4B7YC

Crystal structure of the msl1-msl2 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords MALE-SPECIFIC LETHAL 1 HOMOLOG
publication title Msl1-Mediated Dimerization of the Dosage Compensation Complex is Essential for Male X-Chromosome Regulation in Drosophila.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 115
sequence length 115
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16685 zf-RING_10 zinc RING finger of MSL2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4b7yC00
1ZBDB 1U6GB 1HYJA 2YU4A 5G0FA 5I3LA 5B78A 2K4DA 4A4CA 5B79A 1JM7A 4ZUXU 5TDRA 4WZ2A 4W4UA 2MA6A 2JRJA 3GV4A 2VP7A 1WEUA 4XI1A 1JOCA 2QJ0A 4ZQLA 1E4UA 2CSYA 2H0DA 3MHSA 2LXHC 5TABA 2F42A 2UZGA 4N3WA 4WA6A 2YW8A 2MT5A 4WZ3B 2EGPA 2DX8A 1WIMA 4R7EA 2EODA 1N87A 2ZETC 2KU3A 3ZPV1 5B75A 2EA6A 5EYAF 2KFTA 4LADB 2VPGA 2LXPC 3ZYQA 2MD7B 1K2FA 2YQLA 4R8PK 4A4BA 3N9QA 1X4IA 1JM7B 1WEPA 1WEOA 3O70A 4YC9A 2L75A 5KH7A 3MHHA 5AITA 1IYMA 4X3GA 3KNVA 2LN0A 2Y1MA 2XEUA 3PHDA 4V3LC 3O7AA 2Y43A 1WEVA 3RPGB 2K17A 2ECWA 2QIZA 4YABA 3C6WA 3L1XA 4S3OB 2LQ6A 3LQIA 1V87A 2YSMA 4YATA 3N9LA 1Z60A 5KH9A 2MD8C 2I50A 2JMIA 2L5UA 4GNDA 2YSJA 5TRBA 2CSZA 4N4FA 1VYXA 5H1TA 3C5KA 2F6NA 4AUQB 1DVPA 3KV5A 2XB1A 2ECTA 2KGIA 2M85A 2K16A 1WFKA 1T1HA 2ECVA 3HCSA 3SOUA 2E6RA 3T7LA 5TDWA 4IC3A 2M6MA 3HCTA 3QZVA 1FP0A 1CHCA 3VK6A 3U5MA 4B86C 1HYIA 4R2YA 2LGVA 2YREA 2AN6A 4FO9A 2VJFB 2L43A 5G05B 4YADA 2E6SA 3O35A 2NAAA 3M63A 4UP0A 4BBQA 4LKAA 3ZTGA 3FL2A 5FEYA 2PNXA 3N9NA 3N9PA 2CKLB 2YURA 3ZNIA 3LRQA 2L80A 5H9MA 2C2VS 2KREA 3HCUA 3RPGC 2K1JA 2RSDA 2YHNA 4S3OC 2VPDA 5H1VA 3SHBA 5G04B 2OXQC 2VNFA 1VFYA 2QICA 4BHWA 1X4JA 3SOXA 4UI9B 3RTRB 4F52B 4MSXA 4LK9A 2PUYA 3I2DA 3U5PA 4YBSA 2MA5A 2VJEB 1WEWA 1BORA 3M99A 2G6QA 4GNFA 4UP5A 4I7DA 2KIZA 2LDRA 2VJFA 1WENA 4PTBA 5C13A 3O36A 3ZPVE 2LGGA 2LV9A 3EB5A 4CCGX 5DKAA 2CT2A 4AP4A 2YYRA 1LDJB 5FB1A 2FUIA 2CKLA 2ECNA 2KR4A 5FB0A 3PUQA 5B8DA 4Q6FA 4LJNA 4YBTA 4GB0A 2VPBA 2RI7A 5LCWB 2YT5A 2JMDA 2F6JA 4IC2A 5LKXA 2HYED 5B76A 1RMDA 2LRIC 3GL6A 3O33A 5FERA 5KH3A 3PURA 2JMJA 2ECJA 1WEMA 4FIPA 2HDPA 1WE9A 1FBVA 4LLBA 5D1LB 1MM2A 4GNGA 4L58A 1WILA 2VJEA 3NG2A 1WESA 1Z6UA 4L7XA 4QF2A 1G25A 1MM3A 1LDKC 3N9MA 3SOWA 1WEEA 3LQHA 3EB6A 4I7BA 5B77A 3DPLR 3DQVR 4AYCA 4AVXA 1WEQA 4YBMA 2KE1A 2M1RA 5AIUA 1X4UA 3U5NA 2YQMA 1XWHA 5LKUA 4ZDTA 1VD4A 2G43A 2YUCA 2LGLA 4MVTA 2MNYA 4I7CA 1WGMA 4TKPB 4QF3A 5LKTA 