4B7YC

Crystal structure of the msl1-msl2 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALE-SPECIFIC LETHAL 1 HOMOLOG
publication title Msl1-Mediated Dimerization of the Dosage Compensation Complex is Essential for Male X-Chromosome Regulation in Drosophila.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 33
structure length 115
sequence length 115
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16685 zf-RING_10 zinc RING finger of MSL2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4b7yC00
2M6MA 3PHDA 1WFKA 3M63A 4R8PK 1MM2A 4IC3A 2KE1A 3O34A 3KQIA 4LK9A 4V3KC 2CKLA 2YREA 1HYIA 2H0DA 1FP0A 2VJFB 2FUUA 2Y1MA 2QIZA 5TABA 1FBVA 4NN2A 3T7LA 2YYRA 4I7BA 4QF3A 1Z60A 2VPBA 4N4FA 3LRQA 2YW8A 2Y1NA 4CA1A 5TBNA 3PURA 4YADA 1VYXA 1BORA 3ZPVE 1JOCA 1CHCA 4A4CA 3RPGB 4ZUXU 2FSAA 1JM7A 5FEYA 2KWKA 5D1KB 5DKAA 2M85A 2Y43A 2KU3A 3RPGC 2PNXA 4LLBA 2RI7A 4FJCA 2LGKA 2KYUA 5AIUA 4P5OB 2YURA 4PPEA 3GL6A 4A4BA 2VJFA 3LQIA 2K4DA 2YHOA 1E4UA 3N9MA 4I7DA 2YHNA 2E6SA 4ZDTA 1HYJA 1WEQA 5C11A 3IHPA 2HYED 3U5NA 2H0DB 1G25A 2KIZA 2YQMA 2MNYA 2M3HA 1U6GB 2C2VS 2KREA 3L1ZB 5C13A 4I7CA 3U5OA 4GNDA 5TDRA 2G43A 5EYAF 3HCTA 3KNVA 2JMJA 2CT2A 4X3GA 2RSDA 2VP7A 2KGIA 2LRIC 3O36A 2AN6A 3U5PA 1WE9A 2L75A 2KGGA 1X4IA 4AUQB 2LN0A 4L7XA 5LKZA 1WEOA 2YSJA 5D1LB 2L5UA 3I2DA 2VJEA 2JMDA 1LDJB 4CCGX 4UP0A 5KH7A 2LGVA 3O35A 2F6JA 5B77A 2ECTA 1WEEA 2KWNA 2KWJA 2K16A 2JMIA 5B79A 3GV4A 2ECNA 3SOUA 4WA6A 2BAYA 3NG2A 4GB0A 3T6RA 3RTRB 3KV5A 2EGPA 2D8SA 4FIPA 4YATA 5TDWA 2MA5A 4F52B 4A0CD 3N9PA 5AITA 2LGLA 5B8DA 2G45A 1X4JA 2LXHC 1Z6UA 4YABA 4C9ZA 5JG6A 2HDPA 4YBSA 4WZ3B 5B78A 3N9OA 3SHBA 3V43A 4WZ0A 2CSYA 3EB6A 3EB5A 4LADB 2VJEB 3HCSA 2YU4A 3N9NA 3HCUA 2OXQC 3DQVR 4N3WA 5FB1A 4V3LC 4Q6FA 5H1VA 5J3XA 2L0BA 5FERA 2EODA 2LV9A 2E6RA 2QJ0A 1VD4A 4WZ2A 4B7YC 2VPGA 2LXPC 2M1RA 1Z2QA 3N9LA 1WEWA 5LCWB 1ZBDB 2MD8C 3ZNIA 1IYMA 1VFYA 4R2YA 4AYCB 1F62A 4B86C 2YQLA 2MIQA 5G04B 1XWHA 4LJNA 1X4UA 2ECWA 2DX8A 4GNGA 4MVTA 3ZTGA 2PUYA 4FO9A 3MHHA 3O33A 4BHWA 4XI1A 4TKPB 2KR4A 2MUMA 3M62A 2G6QA 3O70A 2MT5A 2XEUA 4S3OB 2F42A 5LKXA 2KWOA 5G0FA 3ZVZB 5KH3A 3LQJA 4BBQA 3M99A 3U5MA 4GNFA 5LKUA 3HTKC 4S3OC 4MSXA 2XB1A 3ZVYA 4O64A 1WENA 3O37A 5H1UA 2L43A 3O7AA 5DINA 4AYCA 4LKAA 3SOWA 4AVXA 4YBMA 5G05B 1V87A 5KH9A 2LGGA 2KFTA 3LQHA 1WEVA 2ECGA 4ZQLA 2FUIA 5D1MB 2EA6A 1WEUA 2ZETC 3MHSA 4AP4A 4IC2A 3C5KA 5B75A 2IDAA 2L80A 2VPDA 5I3LA 