4B7YC

Crystal structure of the msl1-msl2 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
b'MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALE-SPECIFIC LETHAL 1 HOMOLOG
publication title Msl1-Mediated Dimerization of the Dosage Compensation Complex is Essential for Male X-Chromosome Regulation in Drosophila.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 33
structure length 115
sequence length 115
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16685 zf-RING_10 zinc RING finger of MSL2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4b7yC00
4WZ2A 3VK6A 2F42A 1X4JA 5AITA 4LLBA 4YC9A 2K1JA 5B79A 5B77A 2H0DB 1WEVA 2G45A 3LQIA 2Y1MA 1JM7A 3ZYQA 5B78A 5C13A 2YW8A 1T1HA 1WEUA 3C6WA 4WZ0A 2YSJA 4BBQA 1WE9A 5G04B 1VYXA 3KNVA 3M99A 2EGPA 4FK5A 2F6NA 2E6RA 3EB5A 3HCSA 2VJEA 3O7AA 3U5OA 2YQMA 1LDKC 2MA5A 4YADA 1WEOA 3LQJA 5H1UA 4YABA 1E4UA 4MVTA 2JMIA 2VP7A 5H1VA 3SOXA 2Y1NA 1K2FA 4PPEA 4S3OC 4A0CD 2M85A 2KWOA 2ECWA 4YBSA 3QZVA 2VNFA 3I2DA 4WA6A 2ECJA 2MNYA 3RPGC 2MNZA 5KH7A 2KGGA 4CA1A 3N9PA 2ECGA 5LKUA 2OXQC 3U5MA 2ZETC 2LV9A 2MUMA 3HTKC 4L58A 4B86C 2M3HA 5FEYA 4MSXA 1Z60A 5DINA 4A4CA 1CHCA 4ZDTA 2CSZA 5TABA 2YT5A 3O34A 3O35A 2RI7A 2G6QA 5I3LA 2LXPC 2LN0A 2Y43A 1JM7B 2UZGA 2LGVA 5AIUA 4YAXA 1WGMA 2KU3A 3L11A 2E6SA 4AP4A 2MA6A 4QF3A 2EA6A 3PURA 4UI9B 2VPEA 4N3WA 3ZPV1 4PTBA 3HCUA 1WEWA 4WZ3B 4NN2A 2YQLA 3MHHA 3GV4A 4ZUXU 4FJCA 2VJEB 5KH3A 5LKXA 3MHSA 2YUCA 2PNXA 2KIZA 2JMJA 2DX8A 4I7BA 1WFKA 5B75A 2K16A 2LGLA 3M62A 3PUQA 3GL6A 3T7LA 2KYUA 4C9ZA 5G05B 3IHPA 2MIQA 3ZVZB 4GB0A 5KH9A 4YBTA 3PHDA 4LJNA 4UP5A 2LGGA 5JG6A 5LKZA 1WEMA 2KWJA 4GNEA 3FL2A 4W4UA 2YSMA 5LCWB 4FIPA 3KQIA 5D1KB 2JRJA 2NAAA 1FBVA 3ASLA 3N9NA 2D8SA 3LQHA 4AYCA 5D1MB 2F6JA 2QJ0A 2CT2A 4V3KC 2FUUA 2MD8C 2L0BA 2RSDA 1XWHA 1WEEA 4F52B 3N9QA 1X4IA 2YHOA 1LDJB 2LXHC 4AUQB 2H0DA 2MD7B 2G43A 4O64A 3C5KA 3SHBA 4L7XA 4Q6FA 3KV5A 5G0FA 2L80A 4IC2A 2L75A 2LDRA 2KR4A 2VPDA 3O36A 2LQ6A 1U6GB 3DPLR 2ECTA 2YHNA 4QF2A 2L5UA 1JOCA 5B76A 2AN6A 3LRQA 5H9MA 2EODA 3L1ZB 3ZPVE 2KGIA 4I7DA 4R2YA 1VD4A 5TBNA 2FUIA 1Z6UA 1WILA 5D1LB 2C2VS 1X4UA 2PUYA 2FSAA 2HYED 2ECVA 2YYRA 2K4DA 3M63A 5FERA 3U5NA 5DKAA 1Z2QA 3KV6A 2C2LA 1VFYA 3N9LA 2VJFA 4TKPB 1F62A 5LKTA 3HCTA 3EB6A 2YURA 2KWNA 2KREA 4R7EA 5TRBA 1WEQA 4FO9A 3O37A 3N9MA 3T6RA 2M1RA 1WEPA 4R8PK 5B8DA 4GNGA 2VPGA 1N87A 2CKLA 4V3LC 3V43A 1MM2A 5TDWA 4N4FA 5FB1A 2KE1A 2L43A 