2ECIA 2ECGA 2FSAA 3ASLA 4YAXA 3L11A 2VPEA 4WZ0A 5D1KB 2KWOA 4GNEA 4V3KC 5TBNA 2MNZA 3ZVYA 3LQJA 2MUMA 4FK5A 5JG6A 2KGGA 4A0CD 5D1MB 2C2LA 3M62A 4O64A 2L0BA 2IDAA 2H0DB 4AYCB 5C11A 2D8SA 1F62A 4FJCA 2MIQA 3IHPA 3ZVZB 3T6RA 2KYUA 4NN2A 4B7YC 4PPEA 1Z2QA 2KWJA 3O37A 5LKZA 2KWKA 3HTKC 3O34A 4P5OB 5H1UA 2BAYA 3V43A 2G45A 2Y1NA 4A49A 3U5OA 5J3XA 2KWNA 5DINA 3KQIA 2M3HA 2FUUA 2YHOA 3N9OA 3KV6A 4CA1A 4C9ZA 2LGKA 3L1ZB
chains in the Genus database with same CATH superfamily
1ZBDB 1U6GB 1HYJA 2YU4A 5G0FA 5I3LA 5SVYA 5B78A 2K4DA 4A4CA 5B79A 1DCQA 2CONA 2JM3A 1JM7A 3DWDA 3SUBA 4ZUXU 5TDRA 4WZ2A 4W4UA 2MA6A 2JRJA 3GV4A 2VP7A 1WEUA 4XI1A 1JOCA 2QJ0A 4ZQLA 1E4UA 2CSYA 2H0DA 3FAOA 3LVRE 2DSMA 3MHSA 2LXHC 5TABA 2F42A 4OGEA 2UZGA 4N3WA 2YVRA 3T9KA 3O47A 4WA6A 2YW8A 4OGCA 2MT5A 3FJUB 4WZ3B 3M7KA 2EGPA 2DX8A 1WIMA 2IQJA 4R7EA 2EODA 1N87A 2ZETC 2KU3A 3ZPV1 5B75A 2EA6A 5EYAF 2KFTA 4LADB 2VPGA 3H7HA 3MDBC 2XP0A 2LXPC 3ZYQA 2MD7B 1K2FA 2YQLA 4QQ4A 4R8PK 4A4BA 3N9QA 1X4IA 1JM7B 1WEPA 1WEOA 3O70A 4YC9A 2L75A 2MKEA 5KH7A 3MHHA 5AITA 1IYMA 4X3GA 3KNVA 2LN0A 2Y1MA 2XEUA 3PHDA 4V3LC 3O7AA 2Y43A 2CSVA 1WEVA 3RPGB 2K17A 2ECWA 2QIZA 4YABA 3C6WA 3L1XA 4S3OB 2LQ6A 3LQIA 1V87A 2YSMA 2E61A 4YATA 3N9LA 1Z60A 5KH9A 2MD8C 2I50A 2JMIA 2L5UA 4GNDA 2YSJA 5TRBA 2CSZA 4N4FA 2P57A 1VYXA 5H1TA 3C5KA 2F6NA 4AUQB 1DVPA 3KV5A 2XB1A 2FD4A 2ECTA 2KGIA 2M85A 1MBMA 2K16A 1WFKA 1T1HA 2ECVA 3HCSA 3SOUA 2E6RA 3T7LA 5TDWA 4IC3A 2M6MA 3QZVA 3HCTA 1FP0A 1CHCA 3VK6A 3U5MA 4B86C 1HYIA 4R2YA 2LGVA 2YREA 2AN6A 4FO9A 3DDTA 2VJFB 2L43A 3Q1DA 5G05B 4YADA 2E6SA 3O35A 2NAAA 3M63A 4UP0A 4BBQA 4LKAA 3ZTGA 3FL2A 5FEYA 2PNXA 3N9NA 3N9PA 2CKLB 2YURA 3ZNIA 3LRQA 2L80A 3PLWA 5H9MA 2C2VS 2KREA 3HCUA 3RPGC 2K1JA 2RSDA 2YHNA 4S3OC 5SVIB 2VPDA 5H1VA 3SHBA 2M13A 5G04B 2OXQC 2VNFA 1VFYA 2QICA 4BHWA 2EGMA 1X4JA 3SOXA 4UI9B 3RTRB 4F52B 4MSXA 4LK9A 2PUYA 3I2DA 3U5PA 3FEHA 4YBSA 2MA5A 3FM8C 2VJEB 1WEWA 1BORA 2OWAA 2KKXA 3M99A 2D8UA 2G6QA 4GNFA 4UP5A 4I7DA 2KIZA 2LDRA 2VJFA 1WENA 4PTBA 5C13A 3O36A 3ZPVE 2LGGA 2LV9A 3EB5A 4CCGX 5DKAA 2CT2A 4AP4A 2YYRA 1LDJB 5FB1A 2FUIA 2CKLA 2ECNA 2KR4A 5FB0A 3PUQA 5B8DA 4Q6FA 2CRRA 4LJNA 4YBTA 4GB0A 2VPBA 2RI7A 5LCWB 2YT5A 2JMDA 2F6JA 4IC2A 5SVIA 5LKXA 2HYED 5B76A 3JUEA 1RMDA 2LRIC 3GL6A 3O33A 5FERA 5KH3A 3PURA 2JMJA 2ECJA 2EXUA 1WEMA 4FIPA 2HDPA 1WE9A 1FBVA 2DJAA 3FANA 4LLBA 5D1LB 1MM2A 4GNGA 4L58A 1WILA 2VJEA 3NG2A 5SVXA 