5H9MA 4YAXA 1N87A 3ASLA 4W4UA 5H1TA 2MA6A 2ECJA 1WEPA 1WGMA 1RMDA 2F6NA 2LQ6A 4QF2A 2YT5A 1WEMA 2LDRA 4YBTA 4A49A 1WESA 4UP5A 3FL2A 4FK5A 2ECVA 2YSMA 2ECIA 2I50A 3ZYQA 2MD7B 5LKTA 2CSZA 1WILA 2K1JA 3L11A 2CKLB 2QICA 3PUQA 5FB0A 4GNEA 2VPEA 1LDKC 2K17A 4PTBA 3SOXA 3DPLR 3VK6A 1WIMA 2VNFA 3C6WA 3KV6A 3N9QA 1MM3A 3ZPV1 2YUCA 2MNZA 2C2LA 2JRJA 2UZGA 4R7EA 5B76A 1K2FA 2NAAA 3QZVA 1T1HA 4UI9B 1DVPA 3L1XA 1JM7B 4YC9A 5TRBA 4L58A
chains in the Genus database with same CATH superfamily
2M6MA 3PHDA 1WFKA 3M63A 4R8PK 1MM2A 4IC3A 2KE1A 3O34A 4H9DA 2XP0A 2JUNA 3KQIA 4LK9A 4V3KC 2CKLA 2YREA 1HYIA 2H0DA 1FP0A 4OGEA 2CONA 2VJFB 2FUUA 2Y1MA 2QIZA 5TABA 1FBVA 4NN2A 3T7LA 2YYRA 4I7BA 3LVRE 4QF3A 1Z60A 2VPBA 4N4FA 3LRQA 2YW8A 2Y1NA 4CA1A 5TBNA 3PURA 4YADA 2EGMA 1VYXA 1BORA 3ZPVE 1JOCA 1CHCA 4A4CA 2EXUA 3RPGB 4ZUXU 2FSAA 1JM7A 2D8UA 5FEYA 2KWKA 5D1KB 5DKAA 2M85A 2JM3A 2Y43A 2KU3A 3RPGC 2PNXA 4LLBA 2RI7A 4FJCA 2LGKA 4Z0RA 2KYUA 5AIUA 4P5OB 2YURA 4PPEA 3FJUB 3GL6A 4F1PA 4A4BA 2VJFA 3LQIA 2K4DA 2YHOA 1E4UA 3N9MA 4I7DA 2YHNA 3T9KA 2E6SA 4ZDTA 1HYJA 1WEQA 5C11A 3IHPA 2HYED 3U5NA 2H0DB 3MDBC 1G25A 2FD4A 2KIZA 2YQMA 2MNYA 2M3HA 1U6GB 2MKEA 2C2VS 3FANA 2KREA 3L1ZB 4OGCA 5C13A 2XOZA 4I7CA 3U5OA 4GNDA 5TDRA 2G43A 5EYAF 3HCTA 3KNVA 3JUEA 2JMJA 2CT2A 4X3GA 2RSDA 2VP7A 2KGIA 2DSMA 2LRIC 2AN6A 3O36A 3FM8C 1WE9A 2L75A 2KGGA 2P57A 1X4IA 3DDTA 4Z0OA 4AUQB 2LN0A 4L7XA 2DJAA 2XOYA 5LKZA 1WEOA 3U5PA 2YSJA 5D1LB 2L5UA 2FFWA 2VJEA 3I2DA 2JMDA 1LDJB 4CCGX 4UP0A 5KH7A 2LGVA 3O35A 2F6JA 3SUBA 3O47A 5B77A 2ECTA 1WEEA 2E61A 2KWNA 2KWJA 2K16A 2JMIA 5SVXA 5B79A 3GV4A 2ECNA 3SOUA 4WA6A 2BAYA 3NG2A 4GB0A 5SVIB 3T6RA 3RTRB 3KV5A 2EGPA 2D8SA 4FIPA 4YATA 5TDWA 2MA5A 4F52B 4A0CD 3N9PA 5AITA 2LGLA 5B8DA 2G45A 1X4JA 2LXHC 1Z6UA 4YABA 4C9ZA 5JG6A 2HDPA 4YBSA 4WZ3B 5B78A 3N9OA 2KKXA 3SHBA 3V43A 4WZ0A 2CSYA 3FEHA 3EB6A 4QQ4A 3EB5A 4LADB 2VJEB 3HCSA 5SVIA 2YU4A 3N9NA 2YVRA 3HCUA 2OXQC 3DQVR 4N3WA 5FB1A 4V3LC 4Q6FA 2OWAA 5H1VA 1DCQA 3LJUX 5K3QA 5J3XA 2L0BA 2RR4A 5FERA 2EODA 2LV9A 2CSVA 3M7KA 2E6RA 3PLWA 2QJ0A 1VD4A 4WZ2A 3LVQE 4B7YC 2VPGA 2LXPC 2M1RA 1Z2QA 3N9LA 1WEWA 5LCWB 1ZBDB 2MD8C 3ZNIA 1IYMA 1VFYA 4R2YA 4AYCB 1F62A 4B86C 2YQLA 2MIQA 2XOCA 5G04B 1XWHA 4LJNA 1X4UA 2ECWA 2DX8A 4GNGA 1MBMA 4MVTA 3ZTGA 2PUYA 4FO9A 3MHHA 3O33A 4BHWA 4XI1A 2IQJA 4TKPB 2KR4A 2MUMA 3M62A 2G6QA 3O70A 2L7PA 2MT5A 2M13A 2XEUA 4S3OB 2F42A 3LDYA 5LKXA 2KWOA 5G0FA 