2IDAA 2KFTA 4X3GA 4BHWA 1DVPA 4IC3A 4LK9A 3DQVR 1MM3A 1ZBDB 1WENA 4CCGX 2XEUA 3O33A 2BAYA 4B7YC 4S3OB 3L1XA 2VPBA 4GNFA 3ZTGA 3N9OA 4P5OB 2YREA 3RPGB 1WESA 3U5PA 1FP0A 5FB0A 3SOWA 4A4BA 2I50A 4XI1A 2LGKA 3ZVYA 4LKAA 4LADB 2MT5A 2K17A 3ZNIA 2VJFB 1RMDA 2CSYA 1BORA 2KWKA 3NG2A 4YBMA 3O70A 4UP0A 5J3XA 2JMDA 5TDRA 1HYJA 4A49A 2YU4A 2HDPA 3RTRB 4YATA 4ZQLA 4GNDA 2M6MA 5EYAF 5H1TA 2CKLB 2QIZA 2LRIC 2ECIA 5C11A 1IYMA 4AVXA 1G25A 3SOUA 1WIMA 2ECNA 1HYIA 2QICA 4AYCB 2XB1A 1V87A 4I7CA
chains in the Genus database with same CATH superfamily
4WZ2A 3VK6A 2F42A 1X4JA 5AITA 4LLBA 4O62A 2K1JA 4YC9A 5B79A 5B77A 2H0DB 1MBMA 1WEVA 2G45A 3DWDA 3LQIA 2Y1MA 1JM7A 3ZYQA 5B78A 5C13A 2YW8A 1T1HA 1WEUA 3C6WA 4WZ0A 2YSJA 4BBQA 1WE9A 5G04B 1VYXA 3FJUB 3KNVA 3M99A 2EGPA 4FK5A 4Z0OA 2F6NA 4H9DA 2E6RA 3EB5A 3HCSA 2VJEA 3O7AA 3U5OA 2YQMA 1LDKC 2MA5A 4YADA 1WEOA 3LQJA 2EXUA 5H1UA 4YABA 3LDYA 1E4UA 4MVTA 2DJAA 2JMIA 2VP7A 5H1VA 3SOXA 2Y1NA 1K2FA 4PPEA 4S3OC 4A0CD 2M85A 2KWOA 2ECWA 4YBSA 3QZVA 2VNFA 3I2DA 4WA6A 2ECJA 2MNYA 3RPGC 2MNZA 5KH7A 2KGGA 2YVRA 4CA1A 3N9PA 2ECGA 5LKUA 3H7HA 2OXQC 2KKYA 2DSMA 4Z0RA 3U5MA 2ZETC 2LV9A 2MUMA 3HTKC 4L58A 4B86C 2M3HA 5FEYA 2LAUA 4MSXA 1Z60A 5DINA 4A4CA 1CHCA 4ZDTA 2CSZA 5TABA 2YT5A 3O34A 3O47A 3O35A 2RI7A 2G6QA 5I3LA 2LXPC 2LN0A 2CONA 2Y43A 1JM7B 2UZGA 2LGVA 5AIUA 4YAXA 1WGMA 2KU3A 3L11A 4QQ4A 3LVQE 2E6SA 4AP4A 2MA6A 4QF3A 2EA6A 3PURA 4UI9B 2VPEA 4N3WA 3ZPV1 3T9KA 4PTBA 3HCUA 1WEWA 4WZ3B 4NN2A 2YQLA 3MHHA 3GV4A 4ZUXU 4FJCA 2VJEB 5KH3A 5LKXA 3MHSA 2YUCA 3M7KA 3LJUX 2FFWA 3SUBA 2MKEA 2PNXA 2KIZA 2JMJA 2DX8A 4I7BA 1WFKA 5B75A 2K16A 2RR4A 2LGLA 3M62A 3PUQA 2XOCA 2EGMA 3GL6A 3T7LA 2KYUA 3DDTA 4C9ZA 3Q1DA 5G05B 3IHPA 2MIQA 3ZVZB 4GB0A 5KH9A 4YBTA 3PHDA 4LJNA 2XOZA 4UP5A 2LGGA 5JG6A 5LKZA 1WEMA 2KWJA 5SVXA 4GNEA 3FL2A 4W4UA 2YSMA 5LCWB 4FIPA 3KQIA 5D1KB 2JRJA 2NAAA 1FBVA 3ASLA 3N9NA 2D8SA 3LQHA 4AYCA 5D1MB 2F6JA 2QJ0A 2CT2A 2KKXA 4V3KC 2FUUA 2MD8C 2L0BA 2RSDA 4OGEA 1XWHA 1WEEA 4F52B 3N9QA 1X4IA 2YHOA 1LDJB 2LXHC 4AUQB 2H0DA 2MD7B 2G43A 5K3QA 3JUEA 4O64A 3C5KA 3SHBA 4L7XA 4Q6FA 3KV5A 2IQJA 5G0FA 2L80A 4IC2A 2L75A 2LDRA 2KR4A 2VPDA 3O36A 2LQ6A 1U6GB 3DPLR 2ECTA 2YHNA 4QF2A 2L5UA 1JOCA 5B76A 2AN6A 3LRQA 5H9MA 2EODA 3L1ZB 3ZPVE 2KGIA 4I7DA 4R2YA 1VD4A 5TBNA 2FUIA 1Z6UA 1WILA 3E2DA 5D1LB 2C2VS 1X4UA 2PUYA 2FSAA 2HYED 2FD4A 2ECVA 2YYRA 2K4DA 3M63A 5FERA 3U5NA 5DKAA 1Z2QA 3KV6A 2C2LA 1VFYA 3N9LA 