2XOYA 3KDEC 1WESA 1Z6UA 4L7XA 4QF2A 4Z0RA 1G25A 1MM3A 1LDKC 2RR4A 3N9MA 3SOWA 1WEEA 3LQHA 3EB6A 4I7BA 5B77A 3DPLR 3DQVR 4AYCA 4AVXA 4F1PA 1WEQA 4YBMA 2KE1A 2M1RA 5AIUA 1X4UA 3LVQE 3U5NA 2YQMA 1XWHA 2LAUA 5LKUA 4ZDTA 1VD4A 2G43A 2YUCA 2LGLA 4MVTA 2MNYA 4I7CA 1WGMA 4TKPB 2KKYA 4QF3A 5LKTA 2ECIA 2ECGA 2FSAA 3ASLA 3E2DA 4YAXA 5K3QA 3L11A 2VPEA 2CRWA 4WZ0A 5D1KB 2KWOA 4GNEA 4V3KC 5TBNA 2FFWA 2MNZA 3ZVYA 3LQJA 2MUMA 4FK5A 4O62A 5JG6A 2KGGA 4A0CD 2JUNA 5D1MB 2C2LA 3M62A 4O64A 2B0OE 2L0BA 2IDAA 2H0DB 4AYCB 5C11A 2D8SA 1F62A 4FJCA 2L7PA 2MIQA 3IHPA 3ZVZB 3T6RA 2KYUA 4NN2A 4B7YC 4PPEA 1Z2QA 2KWJA 3O37A 3LDYA 3LJUX 5LKZA 2KWKA 3HTKC 3O34A 4H9DA 4P5OB 5H1UA 2BAYA 2XOZA 2XOCA 3V43A 2G45A 4Z0OA 2Y1NA 4A49A 3U5OA 5J3XA 2KWNA 5DINA 3KQIA 2M3HA 2FUUA 2YHOA 3N9OA 3KV6A 4CA1A 4C9ZA 2LGKA 3L1ZB
chains in the Genus database with same CATH topology
1ZBDB 1U6GB 1HYJA 2YU4A 5G0FA 5I3LA 5B78A 2K4DA 4A4CA 5B79A 1JM7A 4ZUXU 5TDRA 4WZ2A 4W4UA 2MA6A 2JRJA 3GV4A 2VP7A 1WEUA 4XI1A 1JOCA 2QJ0A 4ZQLA 1E4UA 2CSYA 2H0DA 3MHSA 2LXHC 5TABA 2F42A 2UZGA 4N3WA 4WA6A 2YW8A 2MT5A 4WZ3B 2EGPA 2DX8A 1WIMA 4R7EA 2EODA 1N87A 2ZETC 2KU3A 3ZPV1 5B75A 2EA6A 5EYAF 2KFTA 4LADB 2VPGA 2LXPC 3ZYQA 2MD7B 1K2FA 2YQLA 4R8PK 4A4BA 3N9QA 1X4IA 1JM7B 1WEPA 1WEOA 3O70A 4YC9A 2L75A 5KH7A 3MHHA 5AITA 1IYMA 4X3GA 3KNVA 2LN0A 2Y1MA 2XEUA 3PHDA 4V3LC 3O7AA 2Y43A 1WEVA 3RPGB 2K17A 2ECWA 2QIZA 4YABA 3C6WA 3L1XA 4S3OB 2LQ6A 3LQIA 1V87A 2YSMA 4YATA 3N9LA 1Z60A 5KH9A 2MD8C 2I50A 2JMIA 2L5UA 4GNDA 2YSJA 5TRBA 2CSZA 4N4FA 1VYXA 5H1TA 3C5KA 2F6NA 4AUQB 1DVPA 3KV5A 2XB1A 2ECTA 2KGIA 2M85A 2K16A 1WFKA 1T1HA 2ECVA 3HCSA 3SOUA 2E6RA 3T7LA 5TDWA 4IC3A 2M6MA 3HCTA 3QZVA 1FP0A 1CHCA 3VK6A 3U5MA 4B86C 1HYIA 4R2YA 2LGVA 2YREA 2AN6A 4FO9A 2VJFB 2L43A 5G05B 4YADA 2E6SA 3O35A 2NAAA 3M63A 4UP0A 4BBQA 4LKAA 3ZTGA 3FL2A 5FEYA 2PNXA 3N9NA 3N9PA 2CKLB 2YURA 3ZNIA 3LRQA 2L80A 5H9MA 2C2VS 2KREA 3HCUA 3RPGC 2K1JA 2RSDA 2YHNA 4S3OC 2VPDA 5H1VA 3SHBA 5G04B 2OXQC 2VNFA 1VFYA 2QICA 4BHWA 1X4JA 3SOXA 4UI9B 3RTRB 4F52B 4MSXA 4LK9A 2PUYA 3I2DA 3U5PA 4YBSA 2MA5A 2VJEB 1WEWA 1BORA 3M99A 2G6QA 4GNFA 4UP5A 4I7DA 2KIZA 2LDRA 2VJFA 1WENA 4PTBA 5C13A 3O36A 3ZPVE 2LGGA 2LV9A 3EB5A 4CCGX 5DKAA 2CT2A 4AP4A 2YYRA 1LDJB 5FB1A 2FUIA 2CKLA 2ECNA 2KR4A 5FB0A 3PUQA 5B8DA 4Q6FA 4LJNA 4YBTA 4GB0A 2VPBA 2RI7A 5LCWB 2YT5A 2JMDA 2F6JA 4IC2A 5LKXA 2HYED 5B76A 1RMDA 2LRIC 3GL6A 3O33A 5FERA 5KH3A 