3ZVZB 5KH3A 3LQJA 4BBQA 3M99A 3U5MA 4GNFA 5LKUA 3HTKC 4S3OC 5SVYA 4MSXA 2XB1A 2KKYA 4O64A 3ZVYA 1WENA 3O37A 5H1UA 2L43A 3O7AA 5DINA 4AYCA 4LKAA 3SOWA 2B0OE 3DWDA 4AVXA 4YBMA 3Q1DA 5G05B 3H7HA 1V87A 5KH9A 2LGGA 2KFTA 3LQHA 1WEVA 2ECGA 4ZQLA 2FUIA 5D1MB 2EA6A 1WEUA 2ZETC 3MHSA 4AP4A 4IC2A 3C5KA 5B75A 3KDEC 2IDAA 2L80A 2VPDA 5I3LA 5H9MA 4YAXA 1N87A 3ASLA 4W4UA 5H1TA 2MA6A 2ECJA 1WEPA 1WGMA 1RMDA 2F6NA 2LQ6A 3E2DA 4QF2A 2YT5A 1WEMA 2LDRA 4YBTA 4A49A 2CRRA 1WESA 4UP5A 3FAOA 3FL2A 4FK5A 4O62A 2ECVA 2LAUA 2YSMA 2ECIA 2I50A 3ZYQA 2MD7B 5LKTA 2CSZA 1WILA 2K1JA 3L11A 2CKLB 2QICA 3PUQA 5FB0A 4GNEA 2VPEA 1LDKC 2K17A 4PTBA 3SOXA 3DPLR 3VK6A 2CRWA 1WIMA 2VNFA 3C6WA 3KV6A 3N9QA 1MM3A 3ZPV1 2YUCA 2MNZA 2C2LA 2JRJA 2UZGA 4R7EA 5B76A 1K2FA 2NAAA 3QZVA 1T1HA 4UI9B 1DVPA 3L1XA 1JM7B 4YC9A 5TRBA 4L58A
chains in the Genus database with same CATH topology
2M6MA 3PHDA 1WFKA 3M63A 4R8PK 1MM2A 4IC3A 2KE1A 3O34A 3KQIA 4LK9A 4V3KC 2CKLA 2YREA 1HYIA 2H0DA 1FP0A 2VJFB 2FUUA 2Y1MA 2QIZA 5TABA 1FBVA 4NN2A 3T7LA 2YYRA 4I7BA 4QF3A 1Z60A 2VPBA 4N4FA 3LRQA 2YW8A 2Y1NA 4CA1A 5TBNA 3PURA 4YADA 1VYXA 1BORA 3ZPVE 1JOCA 1CHCA 4A4CA 3RPGB 4ZUXU 2FSAA 1JM7A 5FEYA 2KWKA 5D1KB 5DKAA 2M85A 2Y43A 2KU3A 3RPGC 2PNXA 4LLBA 2RI7A 4FJCA 2LGKA 2KYUA 5AIUA 4P5OB 2YURA 4PPEA 3GL6A 4A4BA 2VJFA 3LQIA 2K4DA 2YHOA 1E4UA 3N9MA 4I7DA 2YHNA 2E6SA 4ZDTA 1HYJA 1WEQA 5C11A 3IHPA 2HYED 3U5NA 2H0DB 1G25A 2KIZA 2YQMA 2MNYA 2M3HA 1U6GB 2C2VS 2KREA 3L1ZB 5C13A 4I7CA 3U5OA 4GNDA 5TDRA 2G43A 5EYAF 3HCTA 3KNVA 2JMJA 2CT2A 4X3GA 2RSDA 2VP7A 2KGIA 2LRIC 3O36A 2AN6A 3U5PA 1WE9A 2L75A 2KGGA 1X4IA 4AUQB 2LN0A 4L7XA 5LKZA 1WEOA 2YSJA 5D1LB 2L5UA 3I2DA 2VJEA 2JMDA 1LDJB 4CCGX 4UP0A 5KH7A 2LGVA 3O35A 2F6JA 5B77A 2ECTA 1WEEA 2KWNA 2KWJA 2K16A 2JMIA 5B79A 3GV4A 2ECNA 3SOUA 4WA6A 2BAYA 3NG2A 4GB0A 3T6RA 3RTRB 3KV5A 2EGPA 2D8SA 4FIPA 4YATA 5TDWA 2MA5A 4F52B 4A0CD 3N9PA 5AITA 2LGLA 5B8DA 2G45A 1X4JA 2LXHC 1Z6UA 4YABA 4C9ZA 5JG6A 2HDPA 4YBSA 4WZ3B 5B78A 3N9OA 3SHBA 3V43A 4WZ0A 2CSYA 3EB6A 3EB5A 4LADB 2VJEB 3HCSA 2YU4A 3N9NA 3HCUA 2OXQC 3DQVR 4N3WA 5FB1A 4V3LC 4Q6FA 5H1VA 5J3XA 2L0BA 5FERA 2EODA 2LV9A 2E6RA 2QJ0A 1VD4A 4WZ2A 4B7YC 2VPGA 2LXPC 2M1RA 1Z2QA 3N9LA 1WEWA 5LCWB 1ZBDB 2MD8C 3ZNIA 1IYMA 1VFYA 4R2YA 4AYCB 1F62A 4B86C 2YQLA 2MIQA 5G04B 1XWHA 4LJNA 1X4UA 2ECWA 2DX8A 4GNGA 4MVTA 3ZTGA 2PUYA 4FO9A 3MHHA 3O33A 4BHWA 4XI1A 4TKPB 2KR4A 2MUMA 3M62A 2G6QA 3O70A 