2VJFA 2CRRA 4TKPB 1F62A 5LKTA 2XOYA 3HCTA 3EB6A 2YURA 2KWNA 2KREA 4R7EA 5TRBA 2P57A 1WEQA 4FO9A 5SVYA 3O37A 3N9MA 3T6RA 2M1RA 1WEPA 2JUNA 4R8PK 5B8DA 5SVIA 4GNGA 2VPGA 1N87A 2CKLA 4V3LC 3KDEC 3V43A 1MM2A 2B0OE 5TDWA 4N4FA 2CRWA 5FB1A 2KE1A 2L43A 2IDAA 2KFTA 2M13A 2OWAA 4X3GA 2D8UA 4BHWA 1DVPA 4IC3A 4LK9A 3DQVR 1MM3A 2JM3A 1ZBDB 1WENA 4CCGX 2XEUA 3O33A 2BAYA 4B7YC 4S3OB 2XP0A 2VPBA 3L1XA 4GNFA 3ZTGA 3MDBC 3PLWA 3N9OA 4P5OB 2YREA 3RPGB 1WESA 3U5PA 1FP0A 5FB0A 3SOWA 4A4BA 2I50A 4XI1A 2LGKA 3ZVYA 3FM8C 4LKAA 4LADB 3FAOA 2MT5A 2K17A 3ZNIA 2VJFB 1DCQA 1RMDA 2CSYA 1BORA 2CSVA 2E61A 2KWKA 3LVRE 3NG2A 4YBMA 3O70A 4UP0A 5J3XA 2JMDA 5TDRA 1HYJA 4A49A 2YU4A 2HDPA 3RTRB 5SVIB 4YATA 4F1PA 4ZQLA 4GNDA 2M6MA 5EYAF 5H1TA 2CKLB 2QIZA 2LRIC 2ECIA 5C11A 1IYMA 2L7PA 3FEHA 4AVXA 1G25A 3SOUA 1WIMA 2ECNA 1HYIA 2QICA 4AYCB 2XB1A 1V87A 4I7CA 3FANA 4OGCA
chains in the Genus database with same CATH topology
4WZ2A 3VK6A 2F42A 1X4JA 5AITA 4LLBA 4YC9A 2K1JA 5B79A 5B77A 2H0DB 1WEVA 2G45A 3LQIA 2Y1MA 1JM7A 3ZYQA 5B78A 5C13A 2YW8A 1T1HA 1WEUA 3C6WA 4WZ0A 2YSJA 4BBQA 1WE9A 5G04B 1VYXA 3KNVA 3M99A 2EGPA 4FK5A 2F6NA 2E6RA 3EB5A 3HCSA 2VJEA 3O7AA 3U5OA 2YQMA 1LDKC 2MA5A 4YADA 1WEOA 3LQJA 5H1UA 4YABA 1E4UA 4MVTA 2JMIA 2VP7A 5H1VA 3SOXA 2Y1NA 1K2FA 4PPEA 4S3OC 4A0CD 2M85A 2KWOA 2ECWA 4YBSA 3QZVA 2VNFA 3I2DA 4WA6A 2ECJA 2MNYA 3RPGC 2MNZA 5KH7A 2KGGA 4CA1A 3N9PA 2ECGA 5LKUA 2OXQC 3U5MA 2ZETC 2LV9A 2MUMA 3HTKC 4L58A 4B86C 2M3HA 5FEYA 4MSXA 1Z60A 5DINA 4A4CA 1CHCA 4ZDTA 2CSZA 5TABA 2YT5A 3O34A 3O35A 2RI7A 2G6QA 5I3LA 2LXPC 2LN0A 2Y43A 1JM7B 2UZGA 2LGVA 5AIUA 4YAXA 1WGMA 2KU3A 3L11A 2E6SA 4AP4A 2MA6A 4QF3A 2EA6A 3PURA 4UI9B 2VPEA 4N3WA 3ZPV1 4PTBA 3HCUA 1WEWA 4WZ3B 4NN2A 2YQLA 3MHHA 3GV4A 4ZUXU 4FJCA 2VJEB 5KH3A 5LKXA 3MHSA 2YUCA 2PNXA 2KIZA 2JMJA 2DX8A 4I7BA 1WFKA 5B75A 2K16A 2LGLA 3M62A 3PUQA 3GL6A 3T7LA 2KYUA 4C9ZA 5G05B 3IHPA 2MIQA 3ZVZB 4GB0A 5KH9A 4YBTA 3PHDA 4LJNA 4UP5A 2LGGA 5JG6A 5LKZA 1WEMA 2KWJA 4GNEA 3FL2A 4W4UA 2YSMA 5LCWB 4FIPA 3KQIA 5D1KB 2JRJA 2NAAA 1FBVA 3ASLA 3N9NA 2D8SA 3LQHA 4AYCA 5D1MB 2F6JA 2QJ0A 2CT2A 4V3KC 2FUUA 2MD8C 2L0BA 2RSDA 1XWHA 1WEEA 4F52B 3N9QA 1X4IA 2YHOA 1LDJB 2LXHC 4AUQB 2H0DA 2MD7B 2G43A 4O64A 3C5KA 3SHBA 4L7XA 4Q6FA 3KV5A 5G0FA 2L80A 4IC2A 2L75A 2LDRA 2KR4A 2VPDA 3O36A 2LQ6A 1U6GB 3DPLR 2ECTA 2YHNA 4QF2A 2L5UA 1JOCA 5B76A 2AN6A 3LRQA 5H9MA 2EODA 3L1ZB 3ZPVE 2KGIA 4I7DA 4R2YA 1VD4A 5TBNA 2FUIA 