3PURA 2JMJA 2ECJA 1WEMA 4FIPA 2HDPA 1WE9A 1FBVA 4LLBA 5D1LB 1MM2A 4GNGA 4L58A 1WILA 2VJEA 3NG2A 1WESA 1Z6UA 4L7XA 4QF2A 1G25A 1MM3A 1LDKC 3N9MA 3SOWA 1WEEA 3LQHA 3EB6A 4I7BA 5B77A 3DPLR 3DQVR 4AYCA 4AVXA 1WEQA 4YBMA 2KE1A 2M1RA 5AIUA 1X4UA 3U5NA 2YQMA 1XWHA 5LKUA 4ZDTA 1VD4A 2G43A 2YUCA 2LGLA 4MVTA 2MNYA 4I7CA 1WGMA 4TKPB 4QF3A 5LKTA 2ECIA 2ECGA 2FSAA 3ASLA 4YAXA 3L11A 2VPEA 4WZ0A 5D1KB 2KWOA 4GNEA 4V3KC 5TBNA 2MNZA 3ZVYA 3LQJA 2MUMA 4FK5A 5JG6A 2KGGA 4A0CD 5D1MB 2C2LA 3M62A 4O64A 2L0BA 2IDAA 2H0DB 4AYCB 5C11A 2D8SA 1F62A 4FJCA 2MIQA 3IHPA 3ZVZB 3T6RA 2KYUA 4NN2A 4B7YC 4PPEA 1Z2QA 2KWJA 3O37A 5LKZA 2KWKA 3HTKC 3O34A 4P5OB 5H1UA 2BAYA 3V43A 2G45A 2Y1NA 4A49A 3U5OA 5J3XA 2KWNA 5DINA 3KQIA 2M3HA 2FUUA 2YHOA 3N9OA 3KV6A 4CA1A 4C9ZA 2LGKA 3L1ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBD B;  1U6G B;  1HYJ A;  2YU4 A;  5G0F A;  5I3L A;  5B78 A;  2K4D A;  4A4C A;  5B79 A;  1JM7 A;  4ZUX U;  5TDR A;  4WZ2 A;  4W4U A;  2MA6 A;  2JRJ A;  3GV4 A;  2VP7 A;  1WEU A;  4XI1 A;  1JOC A;  2QJ0 A;  4ZQL A;  1E4U A;  2CSY A;  2H0D A;  3MHS A;  2LXH C;  5TAB A;  2F42 A;  2UZG A;  4N3W A;  4WA6 A;  2YW8 A;  2MT5 A;  4WZ3 B;  2EGP A;  2DX8 A;  1WIM A;  4R7E A;  2EOD A;  1N87 A;  2ZET C;  2KU3 A;  3ZPV 1;  5B75 A;  2EA6 A;  5EYA F;  2KFT A;  4LAD B;  2VPG A;  2LXP C;  3ZYQ A;  2MD7 B;  1K2F A;  2YQL A;  4R8P K;  4A4B A;  3N9Q A;  1X4I A;  1JM7 B;  1WEP A;  1WEO A;  3O70 A;  4YC9 A;  2L75 A;  5KH7 A;  3MHH A;  5AIT A;  1IYM A;  4X3G A;  3KNV A;  2LN0 A;  2Y1M A;  2XEU A;  3PHD A;  4V3L C;  3O7A A;  2Y43 A;  1WEV A;  3RPG B;  2K17 A;  2ECW A;  2QIZ A;  4YAB A;  3C6W A;  3L1X A;  4S3O B;  2LQ6 A;  3LQI A;  1V87 A;  2YSM A;  4YAT A;  3N9L A;  1Z60 A;  5KH9 A;  2MD8 C;  2I50 A;  2JMI A;  2L5U A;  4GND A;  2YSJ A;  5TRB A;  2CSZ A;  4N4F A;  1VYX A;  5H1T A;  3C5K A;  2F6N A;  4AUQ B;  1DVP A;  3KV5 A;  2XB1 A;  2ECT A;  2KGI A;  2M85 A;  2K16 A;  1WFK A;  1T1H A;  2ECV A;  3HCS A;  3SOU A;  2E6R A;  3T7L A;  5TDW A;  4IC3 A;  2M6M A;  3HCT A;  3QZV A;  1FP0 A;  1CHC A;  3VK6 A;  3U5M A;  4B86 C;  1HYI A;  4R2Y A;  2LGV A;  2YRE A;  2AN6 A;  4FO9 A;  2VJF B;  2L43 A;  5G05 B;  4YAD A;  2E6S A;  3O35 A;  2NAA A;  3M63 A;  4UP0 A;  4BBQ A;  4LKA A;  3ZTG A;  3FL2 A;  5FEY A;  2PNX A;  3N9N A;  3N9P A;  2CKL B;  2YUR A;  3ZNI A;  3LRQ A;  2L80 A;  5H9M A;  2C2V S;  2KRE A;  3HCU A;  3RPG C;  2K1J A;  