LKZA 2HYED 3N9NA 2MNYA 5G04B 2BAYA 2PUYA 2YHOA 3U5MA 3I2DA 3N9QA 5LKUA 2I50A 2KFTA 1E4UA 4GNDA 5D1KB 1U6GB 4YBTA 4B7YC 1WGMA 4Q6FA 2VPEA 2LGKA 4C9ZA 1WEUA 2MNZA 1BORA 5B8DA 3DQVR 2Y1MA 2JRJA 2CT2A 2MD7B 2IDAA 2LQ6A 2MA6A 1N87A 4CCGX 3O33A 2L43A 1LDJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5P A;  3MHH A;  1WIL A;  2H0D B;  2YRE A;  3L11 A;  4MSX A;  2XEU A;  2LRI C;  2C2L A;  2L5U A;  1X4U A;  4GB0 A;  5H1V A;  1V87 A;  4F52 B;  1Z6U A;  1CHC A;  4L7X A;  4QF3 A;  2L80 A;  4AYC A;  1HYI A;  2KRE A;  5TBN A;  4I7D A;  2QIZ A;  1FP0 A;  5B75 A;  1X4J A;  3LQJ A;  3EB5 A;  4YAT A;  3M62 A;  3ZPV 1;  5KH9 A;  4WZ3 B;  2G45 A;  4AYC B;  1G25 A;  4GNG A;  2KWK A;  2UZG A;  5FB1 A;  2MUM A;  2YHN A;  4R8P K;  1LDK C;  1WFK A;  5C13 A;  2MIQ A;  4UP5 A;  4FJC A;  4GNE A;  2MD8 C;  2ECI A;  2F6J A;  4L58 A;  4AUQ B;  5KH3 A;  2M85 A;  4LK9 A;  3T7L A;  2QIC A;  4R7E A;  2YW8 A;  5EYA F;  5TAB A;  4PTB A;  4ZUX U;  3ZPV E;  3ZYQ A;  2YSM A;  4WZ0 A;  2YQM A;  5B79 A;  1VFY A;  1IYM A;  5J3X A;  4MVT A;  3C5K A;  2ECV A;  5D1M B;  2LGL A;  3M99 A;  2VPG A;  3C6W A;  4I7B A;  4NN2 A;  2DX8 A;  2KR4 A;  5TDR A;  2YUR A;  4YAD A;  2VPB A;  2YT5 A;  2LXP C;  1WEN A;  3RPG B;  3VK6 A;  2JMI A;  1WES A;  3HCU A;  1WEO A;  2CKL B;  5B77 A;  2M6M A;  2YUC A;  4O64 A;  2RI7 A;  1ZBD B;  4LLB A;  3GV4 A;  4A4B A;  1WEM A;  3EB6 A;  3N9P A;  3MHS A;  5C11 A;  4YBM A;  5DIN A;  2KYU A;  2LGG A;  2EGP A;  3RTR B;  2KE1 A;  2ECJ A;  3O35 A;  4IC3 A;  4V3L C;  2EA6 A;  4FIP A;  4AP4 A;  2KU3 A;  2PNX A;  2ECN A;  4N3W A;  4I7C A;  4WA6 A;  2MA5 A;  2M1R A;  2ECG A;  1WEQ A;  3HCT A;  1WIM A;  3ZVY A;  1F62 A;  3SOW A;  2L75 A;  3DPL R;  5I3L A;  3L1Z B;  3QZV A;  2LXH C;  3U5N A;  1VD4 A;  5B76 A;  4UI9 B;  5FEY A;  1JM7 A;  4LKA A;  4FO9 A;  3ZNI A;  4V3K C;  3ZVZ B;  1WEP A;  2KWN A;  2M3H A;  5TDW A;  1T1H A;  2CKL A;  2LV9 A;  1DVP A;  4A4C A;  5JG6 A;  1HYJ A;  2KWO A;  4QF2 A;  4A0C D;  5DKA A;  2YQL A;  3N9M A;  4PPE A;  2ECT A;  5G05 B;  2ECW A;  4LAD B;  5H1T A;  1WEV A;  2VJF B;  4W4U A;  2CSZ A;  4A49 A;  1XWH A;  3FL2 A;  2LGV A;  1K2F A;  4IC2 A;  1Z2Q A;  4BHW A;  4S3O B;  4B86 C;  2K16 A;  5FB0 A;  4R2Y A;  4N4F A;  2K17 A;  4X3G A;  2H0D A;  4YC9 A;  2ZET C;  2D8S A;  4TKP B;  