1Z6UA 1WILA 5D1LB 2C2VS 1X4UA 2PUYA 2FSAA 2HYED 2ECVA 2YYRA 2K4DA 3M63A 5FERA 3U5NA 5DKAA 1Z2QA 3KV6A 2C2LA 1VFYA 3N9LA 2VJFA 4TKPB 1F62A 5LKTA 3HCTA 3EB6A 2YURA 2KWNA 2KREA 4R7EA 5TRBA 1WEQA 4FO9A 3O37A 3N9MA 3T6RA 2M1RA 1WEPA 4R8PK 5B8DA 4GNGA 2VPGA 1N87A 2CKLA 4V3LC 3V43A 1MM2A 5TDWA 4N4FA 5FB1A 2KE1A 2L43A 2IDAA 2KFTA 4X3GA 4BHWA 1DVPA 4IC3A 4LK9A 3DQVR 1MM3A 1ZBDB 1WENA 4CCGX 2XEUA 3O33A 2BAYA 4B7YC 4S3OB 3L1XA 2VPBA 4GNFA 3ZTGA 3N9OA 4P5OB 2YREA 3RPGB 1WESA 3U5PA 1FP0A 5FB0A 3SOWA 4A4BA 2I50A 4XI1A 2LGKA 3ZVYA 4LKAA 4LADB 2MT5A 2K17A 3ZNIA 2VJFB 1RMDA 2CSYA 1BORA 2KWKA 3NG2A 4YBMA 3O70A 4UP0A 5J3XA 2JMDA 5TDRA 1HYJA 4A49A 2YU4A 2HDPA 3RTRB 4YATA 4ZQLA 4GNDA 2M6MA 5EYAF 5H1TA 2CKLB 2QIZA 2LRIC 2ECIA 5C11A 1IYMA 4AVXA 1G25A 3SOUA 1WIMA 2ECNA 1HYIA 2QICA 4AYCB 2XB1A 1V87A 4I7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ2 A;  3VK6 A;  2F42 A;  1X4J A;  5AIT A;  4LLB A;  4YC9 A;  2K1J A;  5B79 A;  5B77 A;  2H0D B;  1WEV A;  2G45 A;  3LQI A;  2Y1M A;  1JM7 A;  3ZYQ A;  5B78 A;  5C13 A;  2YW8 A;  1T1H A;  1WEU A;  3C6W A;  4WZ0 A;  2YSJ A;  4BBQ A;  1WE9 A;  5G04 B;  1VYX A;  3KNV A;  3M99 A;  2EGP A;  4FK5 A;  2F6N A;  2E6R A;  3EB5 A;  3HCS A;  2VJE A;  3O7A A;  3U5O A;  2YQM A;  1LDK C;  2MA5 A;  4YAD A;  1WEO A;  3LQJ A;  5H1U A;  4YAB A;  1E4U A;  4MVT A;  2JMI A;  2VP7 A;  5H1V A;  3SOX A;  2Y1N A;  1K2F A;  4PPE A;  4S3O C;  4A0C D;  2M85 A;  2KWO A;  2ECW A;  4YBS A;  3QZV A;  2VNF A;  3I2D A;  4WA6 A;  2ECJ A;  2MNY A;  3RPG C;  2MNZ A;  5KH7 A;  2KGG A;  4CA1 A;  3N9P A;  2ECG A;  5LKU A;  2OXQ C;  3U5M A;  2ZET C;  2LV9 A;  2MUM A;  3HTK C;  4L58 A;  4B86 C;  2M3H A;  5FEY A;  4MSX A;  1Z60 A;  5DIN A;  4A4C A;  1CHC A;  4ZDT A;  2CSZ A;  5TAB A;  2YT5 A;  3O34 A;  3O35 A;  2RI7 A;  2G6Q A;  5I3L A;  2LXP C;  2LN0 A;  2Y43 A;  1JM7 B;  2UZG A;  2LGV A;  5AIU A;  4YAX A;  1WGM A;  2KU3 A;  3L11 A;  2E6S A;  4AP4 A;  2MA6 A;  4QF3 A;  2EA6 A;  3PUR A;  4UI9 B;  2VPE A;  4N3W A;  3ZPV 1;  4PTB A;  3HCU A;  1WEW A;  4WZ3 B;  4NN2 A;  2YQL A;  3MHH A;  3GV4 A;  4ZUX U;  4FJC A;  2VJE B;  5KH3 A;  5LKX A;  3MHS A;  2YUC A;  2PNX A;  2KIZ A;  2JMJ A;  2DX8 A;  4I7B A;  1WFK A;  5B75 A;  2K16 A;  2LGL A;  3M62 A;  3PUQ A;  3GL6 A;  3T7L A;  2KYU A;  4C9Z A;  5G05 B;  3IHP A;  2MIQ A;  3ZVZ B;  4GB0 A;  5KH9 A;  4YBT A;  3PHD A;  4LJN A;  4UP5 A;  2LGG A;  5JG6 A;  5LKZ A;  