2RSD A;  2YHN A;  4S3O C;  2VPD A;  5H1V A;  3SHB A;  5G04 B;  2OXQ C;  2VNF A;  1VFY A;  2QIC A;  4BHW A;  1X4J A;  3SOX A;  4UI9 B;  3RTR B;  4F52 B;  4MSX A;  4LK9 A;  2PUY A;  3I2D A;  3U5P A;  4YBS A;  2MA5 A;  2VJE B;  1WEW A;  1BOR A;  3M99 A;  2G6Q A;  4GNF A;  4UP5 A;  4I7D A;  2KIZ A;  2LDR A;  2VJF A;  1WEN A;  4PTB A;  5C13 A;  3O36 A;  3ZPV E;  2LGG A;  2LV9 A;  3EB5 A;  4CCG X;  5DKA A;  2CT2 A;  4AP4 A;  2YYR A;  1LDJ B;  5FB1 A;  2FUI A;  2CKL A;  2ECN A;  2KR4 A;  5FB0 A;  3PUQ A;  5B8D A;  4Q6F A;  4LJN A;  4YBT A;  4GB0 A;  2VPB A;  2RI7 A;  5LCW B;  2YT5 A;  2JMD A;  2F6J A;  4IC2 A;  5LKX A;  2HYE D;  5B76 A;  1RMD A;  2LRI C;  3GL6 A;  3O33 A;  5FER A;  5KH3 A;  3PUR A;  2JMJ A;  2ECJ A;  1WEM A;  4FIP A;  2HDP A;  1WE9 A;  1FBV A;  4LLB A;  5D1L B;  1MM2 A;  4GNG A;  4L58 A;  1WIL A;  2VJE A;  3NG2 A;  1WES A;  1Z6U A;  4L7X A;  4QF2 A;  1G25 A;  1MM3 A;  1LDK C;  3N9M A;  3SOW A;  1WEE A;  3LQH A;  3EB6 A;  4I7B A;  5B77 A;  3DPL R;  3DQV R;  4AYC A;  4AVX A;  1WEQ A;  4YBM A;  2KE1 A;  2M1R A;  5AIU A;  1X4U A;  3U5N A;  2YQM A;  1XWH A;  5LKU A;  4ZDT A;  1VD4 A;  2G43 A;  2YUC A;  2LGL A;  4MVT A;  2MNY A;  4I7C A;  1WGM A;  4TKP B;  4QF3 A;  5LKT A;  2ECI A;  2ECG A;  2FSA A;  3ASL A;  4YAX A;  3L11 A;  2VPE A;  4WZ0 A;  5D1K B;  2KWO A;  4GNE A;  4V3K C;  5TBN A;  2MNZ A;  3ZVY A;  3LQJ A;  2MUM A;  4FK5 A;  5JG6 A;  2KGG A;  4A0C D;  5D1M B;  2C2L A;  3M62 A;  4O64 A;  2L0B A;  2IDA A;  2H0D B;  4AYC B;  5C11 A;  2D8S A;  1F62 A;  4FJC A;  2MIQ A;  3IHP A;  3ZVZ B;  3T6R A;  2KYU A;  4NN2 A;  4B7Y C;  4PPE A;  1Z2Q A;  2KWJ A;  3O37 A;  5LKZ A;  2KWK A;  3HTK C;  3O34 A;  4P5O B;  5H1U A;  2BAY A;  3V43 A;  2G45 A;  2Y1N A;  4A49 A;  3U5O A;  5J3X A;  2KWN A;  5DIN A;  3KQI A;  2M3H A;  2FUU A;  2YHO A;  3N9O A;  3KV6 A;  4CA1 A;  4C9Z A;  2LGK A;  3L1Z B; 
#chains in the Genus database with same CATH topology
 1ZBD B;  1U6G B;  1HYJ A;  2YU4 A;  5G0F A;  5I3L A;  5SVY A;  5B78 A;  2K4D A;  4A4C A;  5B79 A;  1DCQ A;  2CON A;  2JM3 A;  1JM7 A;  3DWD A;  3SUB A;  4ZUX U;  5TDR A;  4WZ2 A;  4W4U A;  2MA6 A;  2JRJ A;  3GV4 A;  2VP7 A;  1WEU A;  4XI1 A;  1JOC A;  2QJ0 A;  4ZQL A;  1E4U A;  2CSY A;  2H0D A;  3FAO A;  3LVR E;  2DSM A;  3MHS A;  2LXH C;  5TAB A;  2F42 A;  4OGE A;  2UZG A;  4N3W A;  2YVR A;  3T9K A;  3O47 A;  4WA6 A;  2YW8 A;  4OGC A;  