2QJ0 A;  5TRB A;  2HDP A;  2VP7 A;  3LQH A;  3SOX A;  3T6R A;  3N9O A;  2RSD A;  1WEE A;  5LCW B;  2F42 A;  2OXQ C;  2XB1 A;  3PHD A;  3KV5 A;  4AVX A;  3U5O A;  5AIU A;  5H1U A;  2VPD A;  3O37 A;  1WEW A;  2EOD A;  2NAA A;  3NG2 A;  4BBQ A;  1MM3 A;  3HCS A;  3LQI A;  2FSA A;  3O34 A;  3LRQ A;  4FK5 A;  4XI1 A;  2FUI A;  2C2V S;  3M63 A;  4P5O B;  2VJF A;  2L0B A;  5KH7 A;  2K4D A;  2CSY A;  3N9L A;  3O36 A;  2JMJ A;  1WE9 A;  4YAX A;  5AIT A;  5LKX A;  2VNF A;  3O7A A;  2VJE B;  3ZTG A;  2LDR A;  2KGI A;  1JM7 B;  2AN6 A;  3PUQ A;  1FBV A;  2G6Q A;  2G43 A;  5FER A;  4UP0 A;  3GL6 A;  3ASL A;  1Z60 A;  5B78 A;  4LJN A;  3KQI A;  5H9M A;  1RMD A;  1MM2 A;  2YYR A;  5G0F A;  4YBS A;  3V43 A;  1JOC A;  3RPG C;  4GNF A;  5D1L B;  4ZQL A;  4CA1 A;  2KIZ A;  4WZ2 A;  2FUU A;  2YSJ A;  3PUR A;  2KWJ A;  2Y43 A;  1VYX A;  3O70 A;  2YU4 A;  4YAB A;  3KV6 A;  2Y1N A;  2JMD A;  2K1J A;  3KNV A;  4ZDT A;  3IHP A;  4S3O C;  2VJE A;  2LN0 A;  1X4I A;  2E6S A;  3L1X A;  5LKT A;  2F6N A;  3SOU A;  2KGG A;  2MT5 A;  3HTK C;  2E6R A;  3SHB A;  5LKZ A;  2HYE D;  3N9N A;  2MNY A;  5G04 B;  2BAY A;  2PUY A;  2YHO A;  3U5M A;  3I2D A;  3N9Q A;  5LKU A;  2I50 A;  2KFT A;  1E4U A;  4GND A;  5D1K B;  1U6G B;  4YBT A;  4B7Y C;  1WGM A;  4Q6F A;  2VPE A;  2LGK A;  4C9Z A;  1WEU A;  2MNZ A;  1BOR A;  5B8D A;  3DQV R;  2Y1M A;  2JRJ A;  2CT2 A;  2MD7 B;  2IDA A;  2LQ6 A;  2MA6 A;  1N87 A;  4CCG X;  3O33 A;  2L43 A;  1LDJ B; 
#chains in the Genus database with same CATH topology
 3U5P A;  3MHH A;  1WIL A;  2L7P A;  2H0D B;  3Q1D A;  2YRE A;  3L11 A;  4MSX A;  2DSM A;  2XEU A;  2LRI C;  2C2L A;  2L5U A;  2JUN A;  1X4U A;  4GB0 A;  5H1V A;  5SVX A;  1V87 A;  4F52 B;  1Z6U A;  2XP0 A;  1CHC A;  4L7X A;  4QF3 A;  2L80 A;  4AYC A;  1HYI A;  2KRE A;  2OWA A;  5TBN A;  4I7D A;  2QIZ A;  2D8U A;  1FP0 A;  5B75 A;  1X4J A;  3LQJ A;  3EB5 A;  4YAT A;  3M62 A;  3ZPV 1;  5KH9 A;  2M13 A;  4WZ3 B;  2G45 A;  4AYC B;  1G25 A;  4GNG A;  2KWK A;  2UZG A;  5FB1 A;  2KKX A;  2MUM A;  2YHN A;  4R8P K;  1LDK C;  1WFK A;  5C13 A;  2MIQ A;  3FAO A;  4UP5 A;  4FJC A;  4GNE A;  2MD8 C;  2ECI A;  2F6J A;  4L58 A;  4AUQ B;  5KH3 A;  2M85 A;  4LK9 A;  3T7L A;  2QIC A;  4R7E A;  2YW8 A;  5EYA F;  5TAB A;  4PTB A;  4ZUX U;  3ZPV E;  