2MT5A 2XEUA 4S3OB 2F42A 5LKXA 2KWOA 5G0FA 3ZVZB 5KH3A 3LQJA 4BBQA 3M99A 3U5MA 4GNFA 5LKUA 3HTKC 4S3OC 4MSXA 2XB1A 3ZVYA 4O64A 1WENA 3O37A 5H1UA 2L43A 3O7AA 5DINA 4AYCA 4LKAA 3SOWA 4AVXA 4YBMA 5G05B 1V87A 5KH9A 2LGGA 2KFTA 3LQHA 1WEVA 2ECGA 4ZQLA 2FUIA 5D1MB 2EA6A 1WEUA 2ZETC 3MHSA 4AP4A 4IC2A 3C5KA 5B75A 2IDAA 2L80A 2VPDA 5I3LA 5H9MA 4YAXA 1N87A 3ASLA 4W4UA 5H1TA 2MA6A 2ECJA 1WEPA 1WGMA 1RMDA 2F6NA 2LQ6A 4QF2A 2YT5A 1WEMA 2LDRA 4YBTA 4A49A 1WESA 4UP5A 3FL2A 4FK5A 2ECVA 2YSMA 2ECIA 2I50A 3ZYQA 2MD7B 5LKTA 2CSZA 1WILA 2K1JA 3L11A 2CKLB 2QICA 3PUQA 5FB0A 4GNEA 2VPEA 1LDKC 2K17A 4PTBA 3SOXA 3DPLR 3VK6A 1WIMA 2VNFA 3C6WA 3KV6A 3N9QA 1MM3A 3ZPV1 2YUCA 2MNZA 2C2LA 2JRJA 2UZGA 4R7EA 5B76A 1K2FA 2NAAA 3QZVA 1T1HA 4UI9B 1DVPA 3L1XA 1JM7B 4YC9A 5TRBA 4L58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6M A;  3PHD A;  1WFK A;  3M63 A;  4R8P K;  1MM2 A;  4IC3 A;  2KE1 A;  3O34 A;  3KQI A;  4LK9 A;  4V3K C;  2CKL A;  2YRE A;  1HYI A;  2H0D A;  1FP0 A;  2VJF B;  2FUU A;  2Y1M A;  2QIZ A;  5TAB A;  1FBV A;  4NN2 A;  3T7L A;  2YYR A;  4I7B A;  4QF3 A;  1Z60 A;  2VPB A;  4N4F A;  3LRQ A;  2YW8 A;  2Y1N A;  4CA1 A;  5TBN A;  3PUR A;  4YAD A;  1VYX A;  1BOR A;  3ZPV E;  1JOC A;  1CHC A;  4A4C A;  3RPG B;  4ZUX U;  2FSA A;  1JM7 A;  5FEY A;  2KWK A;  5D1K B;  5DKA A;  2M85 A;  2Y43 A;  2KU3 A;  3RPG C;  2PNX A;  4LLB A;  2RI7 A;  4FJC A;  2LGK A;  2KYU A;  5AIU A;  4P5O B;  2YUR A;  4PPE A;  3GL6 A;  4A4B A;  2VJF A;  3LQI A;  2K4D A;  2YHO A;  1E4U A;  3N9M A;  4I7D A;  2YHN A;  2E6S A;  4ZDT A;  1HYJ A;  1WEQ A;  5C11 A;  3IHP A;  2HYE D;  3U5N A;  2H0D B;  1G25 A;  2KIZ A;  2YQM A;  2MNY A;  2M3H A;  1U6G B;  2C2V S;  2KRE A;  3L1Z B;  5C13 A;  4I7C A;  3U5O A;  4GND A;  5TDR A;  2G43 A;  5EYA F;  3HCT A;  3KNV A;  2JMJ A;  2CT2 A;  4X3G A;  2RSD A;  2VP7 A;  2KGI A;  2LRI C;  3O36 A;  2AN6 A;  3U5P A;  1WE9 A;  2L75 A;  2KGG A;  1X4I A;  4AUQ B;  2LN0 A;  4L7X A;  5LKZ A;  1WEO A;  2YSJ A;  5D1L B;  2L5U A;  3I2D A;  2VJE A;  2JMD A;  1LDJ B;  4CCG X;  4UP0 A;  5KH7 A;  2LGV A;  3O35 A;  2F6J A;  5B77 A;  2ECT A;  1WEE A;  2KWN A;  2KWJ A;  2K16 A;  2JMI A;  5B79 A;  3GV4 A;  2ECN A;  3SOU A;  4WA6 A;  2BAY A;  3NG2 A;  4GB0 A;  3T6R A;  3RTR B;  3KV5 A;  2EGP A;  2D8S A;  4FIP A;  4YAT A;  5TDW A;  2MA5 A;  4F52 B;  4A0C D;  3N9P A;  5AIT A;  2LGL A;  5B8D A;  2G45 A;  1X4J A;  2LXH C;  