2MT5 A;  3FJU B;  4WZ3 B;  3M7K A;  2EGP A;  2DX8 A;  1WIM A;  2IQJ A;  4R7E A;  2EOD A;  1N87 A;  2ZET C;  2KU3 A;  3ZPV 1;  5B75 A;  2EA6 A;  5EYA F;  2KFT A;  4LAD B;  2VPG A;  3H7H A;  3MDB C;  2XP0 A;  2LXP C;  3ZYQ A;  2MD7 B;  1K2F A;  2YQL A;  4QQ4 A;  4R8P K;  4A4B A;  3N9Q A;  1X4I A;  1JM7 B;  1WEP A;  1WEO A;  3O70 A;  4YC9 A;  2L75 A;  2MKE A;  5KH7 A;  3MHH A;  5AIT A;  1IYM A;  4X3G A;  3KNV A;  2LN0 A;  2Y1M A;  2XEU A;  3PHD A;  4V3L C;  3O7A A;  2Y43 A;  2CSV A;  1WEV A;  3RPG B;  2K17 A;  2ECW A;  2QIZ A;  4YAB A;  3C6W A;  3L1X A;  4S3O B;  2LQ6 A;  3LQI A;  1V87 A;  2YSM A;  2E61 A;  4YAT A;  3N9L A;  1Z60 A;  5KH9 A;  2MD8 C;  2I50 A;  2JMI A;  2L5U A;  4GND A;  2YSJ A;  5TRB A;  2CSZ A;  4N4F A;  2P57 A;  1VYX A;  5H1T A;  3C5K A;  2F6N A;  4AUQ B;  1DVP A;  3KV5 A;  2XB1 A;  2FD4 A;  2ECT A;  2KGI A;  2M85 A;  1MBM A;  2K16 A;  1WFK A;  1T1H A;  2ECV A;  3HCS A;  3SOU A;  2E6R A;  3T7L A;  5TDW A;  4IC3 A;  2M6M A;  3QZV A;  3HCT A;  1FP0 A;  1CHC A;  3VK6 A;  3U5M A;  4B86 C;  1HYI A;  4R2Y A;  2LGV A;  2YRE A;  2AN6 A;  4FO9 A;  3DDT A;  2VJF B;  2L43 A;  3Q1D A;  5G05 B;  4YAD A;  2E6S A;  3O35 A;  2NAA A;  3M63 A;  4UP0 A;  4BBQ A;  4LKA A;  3ZTG A;  3FL2 A;  5FEY A;  2PNX A;  3N9N A;  3N9P A;  2CKL B;  2YUR A;  3ZNI A;  3LRQ A;  2L80 A;  3PLW A;  5H9M A;  2C2V S;  2KRE A;  3HCU A;  3RPG C;  2K1J A;  2RSD A;  2YHN A;  4S3O C;  5SVI B;  2VPD A;  5H1V A;  3SHB A;  2M13 A;  5G04 B;  2OXQ C;  2VNF A;  1VFY A;  2QIC A;  4BHW A;  2EGM A;  1X4J A;  3SOX A;  4UI9 B;  3RTR B;  4F52 B;  4MSX A;  4LK9 A;  2PUY A;  3I2D A;  3U5P A;  3FEH A;  4YBS A;  2MA5 A;  3FM8 C;  2VJE B;  1WEW A;  1BOR A;  2OWA A;  2KKX A;  3M99 A;  2D8U A;  2G6Q A;  4GNF A;  4UP5 A;  4I7D A;  2KIZ A;  2LDR A;  2VJF A;  1WEN A;  4PTB A;  5C13 A;  3O36 A;  3ZPV E;  2LGG A;  2LV9 A;  3EB5 A;  4CCG X;  5DKA A;  2CT2 A;  4AP4 A;  2YYR A;  1LDJ B;  5FB1 A;  2FUI A;  2CKL A;  2ECN A;  2KR4 A;  5FB0 A;  3PUQ A;  5B8D A;  4Q6F A;  2CRR A;  4LJN A;  4YBT A;  4GB0 A;  2VPB A;  2RI7 A;  5LCW B;  2YT5 A;  2JMD A;  2F6J A;  4IC2 A;  5SVI A;  5LKX A;  2HYE D;  5B76 A;  3JUE A;  1RMD A;  2LRI C;  3GL6 A;  3O33 A;  5FER A;  5KH3 A;  3PUR A;  2JMJ A;  2ECJ A;  2EXU A;  1WEM A;  4FIP A;  2HDP A;  1WE9 A;  1FBV A;  2DJA A;  3FAN A;  4LLB A;  5D1L B;  1MM2 A;  4GNG A;  4L58 A;  1WIL A;  2VJE A;  3NG2 A;  