3ZYQ A;  2YSM A;  4WZ0 A;  2YQM A;  5B79 A;  1VFY A;  1IYM A;  5J3X A;  4MVT A;  3C5K A;  5D1M B;  2ECV A;  2LGL A;  3M99 A;  2VPG A;  3C6W A;  3H7H A;  4I7B A;  5SVI A;  4NN2 A;  2DX8 A;  2KR4 A;  5TDR A;  2XOC A;  2YUR A;  4YAD A;  2VPB A;  2YT5 A;  2LXP C;  3T9K A;  1WEN A;  3RPG B;  3VK6 A;  2JMI A;  1WES A;  3HCU A;  1WEO A;  2CKL B;  2P57 A;  5B77 A;  2M6M A;  2YUC A;  3DWD A;  4O64 A;  2CSV A;  2RI7 A;  1ZBD B;  4LLB A;  1MBM A;  3GV4 A;  4A4B A;  1WEM A;  3EB6 A;  3N9P A;  3MHS A;  5C11 A;  4YBM A;  5DIN A;  2KYU A;  2LGG A;  2EGP A;  4Z0R A;  4OGC A;  3RTR B;  2EXU A;  2KE1 A;  2ECJ A;  3O35 A;  3LVQ E;  4IC3 A;  4V3L C;  2EA6 A;  4FIP A;  4AP4 A;  3FEH A;  2KU3 A;  2PNX A;  2ECN A;  2CON A;  4N3W A;  4I7C A;  3DDT A;  3LJU X;  4WA6 A;  2MA5 A;  2M1R A;  2ECG A;  1WEQ A;  3HCT A;  3FJU B;  1WIM A;  3ZVY A;  1F62 A;  3SOW A;  2L75 A;  3DPL R;  5I3L A;  3L1Z B;  3QZV A;  2LXH C;  4F1P A;  3U5N A;  1VD4 A;  5B76 A;  4UI9 B;  5FEY A;  1JM7 A;  4LKA A;  4FO9 A;  2FD4 A;  3ZNI A;  4V3K C;  3ZVZ B;  1WEP A;  2IQJ A;  2KWN A;  5K3Q A;  2M3H A;  5TDW A;  1T1H A;  2CKL A;  2LV9 A;  1DVP A;  4A4C A;  5JG6 A;  1HYJ A;  2FFW A;  2KWO A;  2E61 A;  4QF2 A;  4A0C D;  5DKA A;  2YQL A;  3N9M A;  5SVI B;  4PPE A;  2ECT A;  5G05 B;  2ECW A;  4LAD B;  5H1T A;  1WEV A;  2VJF B;  4W4U A;  2CSZ A;  5SVY A;  4A49 A;  4QQ4 A;  1XWH A;  3FL2 A;  2LGV A;  1K2F A;  4IC2 A;  1Z2Q A;  4BHW A;  4S3O B;  4B86 C;  3MDB C;  2K16 A;  5FB0 A;  4R2Y A;  4N4F A;  2K17 A;  4X3G A;  2H0D A;  4YC9 A;  2ZET C;  2D8S A;  3SUB A;  4TKP B;  2QJ0 A;  5TRB A;  2HDP A;  2VP7 A;  3LQH A;  3SOX A;  3T6R A;  3N9O A;  2RSD A;  2RR4 A;  1WEE A;  4Z0O A;  5LCW B;  2CRR A;  2F42 A;  2OXQ C;  2XB1 A;  3PHD A;  3KV5 A;  4AVX A;  3U5O A;  5AIU A;  5H1U A;  2VPD A;  3O37 A;  2KKY A;  1WEW A;  2EOD A;  2NAA A;  3NG2 A;  2B0O E;  4BBQ A;  1MM3 A;  3HCS A;  3LQI A;  2FSA A;  3O34 A;  3LRQ A;  4FK5 A;  4XI1 A;  2FUI A;  2C2V S;  3M63 A;  4P5O B;  2VJF A;  2L0B A;  5KH7 A;  2K4D A;  2CRW A;  2CSY A;  3N9L A;  3O36 A;  2JMJ A;  1WE9 A;  3LVR E;  3JUE A;  1DCQ A;  4YAX A;  5AIT A;  5LKX A;  2VNF A;  4OGE A;  3O7A A;  2VJE B;  3ZTG A;  2LDR A;  2KGI A;  1JM7 B;  2AN6 A;  3PUQ A;  1FBV A;  2G6Q A;  2G43 A;  5FER A;  4UP0 A;  3GL6 A;  3ASL