1Z6U A;  4YAB A;  4C9Z A;  5JG6 A;  2HDP A;  4YBS A;  4WZ3 B;  5B78 A;  3N9O A;  3SHB A;  3V43 A;  4WZ0 A;  2CSY A;  3EB6 A;  3EB5 A;  4LAD B;  2VJE B;  3HCS A;  2YU4 A;  3N9N A;  3HCU A;  2OXQ C;  3DQV R;  4N3W A;  5FB1 A;  4V3L C;  4Q6F A;  5H1V A;  5J3X A;  2L0B A;  5FER A;  2EOD A;  2LV9 A;  2E6R A;  2QJ0 A;  1VD4 A;  4WZ2 A;  4B7Y C;  2VPG A;  2LXP C;  2M1R A;  1Z2Q A;  3N9L A;  1WEW A;  5LCW B;  1ZBD B;  2MD8 C;  3ZNI A;  1IYM A;  1VFY A;  4R2Y A;  4AYC B;  1F62 A;  4B86 C;  2YQL A;  2MIQ A;  5G04 B;  1XWH A;  4LJN A;  1X4U A;  2ECW A;  2DX8 A;  4GNG A;  4MVT A;  3ZTG A;  2PUY A;  4FO9 A;  3MHH A;  3O33 A;  4BHW A;  4XI1 A;  4TKP B;  2KR4 A;  2MUM A;  3M62 A;  2G6Q A;  3O70 A;  2MT5 A;  2XEU A;  4S3O B;  2F42 A;  5LKX A;  2KWO A;  5G0F A;  3ZVZ B;  5KH3 A;  3LQJ A;  4BBQ A;  3M99 A;  3U5M A;  4GNF A;  5LKU A;  3HTK C;  4S3O C;  4MSX A;  2XB1 A;  3ZVY A;  4O64 A;  1WEN A;  3O37 A;  5H1U A;  2L43 A;  3O7A A;  5DIN A;  4AYC A;  4LKA A;  3SOW A;  4AVX A;  4YBM A;  5G05 B;  1V87 A;  5KH9 A;  2LGG A;  2KFT A;  3LQH A;  1WEV A;  2ECG A;  4ZQL A;  2FUI A;  5D1M B;  2EA6 A;  1WEU A;  2ZET C;  3MHS A;  4AP4 A;  4IC2 A;  3C5K A;  5B75 A;  2IDA A;  2L80 A;  2VPD A;  5I3L A;  5H9M A;  4YAX A;  1N87 A;  3ASL A;  4W4U A;  5H1T A;  2MA6 A;  2ECJ A;  1WEP A;  1WGM A;  1RMD A;  2F6N A;  2LQ6 A;  4QF2 A;  2YT5 A;  1WEM A;  2LDR A;  4YBT A;  4A49 A;  1WES A;  4UP5 A;  3FL2 A;  4FK5 A;  2ECV A;  2YSM A;  2ECI A;  2I50 A;  3ZYQ A;  2MD7 B;  5LKT A;  2CSZ A;  1WIL A;  2K1J A;  3L11 A;  2CKL B;  2QIC A;  3PUQ A;  5FB0 A;  4GNE A;  2VPE A;  1LDK C;  2K17 A;  4PTB A;  3SOX A;  3DPL R;  3VK6 A;  1WIM A;  2VNF A;  3C6W A;  3KV6 A;  3N9Q A;  1MM3 A;  3ZPV 1;  2YUC A;  2MNZ A;  2C2L A;  2JRJ A;  2UZG A;  4R7E A;  5B76 A;  1K2F A;  2NAA A;  3QZV A;  1T1H A;  4UI9 B;  1DVP A;  3L1X A;  1JM7 B;  4YC9 A;  5TRB A;  4L58 A; 
#chains in the Genus database with same CATH topology
 2M6M A;  3PHD A;  1WFK A;  3M63 A;  4R8P K;  1MM2 A;  4IC3 A;  2KE1 A;  3O34 A;  4H9D A;  2XP0 A;  2JUN A;  3KQI A;  4LK9 A;  4V3K C;  2CKL A;  2YRE A;  1HYI A;  2H0D A;  1FP0 A;  4OGE A;  2CON A;  2VJF B;  2FUU A;  2Y1M A;  2QIZ A;  5TAB A;  1FBV A;  4NN2 A;  3T7L A;  2YYR A;  4I7B A;  3LVR E;  4QF3 A;  1Z60 A;  2VPB A;  4N4F A;  3LRQ A;  2YW8 A;  2Y1N A;  4CA1 A;  5TBN A;  3PUR A;  4YAD A;  2EGM A;  1VYX A;  1BOR A;  3ZPV E;  1JOC