5SVX A;  2XOY A;  3KDE C;  1WES A;  1Z6U A;  4L7X A;  4QF2 A;  4Z0R A;  1G25 A;  1MM3 A;  1LDK C;  2RR4 A;  3N9M A;  3SOW A;  1WEE A;  3LQH A;  3EB6 A;  4I7B A;  5B77 A;  3DPL R;  3DQV R;  4AYC A;  4AVX A;  4F1P A;  1WEQ A;  4YBM A;  2KE1 A;  2M1R A;  5AIU A;  1X4U A;  3LVQ E;  3U5N A;  2YQM A;  1XWH A;  2LAU A;  5LKU A;  4ZDT A;  1VD4 A;  2G43 A;  2YUC A;  2LGL A;  4MVT A;  2MNY A;  4I7C A;  1WGM A;  4TKP B;  2KKY A;  4QF3 A;  5LKT A;  2ECI A;  2ECG A;  2FSA A;  3ASL A;  3E2D A;  4YAX A;  5K3Q A;  3L11 A;  2VPE A;  2CRW A;  4WZ0 A;  5D1K B;  2KWO A;  4GNE A;  4V3K C;  5TBN A;  2FFW A;  2MNZ A;  3ZVY A;  3LQJ A;  2MUM A;  4FK5 A;  4O62 A;  5JG6 A;  2KGG A;  4A0C D;  2JUN A;  5D1M B;  2C2L A;  3M62 A;  4O64 A;  2B0O E;  2L0B A;  2IDA A;  2H0D B;  4AYC B;  5C11 A;  2D8S A;  1F62 A;  4FJC A;  2L7P A;  2MIQ A;  3IHP A;  3ZVZ B;  3T6R A;  2KYU A;  4NN2 A;  4B7Y C;  4PPE A;  1Z2Q A;  2KWJ A;  3O37 A;  3LDY A;  3LJU X;  5LKZ A;  2KWK A;  3HTK C;  3O34 A;  4H9D A;  4P5O B;  5H1U A;  2BAY A;  2XOZ A;  2XOC A;  3V43 A;  2G45 A;  4Z0O A;  2Y1N A;  4A49 A;  3U5O A;  5J3X A;  2KWN A;  5DIN A;  3KQI A;  2M3H A;  2FUU A;  2YHO A;  3N9O A;  3KV6 A;  4CA1 A;  4C9Z A;  2LGK A;  3L1Z B; 
#chains in the Genus database with same CATH homology
 1ZBD B;  1U6G B;  1HYJ A;  2YU4 A;  5G0F A;  5I3L A;  5B78 A;  2K4D A;  4A4C A;  5B79 A;  1JM7 A;  4ZUX U;  5TDR A;  4WZ2 A;  4W4U A;  2MA6 A;  2JRJ A;  3GV4 A;  2VP7 A;  1WEU A;  4XI1 A;  1JOC A;  2QJ0 A;  4ZQL A;  1E4U A;  2CSY A;  2H0D A;  3MHS A;  2LXH C;  5TAB A;  2F42 A;  2UZG A;  4N3W A;  4WA6 A;  2YW8 A;  2MT5 A;  4WZ3 B;  2EGP A;  2DX8 A;  1WIM A;  4R7E A;  2EOD A;  1N87 A;  2ZET C;  2KU3 A;  3ZPV 1;  5B75 A;  2EA6 A;  5EYA F;  2KFT A;  4LAD B;  2VPG A;  2LXP C;  3ZYQ A;  2MD7 B;  1K2F A;  2YQL A;  4R8P K;  4A4B A;  3N9Q A;  1X4I A;  1JM7 B;  1WEP A;  1WEO A;  3O70 A;  4YC9 A;  2L75 A;  5KH7 A;  3MHH A;  5AIT A;  1IYM A;  4X3G A;  3KNV A;  2LN0 A;  2Y1M A;  2XEU A;  3PHD A;  4V3L C;  3O7A A;  2Y43 A;  1WEV A;  3RPG B;  2K17 A;  2ECW A;  2QIZ A;  4YAB A;  3C6W A;  3L1X A;  4S3O B;  2LQ6 A;  3LQI A;  1V87 A;  2YSM A;  4YAT A;  3N9L A;  1Z60 A;  5KH9 A;  2MD8 C;  2I50 A;  2JMI A;  2L5U A;  4GND A;  2YSJ A;  5TRB A;  2CSZ A;  4N4F A;  1VYX A;  5H1T A;  3C5K A;  2F6N A;  4AUQ B;  1DVP A;  3KV5 A;  2XB1 A;  2ECT A;  2KGI A;  2M85 A;  2K16 A;  1WFK A;  1T1H