1WEM A;  2KWJ A;  4GNE A;  3FL2 A;  4W4U A;  2YSM A;  5LCW B;  4FIP A;  3KQI A;  5D1K B;  2JRJ A;  2NAA A;  1FBV A;  3ASL A;  3N9N A;  2D8S A;  3LQH A;  4AYC A;  5D1M B;  2F6J A;  2QJ0 A;  2CT2 A;  4V3K C;  2FUU A;  2MD8 C;  2L0B A;  2RSD A;  1XWH A;  1WEE A;  4F52 B;  3N9Q A;  1X4I A;  2YHO A;  1LDJ B;  2LXH C;  4AUQ B;  2H0D A;  2MD7 B;  2G43 A;  4O64 A;  3C5K A;  3SHB A;  4L7X A;  4Q6F A;  3KV5 A;  5G0F A;  2L80 A;  4IC2 A;  2L75 A;  2LDR A;  2KR4 A;  2VPD A;  3O36 A;  2LQ6 A;  1U6G B;  3DPL R;  2ECT A;  2YHN A;  4QF2 A;  2L5U A;  1JOC A;  5B76 A;  2AN6 A;  3LRQ A;  5H9M A;  2EOD A;  3L1Z B;  3ZPV E;  2KGI A;  4I7D A;  4R2Y A;  1VD4 A;  5TBN A;  2FUI A;  1Z6U A;  1WIL A;  5D1L B;  2C2V S;  1X4U A;  2PUY A;  2FSA A;  2HYE D;  2ECV A;  2YYR A;  2K4D A;  3M63 A;  5FER A;  3U5N A;  5DKA A;  1Z2Q A;  3KV6 A;  2C2L A;  1VFY A;  3N9L A;  2VJF A;  4TKP B;  1F62 A;  5LKT A;  3HCT A;  3EB6 A;  2YUR A;  2KWN A;  2KRE A;  4R7E A;  5TRB A;  1WEQ A;  4FO9 A;  3O37 A;  3N9M A;  3T6R A;  2M1R A;  1WEP A;  4R8P K;  5B8D A;  4GNG A;  2VPG A;  1N87 A;  2CKL A;  4V3L C;  3V43 A;  1MM2 A;  5TDW A;  4N4F A;  5FB1 A;  2KE1 A;  2L43 A;  2IDA A;  2KFT A;  4X3G A;  4BHW A;  1DVP A;  4IC3 A;  4LK9 A;  3DQV R;  1MM3 A;  1ZBD B;  1WEN A;  4CCG X;  2XEU A;  3O33 A;  2BAY A;  4B7Y C;  4S3O B;  3L1X A;  2VPB A;  4GNF A;  3ZTG A;  3N9O A;  4P5O B;  2YRE A;  3RPG B;  1WES A;  3U5P A;  1FP0 A;  5FB0 A;  3SOW A;  4A4B A;  2I50 A;  4XI1 A;  2LGK A;  3ZVY A;  4LKA A;  4LAD B;  2MT5 A;  2K17 A;  3ZNI A;  2VJF B;  1RMD A;  2CSY A;  1BOR A;  2KWK A;  3NG2 A;  4YBM A;  3O70 A;  4UP0 A;  5J3X A;  2JMD A;  5TDR A;  1HYJ A;  4A49 A;  2YU4 A;  2HDP A;  3RTR B;  4YAT A;  4ZQL A;  4GND A;  2M6M A;  5EYA F;  5H1T A;  2CKL B;  2QIZ A;  2LRI C;  2ECI A;  5C11 A;  1IYM A;  4AVX A;  1G25 A;  3SOU A;  1WIM A;  2ECN A;  1HYI A;  2QIC A;  4AYC B;  2XB1 A;  1V87 A;  4I7C A; 
#chains in the Genus database with same CATH topology
 4WZ2 A;  3VK6 A;  2F42 A;  1X4J A;  5AIT A;  4LLB A;  4O62 A;  2K1J A;  4YC9 A;  5B79 A;  5B77 A;  2H0D B;  1MBM A;  1WEV A;  2G45 A;  3DWD A;  3LQI A;  2Y1M A;  1JM7 A;  3ZYQ A;  5B78 A;  5C13 A;  2YW8 A;  1T1H A;  1WEU A;  3C6W A;  4WZ0 A;  2YSJ A;  4BBQ A;  1WE9 A;  5G04 B;  1VYX A;  3FJU B;  3KNV A;  3M99 A;  2EGP A;  4FK5 A;  4Z0O A;  2F6N A;  4H9D A;  2E6R A;  3EB5 A;  3HCS A;  2VJE A;  3O7A A;  3U5O A;  