A;  1CHC A;  4A4C A;  2EXU A;  3RPG B;  4ZUX U;  2FSA A;  1JM7 A;  2D8U A;  5FEY A;  2KWK A;  5D1K B;  5DKA A;  2M85 A;  2JM3 A;  2Y43 A;  2KU3 A;  3RPG C;  2PNX A;  4LLB A;  2RI7 A;  4FJC A;  2LGK A;  4Z0R A;  2KYU A;  5AIU A;  4P5O B;  2YUR A;  4PPE A;  3FJU B;  3GL6 A;  4F1P A;  4A4B A;  2VJF A;  3LQI A;  2K4D A;  2YHO A;  1E4U A;  3N9M A;  4I7D A;  2YHN A;  3T9K A;  2E6S A;  4ZDT A;  1HYJ A;  1WEQ A;  5C11 A;  3IHP A;  2HYE D;  3U5N A;  2H0D B;  3MDB C;  1G25 A;  2FD4 A;  2KIZ A;  2YQM A;  2MNY A;  2M3H A;  1U6G B;  2MKE A;  2C2V S;  3FAN A;  2KRE A;  3L1Z B;  4OGC A;  5C13 A;  2XOZ A;  4I7C A;  3U5O A;  4GND A;  5TDR A;  2G43 A;  5EYA F;  3HCT A;  3KNV A;  3JUE A;  2JMJ A;  2CT2 A;  4X3G A;  2RSD A;  2VP7 A;  2KGI A;  2DSM A;  2LRI C;  2AN6 A;  3O36 A;  3FM8 C;  1WE9 A;  2L75 A;  2KGG A;  2P57 A;  1X4I A;  3DDT A;  4Z0O A;  4AUQ B;  2LN0 A;  4L7X A;  2DJA A;  2XOY A;  5LKZ A;  1WEO A;  3U5P A;  2YSJ A;  5D1L B;  2L5U A;  2FFW A;  2VJE A;  3I2D A;  2JMD A;  1LDJ B;  4CCG X;  4UP0 A;  5KH7 A;  2LGV A;  3O35 A;  2F6J A;  3SUB A;  3O47 A;  5B77 A;  2ECT A;  1WEE A;  2E61 A;  2KWN A;  2KWJ A;  2K16 A;  2JMI A;  5SVX A;  5B79 A;  3GV4 A;  2ECN A;  3SOU A;  4WA6 A;  2BAY A;  3NG2 A;  4GB0 A;  5SVI B;  3T6R A;  3RTR B;  3KV5 A;  2EGP A;  2D8S A;  4FIP A;  4YAT A;  5TDW A;  2MA5 A;  4F52 B;  4A0C D;  3N9P A;  5AIT A;  2LGL A;  5B8D A;  2G45 A;  1X4J A;  2LXH C;  1Z6U A;  4YAB A;  4C9Z A;  5JG6 A;  2HDP A;  4YBS A;  4WZ3 B;  5B78 A;  3N9O A;  2KKX A;  3SHB A;  3V43 A;  4WZ0 A;  2CSY A;  3FEH A;  3EB6 A;  4QQ4 A;  3EB5 A;  4LAD B;  2VJE B;  3HCS A;  5SVI A;  2YU4 A;  3N9N A;  2YVR A;  3HCU A;  2OXQ C;  3DQV R;  4N3W A;  5FB1 A;  4V3L C;  4Q6F A;  2OWA A;  5H1V A;  1DCQ A;  3LJU X;  5K3Q A;  5J3X A;  2L0B A;  2RR4 A;  5FER A;  2EOD A;  2LV9 A;  2CSV A;  3M7K A;  2E6R A;  3PLW A;  2QJ0 A;  1VD4 A;  4WZ2 A;  3LVQ E;  4B7Y C;  2VPG A;  2LXP C;  2M1R A;  1Z2Q A;  3N9L A;  1WEW A;  5LCW B;  1ZBD B;  2MD8 C;  3ZNI A;  1IYM A;  1VFY A;  4R2Y A;  4AYC B;  1F62 A;  4B86 C;  2YQL A;  2MIQ A;  2XOC A;  5G04 B;  1XWH A;  4LJN A;  1X4U A;  2ECW A;  2DX8 A;  4GNG A;  1MBM A;  4MVT A;  3ZTG A;  2PUY A;  4FO9 A;  3MHH A;  3O33 A;  4BHW A;  4XI1 A;  2IQJ A;  4TKP B;  2KR4 A;  2MUM A;  3M62 A;  2G6Q A;  3O70 A;  2L7P A;  2MT5 A;  2M13 A;  2XEU A;  4S3O B;  2F42 A;  3LDY A;  5LKX A;  2KWO A;  5G0F A;  