A;  2ECV A;  3HCS A;  3SOU A;  2E6R A;  3T7L A;  5TDW A;  4IC3 A;  2M6M A;  3HCT A;  3QZV A;  1FP0 A;  1CHC A;  3VK6 A;  3U5M A;  4B86 C;  1HYI A;  4R2Y A;  2LGV A;  2YRE A;  2AN6 A;  4FO9 A;  2VJF B;  2L43 A;  5G05 B;  4YAD A;  2E6S A;  3O35 A;  2NAA A;  3M63 A;  4UP0 A;  4BBQ A;  4LKA A;  3ZTG A;  3FL2 A;  5FEY A;  2PNX A;  3N9N A;  3N9P A;  2CKL B;  2YUR A;  3ZNI A;  3LRQ A;  2L80 A;  5H9M A;  2C2V S;  2KRE A;  3HCU A;  3RPG C;  2K1J A;  2RSD A;  2YHN A;  4S3O C;  2VPD A;  5H1V A;  3SHB A;  5G04 B;  2OXQ C;  2VNF A;  1VFY A;  2QIC A;  4BHW A;  1X4J A;  3SOX A;  4UI9 B;  3RTR B;  4F52 B;  4MSX A;  4LK9 A;  2PUY A;  3I2D A;  3U5P A;  4YBS A;  2MA5 A;  2VJE B;  1WEW A;  1BOR A;  3M99 A;  2G6Q A;  4GNF A;  4UP5 A;  4I7D A;  2KIZ A;  2LDR A;  2VJF A;  1WEN A;  4PTB A;  5C13 A;  3O36 A;  3ZPV E;  2LGG A;  2LV9 A;  3EB5 A;  4CCG X;  5DKA A;  2CT2 A;  4AP4 A;  2YYR A;  1LDJ B;  5FB1 A;  2FUI A;  2CKL A;  2ECN A;  2KR4 A;  5FB0 A;  3PUQ A;  5B8D A;  4Q6F A;  4LJN A;  4YBT A;  4GB0 A;  2VPB A;  2RI7 A;  5LCW B;  2YT5 A;  2JMD A;  2F6J A;  4IC2 A;  5LKX A;  2HYE D;  5B76 A;  1RMD A;  2LRI C;  3GL6 A;  3O33 A;  5FER A;  5KH3 A;  3PUR A;  2JMJ A;  2ECJ A;  1WEM A;  4FIP A;  2HDP A;  1WE9 A;  1FBV A;  4LLB A;  5D1L B;  1MM2 A;  4GNG A;  4L58 A;  1WIL A;  2VJE A;  3NG2 A;  1WES A;  1Z6U A;  4L7X A;  4QF2 A;  1G25 A;  1MM3 A;  1LDK C;  3N9M A;  3SOW A;  1WEE A;  3LQH A;  3EB6 A;  4I7B A;  5B77 A;  3DPL R;  3DQV R;  4AYC A;  4AVX A;  1WEQ A;  4YBM A;  2KE1 A;  2M1R A;  5AIU A;  1X4U A;  3U5N A;  2YQM A;  1XWH A;  5LKU A;  4ZDT A;  1VD4 A;  2G43 A;  2YUC A;  2LGL A;  4MVT A;  2MNY A;  4I7C A;  1WGM A;  4TKP B;  4QF3 A;  5LKT A;  2ECI A;  2ECG A;  2FSA A;  3ASL A;  4YAX A;  3L11 A;  2VPE A;  4WZ0 A;  5D1K B;  2KWO A;  4GNE A;  4V3K C;  5TBN A;  2MNZ A;  3ZVY A;  3LQJ A;  2MUM A;  4FK5 A;  5JG6 A;  2KGG A;  4A0C D;  5D1M B;  2C2L A;  3M62 A;  4O64 A;  2L0B A;  2IDA A;  2H0D B;  4AYC B;  5C11 A;  2D8S A;  1F62 A;  4FJC A;  2MIQ A;  3IHP A;  3ZVZ B;  3T6R A;  2KYU A;  4NN2 A;  4B7Y C;  4PPE A;  1Z2Q A;  2KWJ A;  3O37 A;  5LKZ A;  2KWK A;  3HTK C;  3O34 A;  4P5O B;  5H1U A;  2BAY A;  3V43 A;  2G45 A;  2Y1N A;  4A49 A;  3U5O A;  5J3X A;  2KWN A;  5DIN A;  3KQI A;  2M3H A;  2FUU A;  2YHO A;  3N9O A;  3KV6 A;  4CA1 A;  4C9Z A;  2LGK A;  3L1Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...