2YQM A;  1LDK C;  2MA5 A;  4YAD A;  1WEO A;  3LQJ A;  2EXU A;  5H1U A;  4YAB A;  3LDY A;  1E4U A;  4MVT A;  2DJA A;  2JMI A;  2VP7 A;  5H1V A;  3SOX A;  2Y1N A;  1K2F A;  4PPE A;  4S3O C;  4A0C D;  2M85 A;  2KWO A;  2ECW A;  4YBS A;  3QZV A;  2VNF A;  3I2D A;  4WA6 A;  2ECJ A;  2MNY A;  3RPG C;  2MNZ A;  5KH7 A;  2KGG A;  2YVR A;  4CA1 A;  3N9P A;  2ECG A;  5LKU A;  3H7H A;  2OXQ C;  2KKY A;  2DSM A;  4Z0R A;  3U5M A;  2ZET C;  2LV9 A;  2MUM A;  3HTK C;  4L58 A;  4B86 C;  2M3H A;  5FEY A;  2LAU A;  4MSX A;  1Z60 A;  5DIN A;  4A4C A;  1CHC A;  4ZDT A;  2CSZ A;  5TAB A;  2YT5 A;  3O34 A;  3O47 A;  3O35 A;  2RI7 A;  2G6Q A;  5I3L A;  2LXP C;  2LN0 A;  2CON A;  2Y43 A;  1JM7 B;  2UZG A;  2LGV A;  5AIU A;  4YAX A;  1WGM A;  2KU3 A;  3L11 A;  4QQ4 A;  3LVQ E;  2E6S A;  4AP4 A;  2MA6 A;  4QF3 A;  2EA6 A;  3PUR A;  4UI9 B;  2VPE A;  4N3W A;  3ZPV 1;  3T9K A;  4PTB A;  3HCU A;  1WEW A;  4WZ3 B;  4NN2 A;  2YQL A;  3MHH A;  3GV4 A;  4ZUX U;  4FJC A;  2VJE B;  5KH3 A;  5LKX A;  3MHS A;  2YUC A;  3M7K A;  3LJU X;  2FFW A;  3SUB A;  2MKE A;  2PNX A;  2KIZ A;  2JMJ A;  2DX8 A;  4I7B A;  1WFK A;  5B75 A;  2K16 A;  2RR4 A;  2LGL A;  3M62 A;  3PUQ A;  2XOC A;  2EGM A;  3GL6 A;  3T7L A;  2KYU A;  3DDT A;  4C9Z A;  3Q1D A;  5G05 B;  3IHP A;  2MIQ A;  3ZVZ B;  4GB0 A;  5KH9 A;  4YBT A;  3PHD A;  4LJN A;  2XOZ A;  4UP5 A;  2LGG A;  5JG6 A;  5LKZ A;  1WEM A;  2KWJ A;  5SVX A;  4GNE A;  3FL2 A;  4W4U A;  2YSM A;  5LCW B;  4FIP A;  3KQI A;  5D1K B;  2JRJ A;  2NAA A;  1FBV A;  3ASL A;  3N9N A;  2D8S A;  3LQH A;  4AYC A;  5D1M B;  2F6J A;  2QJ0 A;  2CT2 A;  2KKX A;  4V3K C;  2FUU A;  2MD8 C;  2L0B A;  2RSD A;  4OGE A;  1XWH A;  1WEE A;  4F52 B;  3N9Q A;  1X4I A;  2YHO A;  1LDJ B;  2LXH C;  4AUQ B;  2H0D A;  2MD7 B;  2G43 A;  5K3Q A;  3JUE A;  4O64 A;  3C5K A;  3SHB A;  4L7X A;  4Q6F A;  3KV5 A;  2IQJ A;  5G0F A;  2L80 A;  4IC2 A;  2L75 A;  2LDR A;  2KR4 A;  2VPD A;  3O36 A;  2LQ6 A;  1U6G B;  3DPL R;  2ECT A;  2YHN A;  4QF2 A;  2L5U A;  1JOC A;  5B76 A;  2AN6 A;  3LRQ A;  5H9M A;  2EOD A;  3L1Z B;  3ZPV E;  2KGI A;  4I7D A;  4R2Y A;  1VD4 A;  5TBN A;  2FUI A;  1Z6U A;  1WIL A;  3E2D A;  5D1L B;  2C2V S;  1X4U A;  2PUY A;  2FSA A;  2HYE D;  2FD4 A;  2ECV A;  2YYR A;  2K4D A;  3M63 A;  5FER A;  3U5N A;  5DKA A;  1Z2Q A;  3KV6 A;  2C2L A;  1VFY A;  3N9L A;  2VJF A;  2CRR A;  4TKP B;  1F62 A;  5LKT A;  2XOY A;  