3ZVZ B;  5KH3 A;  3LQJ A;  4BBQ A;  3M99 A;  3U5M A;  4GNF A;  5LKU A;  3HTK C;  4S3O C;  5SVY A;  4MSX A;  2XB1 A;  2KKY A;  4O64 A;  3ZVY A;  1WEN A;  3O37 A;  5H1U A;  2L43 A;  3O7A A;  5DIN A;  4AYC A;  4LKA A;  3SOW A;  2B0O E;  3DWD A;  4AVX A;  4YBM A;  3Q1D A;  5G05 B;  3H7H A;  1V87 A;  5KH9 A;  2LGG A;  2KFT A;  3LQH A;  1WEV A;  2ECG A;  4ZQL A;  2FUI A;  5D1M B;  2EA6 A;  1WEU A;  2ZET C;  3MHS A;  4AP4 A;  4IC2 A;  3C5K A;  5B75 A;  3KDE C;  2IDA A;  2L80 A;  2VPD A;  5I3L A;  5H9M A;  4YAX A;  1N87 A;  3ASL A;  4W4U A;  5H1T A;  2MA6 A;  2ECJ A;  1WEP A;  1WGM A;  1RMD A;  2F6N A;  2LQ6 A;  3E2D A;  4QF2 A;  2YT5 A;  1WEM A;  2LDR A;  4YBT A;  4A49 A;  2CRR A;  1WES A;  4UP5 A;  3FAO A;  3FL2 A;  4FK5 A;  4O62 A;  2ECV A;  2LAU A;  2YSM A;  2ECI A;  2I50 A;  3ZYQ A;  2MD7 B;  5LKT A;  2CSZ A;  1WIL A;  2K1J A;  3L11 A;  2CKL B;  2QIC A;  3PUQ A;  5FB0 A;  4GNE A;  2VPE A;  1LDK C;  2K17 A;  4PTB A;  3SOX A;  3DPL R;  3VK6 A;  2CRW A;  1WIM A;  2VNF A;  3C6W A;  3KV6 A;  3N9Q A;  1MM3 A;  3ZPV 1;  2YUC A;  2MNZ A;  2C2L A;  2JRJ A;  2UZG A;  4R7E A;  5B76 A;  1K2F A;  2NAA A;  3QZV A;  1T1H A;  4UI9 B;  1DVP A;  3L1X A;  1JM7 B;  4YC9 A;  5TRB A;  4L58 A; 
#chains in the Genus database with same CATH homology
 2M6M A;  3PHD A;  1WFK A;  3M63 A;  4R8P K;  1MM2 A;  4IC3 A;  2KE1 A;  3O34 A;  3KQI A;  4LK9 A;  4V3K C;  2CKL A;  2YRE A;  1HYI A;  2H0D A;  1FP0 A;  2VJF B;  2FUU A;  2Y1M A;  2QIZ A;  5TAB A;  1FBV A;  4NN2 A;  3T7L A;  2YYR A;  4I7B A;  4QF3 A;  1Z60 A;  2VPB A;  4N4F A;  3LRQ A;  2YW8 A;  2Y1N A;  4CA1 A;  5TBN A;  3PUR A;  4YAD A;  1VYX A;  1BOR A;  3ZPV E;  1JOC A;  1CHC A;  4A4C A;  3RPG B;  4ZUX U;  2FSA A;  1JM7 A;  5FEY A;  2KWK A;  5D1K B;  5DKA A;  2M85 A;  2Y43 A;  2KU3 A;  3RPG C;  2PNX A;  4LLB A;  2RI7 A;  4FJC A;  2LGK A;  2KYU A;  5AIU A;  4P5O B;  2YUR A;  4PPE A;  3GL6 A;  4A4B A;  2VJF A;  3LQI A;  2K4D A;  2YHO A;  1E4U A;  3N9M A;  4I7D A;  2YHN A;  2E6S A;  4ZDT A;  1HYJ A;  1WEQ A;  5C11 A;  3IHP A;  2HYE D;  3U5N A;  2H0D B;  1G25 A;  2KIZ A;  2YQM A;  2MNY A;  2M3H A;  1U6G B;  2C2V S;  2KRE A;  3L1Z B;  5C13 A;  4I7C A;  3U5O A;  4GND A;  5TDR A;  2G43 A;  5EYA F;  3HCT A;  3KNV A;  2JMJ A;  2CT2 A;  4X3G A;  2RSD A;  2VP7 A;  2KGI A;  2LRI C;  3O36 A;  2AN6 A;  3U5P A;  1WE9 A;  2L75 A;  2KGG A;  1X4I A;  4AUQ B;  2LN0 A;  