A;  1Z60 A;  5B78 A;  4LJN A;  3KQI A;  5H9M A;  1RMD A;  1MM2 A;  2YYR A;  5G0F A;  4YBS A;  3V43 A;  3KDE C;  1JOC A;  3RPG C;  4GNF A;  5D1L B;  4ZQL A;  4CA1 A;  2YVR A;  2KIZ A;  4WZ2 A;  2FUU A;  2YSJ A;  3PUR A;  2KWJ A;  2Y43 A;  1VYX A;  3O70 A;  2YU4 A;  4YAB A;  3KV6 A;  2Y1N A;  2JMD A;  2K1J A;  3KNV A;  2JM3 A;  4ZDT A;  3M7K A;  3IHP A;  4S3O C;  2LAU A;  2VJE A;  2LN0 A;  1X4I A;  2E6S A;  3L1X A;  5LKT A;  2F6N A;  3LDY A;  3SOU A;  2MKE A;  2KGG A;  2MT5 A;  3HTK C;  2E6R A;  3SHB A;  5LKZ A;  2EGM A;  3PLW A;  4O62 A;  2HYE D;  3N9N A;  2MNY A;  5G04 B;  3O47 A;  2BAY A;  2PUY A;  3FAN A;  2YHO A;  3U5M A;  3I2D A;  3N9Q A;  5LKU A;  2I50 A;  2XOZ A;  2KFT A;  1E4U A;  4GND A;  5D1K B;  1U6G B;  4YBT A;  4B7Y C;  1WGM A;  4Q6F A;  2VPE A;  4H9D A;  2LGK A;  3E2D A;  4C9Z A;  1WEU A;  2MNZ A;  1BOR A;  5B8D A;  3DQV R;  2DJA A;  2Y1M A;  2JRJ A;  2CT2 A;  2MD7 B;  2IDA A;  2LQ6 A;  2MA6 A;  2XOY A;  3FM8 C;  1N87 A;  4CCG X;  3O33 A;  2L43 A;  1LDJ B; 
#chains in the Genus database with same CATH homology
 3U5P A;  3MHH A;  1WIL A;  2H0D B;  2YRE A;  3L11 A;  4MSX A;  2XEU A;  2LRI C;  2C2L A;  2L5U A;  1X4U A;  4GB0 A;  5H1V A;  1V87 A;  4F52 B;  1Z6U A;  1CHC A;  4L7X A;  4QF3 A;  2L80 A;  4AYC A;  1HYI A;  2KRE A;  5TBN A;  4I7D A;  2QIZ A;  1FP0 A;  5B75 A;  1X4J A;  3LQJ A;  3EB5 A;  4YAT A;  3M62 A;  3ZPV 1;  5KH9 A;  4WZ3 B;  2G45 A;  4AYC B;  1G25 A;  4GNG A;  2KWK A;  2UZG A;  5FB1 A;  2MUM A;  2YHN A;  4R8P K;  1LDK C;  1WFK A;  5C13 A;  2MIQ A;  4UP5 A;  4FJC A;  4GNE A;  2MD8 C;  2ECI A;  2F6J A;  4L58 A;  4AUQ B;  5KH3 A;  2M85 A;  4LK9 A;  3T7L A;  2QIC A;  4R7E A;  2YW8 A;  5EYA F;  5TAB A;  4PTB A;  4ZUX U;  3ZPV E;  3ZYQ A;  2YSM A;  4WZ0 A;  2YQM A;  5B79 A;  1VFY A;  1IYM A;  5J3X A;  4MVT A;  3C5K A;  2ECV A;  5D1M B;  2LGL A;  3M99 A;  2VPG A;  3C6W A;  4I7B A;  4NN2 A;  2DX8 A;  2KR4 A;  5TDR A;  2YUR A;  4YAD A;  2VPB A;  2YT5 A;  2LXP C;  1WEN A;  3RPG B;  3VK6 A;  2JMI A;  1WES A;  3HCU A;  1WEO A;  2CKL B;  5B77 A;  2M6M A;  2YUC A;  4O64 A;  2RI7 A;  1ZBD B;  4LLB A;  3GV4 A;  4A4B A;  1WEM A;  3EB6 A;  3N9P A;  3MHS A;  5C11 A;  4YBM A;  5DIN A;  2KYU A;  2LGG A;  2EGP A;  3RTR B;  2KE1 A;  2ECJ A;  3O35 A;  4IC3 A;  4V3L C;  2EA6 