3HCT A;  3EB6 A;  2YUR A;  2KWN A;  2KRE A;  4R7E A;  5TRB A;  2P57 A;  1WEQ A;  4FO9 A;  5SVY A;  3O37 A;  3N9M A;  3T6R A;  2M1R A;  1WEP A;  2JUN A;  4R8P K;  5B8D A;  5SVI A;  4GNG A;  2VPG A;  1N87 A;  2CKL A;  4V3L C;  3KDE C;  3V43 A;  1MM2 A;  2B0O E;  5TDW A;  4N4F A;  2CRW A;  5FB1 A;  2KE1 A;  2L43 A;  2IDA A;  2KFT A;  2M13 A;  2OWA A;  4X3G A;  2D8U A;  4BHW A;  1DVP A;  4IC3 A;  4LK9 A;  3DQV R;  1MM3 A;  2JM3 A;  1ZBD B;  1WEN A;  4CCG X;  2XEU A;  3O33 A;  2BAY A;  4B7Y C;  4S3O B;  2XP0 A;  2VPB A;  3L1X A;  4GNF A;  3ZTG A;  3MDB C;  3PLW A;  3N9O A;  4P5O B;  2YRE A;  3RPG B;  1WES A;  3U5P A;  1FP0 A;  5FB0 A;  3SOW A;  4A4B A;  2I50 A;  4XI1 A;  2LGK A;  3ZVY A;  3FM8 C;  4LKA A;  4LAD B;  3FAO A;  2MT5 A;  2K17 A;  3ZNI A;  2VJF B;  1DCQ A;  1RMD A;  2CSY A;  1BOR A;  2CSV A;  2E61 A;  2KWK A;  3LVR E;  3NG2 A;  4YBM A;  3O70 A;  4UP0 A;  5J3X A;  2JMD A;  5TDR A;  1HYJ A;  4A49 A;  2YU4 A;  2HDP A;  3RTR B;  5SVI B;  4YAT A;  4F1P A;  4ZQL A;  4GND A;  2M6M A;  5EYA F;  5H1T A;  2CKL B;  2QIZ A;  2LRI C;  2ECI A;  5C11 A;  1IYM A;  2L7P A;  3FEH A;  4AVX A;  1G25 A;  3SOU A;  1WIM A;  2ECN A;  1HYI A;  2QIC A;  4AYC B;  2XB1 A;  1V87 A;  4I7C A;  3FAN A;  4OGC A; 
#chains in the Genus database with same CATH homology
 4WZ2 A;  3VK6 A;  2F42 A;  1X4J A;  5AIT A;  4LLB A;  4YC9 A;  2K1J A;  5B79 A;  5B77 A;  2H0D B;  1WEV A;  2G45 A;  3LQI A;  2Y1M A;  1JM7 A;  3ZYQ A;  5B78 A;  5C13 A;  2YW8 A;  1T1H A;  1WEU A;  3C6W A;  4WZ0 A;  2YSJ A;  4BBQ A;  1WE9 A;  5G04 B;  1VYX A;  3KNV A;  3M99 A;  2EGP A;  4FK5 A;  2F6N A;  2E6R A;  3EB5 A;  3HCS A;  2VJE A;  3O7A A;  3U5O A;  2YQM A;  1LDK C;  2MA5 A;  4YAD A;  1WEO A;  3LQJ A;  5H1U A;  4YAB A;  1E4U A;  4MVT A;  2JMI A;  2VP7 A;  5H1V A;  3SOX A;  2Y1N A;  1K2F A;  4PPE A;  4S3O C;  4A0C D;  2M85 A;  2KWO A;  2ECW A;  4YBS A;  3QZV A;  2VNF A;  3I2D A;  4WA6 A;  2ECJ A;  2MNY A;  3RPG C;  2MNZ A;  5KH7 A;  2KGG A;  4CA1 A;  3N9P A;  2ECG A;  5LKU A;  2OXQ C;  3U5M A;  2ZET C;  2LV9 A;  2MUM A;  3HTK C;  4L58 A;  4B86 C;  2M3H A;  5FEY A;  4MSX A;  1Z60 A;  5DIN A;  4A4C A;  1CHC A;  4ZDT A;  2CSZ A;  5TAB A;  2YT5 A;  3O34 A;  3O35 A;  2RI7 A;  2G6Q A;  5I3L A;  2LXP C;  2LN0 A;  2Y43 A;  1JM7 B;  2UZG A;  2LGV A;  5AIU A;  4YAX A;  1WGM A;  2KU3 A;  3L11 A;  2E6S A;  4AP4 A;  2MA6 A;  4QF3 A;  2EA6 A;  3PUR A;  4UI9 