4L7X A;  5LKZ A;  1WEO A;  2YSJ A;  5D1L B;  2L5U A;  3I2D A;  2VJE A;  2JMD A;  1LDJ B;  4CCG X;  4UP0 A;  5KH7 A;  2LGV A;  3O35 A;  2F6J A;  5B77 A;  2ECT A;  1WEE A;  2KWN A;  2KWJ A;  2K16 A;  2JMI A;  5B79 A;  3GV4 A;  2ECN A;  3SOU A;  4WA6 A;  2BAY A;  3NG2 A;  4GB0 A;  3T6R A;  3RTR B;  3KV5 A;  2EGP A;  2D8S A;  4FIP A;  4YAT A;  5TDW A;  2MA5 A;  4F52 B;  4A0C D;  3N9P A;  5AIT A;  2LGL A;  5B8D A;  2G45 A;  1X4J A;  2LXH C;  1Z6U A;  4YAB A;  4C9Z A;  5JG6 A;  2HDP A;  4YBS A;  4WZ3 B;  5B78 A;  3N9O A;  3SHB A;  3V43 A;  4WZ0 A;  2CSY A;  3EB6 A;  3EB5 A;  4LAD B;  2VJE B;  3HCS A;  2YU4 A;  3N9N A;  3HCU A;  2OXQ C;  3DQV R;  4N3W A;  5FB1 A;  4V3L C;  4Q6F A;  5H1V A;  5J3X A;  2L0B A;  5FER A;  2EOD A;  2LV9 A;  2E6R A;  2QJ0 A;  1VD4 A;  4WZ2 A;  4B7Y C;  2VPG A;  2LXP C;  2M1R A;  1Z2Q A;  3N9L A;  1WEW A;  5LCW B;  1ZBD B;  2MD8 C;  3ZNI A;  1IYM A;  1VFY A;  4R2Y A;  4AYC B;  1F62 A;  4B86 C;  2YQL A;  2MIQ A;  5G04 B;  1XWH A;  4LJN A;  1X4U A;  2ECW A;  2DX8 A;  4GNG A;  4MVT A;  3ZTG A;  2PUY A;  4FO9 A;  3MHH A;  3O33 A;  4BHW A;  4XI1 A;  4TKP B;  2KR4 A;  2MUM A;  3M62 A;  2G6Q A;  3O70 A;  2MT5 A;  2XEU A;  4S3O B;  2F42 A;  5LKX A;  2KWO A;  5G0F A;  3ZVZ B;  5KH3 A;  3LQJ A;  4BBQ A;  3M99 A;  3U5M A;  4GNF A;  5LKU A;  3HTK C;  4S3O C;  4MSX A;  2XB1 A;  3ZVY A;  4O64 A;  1WEN A;  3O37 A;  5H1U A;  2L43 A;  3O7A A;  5DIN A;  4AYC A;  4LKA A;  3SOW A;  4AVX A;  4YBM A;  5G05 B;  1V87 A;  5KH9 A;  2LGG A;  2KFT A;  3LQH A;  1WEV A;  2ECG A;  4ZQL A;  2FUI A;  5D1M B;  2EA6 A;  1WEU A;  2ZET C;  3MHS A;  4AP4 A;  4IC2 A;  3C5K A;  5B75 A;  2IDA A;  2L80 A;  2VPD A;  5I3L A;  5H9M A;  4YAX A;  1N87 A;  3ASL A;  4W4U A;  5H1T A;  2MA6 A;  2ECJ A;  1WEP A;  1WGM A;  1RMD A;  2F6N A;  2LQ6 A;  4QF2 A;  2YT5 A;  1WEM A;  2LDR A;  4YBT A;  4A49 A;  1WES A;  4UP5 A;  3FL2 A;  4FK5 A;  2ECV A;  2YSM A;  2ECI A;  2I50 A;  3ZYQ A;  2MD7 B;  5LKT A;  2CSZ A;  1WIL A;  2K1J A;  3L11 A;  2CKL B;  2QIC A;  3PUQ A;  5FB0 A;  4GNE A;  2VPE A;  1LDK C;  2K17 A;  4PTB A;  3SOX A;  3DPL R;  3VK6 A;  1WIM A;  2VNF A;  3C6W A;  3KV6 A;  3N9Q A;  1MM3 A;  3ZPV 1;  2YUC A;  2MNZ A;  2C2L A;  2JRJ A;  2UZG A;  4R7E A;  5B76 A;  1K2F A;  2NAA A;  3QZV A;  1T1H A;  4UI9 B;  1DVP A;  3L1X A;  1JM7 B;  4YC9 A;  5TRB A;  4L58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...