A;  4FIP A;  4AP4 A;  2KU3 A;  2PNX A;  2ECN A;  4N3W A;  4I7C A;  4WA6 A;  2MA5 A;  2M1R A;  2ECG A;  1WEQ A;  3HCT A;  1WIM A;  3ZVY A;  1F62 A;  3SOW A;  2L75 A;  3DPL R;  5I3L A;  3L1Z B;  3QZV A;  2LXH C;  3U5N A;  1VD4 A;  5B76 A;  4UI9 B;  5FEY A;  1JM7 A;  4LKA A;  4FO9 A;  3ZNI A;  4V3K C;  3ZVZ B;  1WEP A;  2KWN A;  2M3H A;  5TDW A;  1T1H A;  2CKL A;  2LV9 A;  1DVP A;  4A4C A;  5JG6 A;  1HYJ A;  2KWO A;  4QF2 A;  4A0C D;  5DKA A;  2YQL A;  3N9M A;  4PPE A;  2ECT A;  5G05 B;  2ECW A;  4LAD B;  5H1T A;  1WEV A;  2VJF B;  4W4U A;  2CSZ A;  4A49 A;  1XWH A;  3FL2 A;  2LGV A;  1K2F A;  4IC2 A;  1Z2Q A;  4BHW A;  4S3O B;  4B86 C;  2K16 A;  5FB0 A;  4R2Y A;  4N4F A;  2K17 A;  4X3G A;  2H0D A;  4YC9 A;  2ZET C;  2D8S A;  4TKP B;  2QJ0 A;  5TRB A;  2HDP A;  2VP7 A;  3LQH A;  3SOX A;  3T6R A;  3N9O A;  2RSD A;  1WEE A;  5LCW B;  2F42 A;  2OXQ C;  2XB1 A;  3PHD A;  3KV5 A;  4AVX A;  3U5O A;  5AIU A;  5H1U A;  2VPD A;  3O37 A;  1WEW A;  2EOD A;  2NAA A;  3NG2 A;  4BBQ A;  1MM3 A;  3HCS A;  3LQI A;  2FSA A;  3O34 A;  3LRQ A;  4FK5 A;  4XI1 A;  2FUI A;  2C2V S;  3M63 A;  4P5O B;  2VJF A;  2L0B A;  5KH7 A;  2K4D A;  2CSY A;  3N9L A;  3O36 A;  2JMJ A;  1WE9 A;  4YAX A;  5AIT A;  5LKX A;  2VNF A;  3O7A A;  2VJE B;  3ZTG A;  2LDR A;  2KGI A;  1JM7 B;  2AN6 A;  3PUQ A;  1FBV A;  2G6Q A;  2G43 A;  5FER A;  4UP0 A;  3GL6 A;  3ASL A;  1Z60 A;  5B78 A;  4LJN A;  3KQI A;  5H9M A;  1RMD A;  1MM2 A;  2YYR A;  5G0F A;  4YBS A;  3V43 A;  1JOC A;  3RPG C;  4GNF A;  5D1L B;  4ZQL A;  4CA1 A;  2KIZ A;  4WZ2 A;  2FUU A;  2YSJ A;  3PUR A;  2KWJ A;  2Y43 A;  1VYX A;  3O70 A;  2YU4 A;  4YAB A;  3KV6 A;  2Y1N A;  2JMD A;  2K1J A;  3KNV A;  4ZDT A;  3IHP A;  4S3O C;  2VJE A;  2LN0 A;  1X4I A;  2E6S A;  3L1X A;  5LKT A;  2F6N A;  3SOU A;  2KGG A;  2MT5 A;  3HTK C;  2E6R A;  3SHB A;  5LKZ A;  2HYE D;  3N9N A;  2MNY A;  5G04 B;  2BAY A;  2PUY A;  2YHO A;  3U5M A;  3I2D A;  3N9Q A;  5LKU A;  2I50 A;  2KFT A;  1E4U A;  4GND A;  5D1K B;  1U6G B;  4YBT A;  4B7Y C;  1WGM A;  4Q6F A;  2VPE A;  2LGK A;  4C9Z A;  1WEU A;  2MNZ A;  1BOR A;  5B8D A;  3DQV R;  2Y1M A;  2JRJ A;  2CT2 A;  2MD7 B;  2IDA A;  2LQ6 A;  2MA6 A;  1N87 A;  4CCG X;  3O33 A;  2L43 A;  1LDJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...