B;  2VPE A;  4N3W A;  3ZPV 1;  4PTB A;  3HCU A;  1WEW A;  4WZ3 B;  4NN2 A;  2YQL A;  3MHH A;  3GV4 A;  4ZUX U;  4FJC A;  2VJE B;  5KH3 A;  5LKX A;  3MHS A;  2YUC A;  2PNX A;  2KIZ A;  2JMJ A;  2DX8 A;  4I7B A;  1WFK A;  5B75 A;  2K16 A;  2LGL A;  3M62 A;  3PUQ A;  3GL6 A;  3T7L A;  2KYU A;  4C9Z A;  5G05 B;  3IHP A;  2MIQ A;  3ZVZ B;  4GB0 A;  5KH9 A;  4YBT A;  3PHD A;  4LJN A;  4UP5 A;  2LGG A;  5JG6 A;  5LKZ A;  1WEM A;  2KWJ A;  4GNE A;  3FL2 A;  4W4U A;  2YSM A;  5LCW B;  4FIP A;  3KQI A;  5D1K B;  2JRJ A;  2NAA A;  1FBV A;  3ASL A;  3N9N A;  2D8S A;  3LQH A;  4AYC A;  5D1M B;  2F6J A;  2QJ0 A;  2CT2 A;  4V3K C;  2FUU A;  2MD8 C;  2L0B A;  2RSD A;  1XWH A;  1WEE A;  4F52 B;  3N9Q A;  1X4I A;  2YHO A;  1LDJ B;  2LXH C;  4AUQ B;  2H0D A;  2MD7 B;  2G43 A;  4O64 A;  3C5K A;  3SHB A;  4L7X A;  4Q6F A;  3KV5 A;  5G0F A;  2L80 A;  4IC2 A;  2L75 A;  2LDR A;  2KR4 A;  2VPD A;  3O36 A;  2LQ6 A;  1U6G B;  3DPL R;  2ECT A;  2YHN A;  4QF2 A;  2L5U A;  1JOC A;  5B76 A;  2AN6 A;  3LRQ A;  5H9M A;  2EOD A;  3L1Z B;  3ZPV E;  2KGI A;  4I7D A;  4R2Y A;  1VD4 A;  5TBN A;  2FUI A;  1Z6U A;  1WIL A;  5D1L B;  2C2V S;  1X4U A;  2PUY A;  2FSA A;  2HYE D;  2ECV A;  2YYR A;  2K4D A;  3M63 A;  5FER A;  3U5N A;  5DKA A;  1Z2Q A;  3KV6 A;  2C2L A;  1VFY A;  3N9L A;  2VJF A;  4TKP B;  1F62 A;  5LKT A;  3HCT A;  3EB6 A;  2YUR A;  2KWN A;  2KRE A;  4R7E A;  5TRB A;  1WEQ A;  4FO9 A;  3O37 A;  3N9M A;  3T6R A;  2M1R A;  1WEP A;  4R8P K;  5B8D A;  4GNG A;  2VPG A;  1N87 A;  2CKL A;  4V3L C;  3V43 A;  1MM2 A;  5TDW A;  4N4F A;  5FB1 A;  2KE1 A;  2L43 A;  2IDA A;  2KFT A;  4X3G A;  4BHW A;  1DVP A;  4IC3 A;  4LK9 A;  3DQV R;  1MM3 A;  1ZBD B;  1WEN A;  4CCG X;  2XEU A;  3O33 A;  2BAY A;  4B7Y C;  4S3O B;  3L1X A;  2VPB A;  4GNF A;  3ZTG A;  3N9O A;  4P5O B;  2YRE A;  3RPG B;  1WES A;  3U5P A;  1FP0 A;  5FB0 A;  3SOW A;  4A4B A;  2I50 A;  4XI1 A;  2LGK A;  3ZVY A;  4LKA A;  4LAD B;  2MT5 A;  2K17 A;  3ZNI A;  2VJF B;  1RMD A;  2CSY A;  1BOR A;  2KWK A;  3NG2 A;  4YBM A;  3O70 A;  4UP0 A;  5J3X A;  2JMD A;  5TDR A;  1HYJ A;  4A49 A;  2YU4 A;  2HDP A;  3RTR B;  4YAT A;  4ZQL A;  4GND A;  2M6M A;  5EYA F;  5H1T A;  2CKL B;  2QIZ A;  2LRI C;  2ECI A;  5C11 A;  1IYM A;  4AVX A;  1G25 A;  3SOU A;  1WIM A;  2ECN A;  1HYI A;  2QIC A;  4AYC B;  2XB1 A;  1V87 A;  4I7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...