4B7YC

Crystal structure of the msl1-msl2 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Msl1-Mediated Dimerization of the Dosage Compensation Complex is Essential for Male X-Chromosome Regulation in Drosophila.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords MALE-SPECIFIC LETHAL 1 HOMOLOG
total genus 33
structure length 115
sequence length 115
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16685 zf-RING_10 zinc RING finger of MSL2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4b7yC00
3MHHA 2LXHC 2YYRA 2M85A 1WEWA 3C6WA 4LADB 3N9LA 3O36A 3L11A 2YQMA 4ZUXU 3ASLA 4R8PK 1LDKC 5C13A 4L58A 2FUUA 3ZVYA 1X4IA 4FIPA 4NN2A 2MA5A 4AUQB 4S3OB 2C2VS 4UP0A 2ECIA 3O70A 4QF3A 4YABA 4A49A 2YSMA 2M6MA 1MM3A 4QF2A 2VJEA 5FEYA 2CSZA 4FO9A 2XB1A 3ZPV1 2FUIA 3N9NA 5TDWA 2YQLA 2CKLB 4V3LC 2YU4A 1WEMA 5B75A 2CT2A 2D8SA 1WESA 3RTRB 5TABA 2KWJA 4PTBA 3M62A 2I50A 5AIUA 2VPBA 3FL2A 1WEEA 5LKZA 3PURA 2KR4A 2G6QA 2L80A 1BORA 1CHCA 2ZETC 2FSAA 2MIQA 3O33A 4GNFA 3N9OA 2LGLA 2JMIA 5I3LA 4BBQA 2IDAA 1WENA 5D1LB 1F62A 2VPEA 2YHOA 2MUMA 2MD8C 4X3GA 4YADA 2YT5A 4GNEA 4UI9B 3SHBA 5KH9A 4V3KC 1DVPA 1JM7B 1V87A 5D1MB 1Z2QA 1WEUA 1U6GB 5FB1A 4AVXA 5LKTA 2L0BA 2KGGA 2EGPA 2LRIC 2K4DA 2E6SA 3I2DA 1RMDA 2MD7B 3ZNIA 4YBSA 2YHNA 3IHPA 3M99A 2YSJA 5H9MA 1FP0A 3GV4A 1WILA 3DPLR 5C11A 4AYCB 3SOXA 4LLBA 3C5KA 1WEPA 2DX8A 3L1XA 2HDPA 5H1TA 2L75A 4WA6A 3T6RA 1FBVA 3LQIA 2M1RA 2VP7A 4XI1A 3O7AA 2YURA 2ECVA 2KYUA 4AYCA 4WZ2A 3RPGC 4Q6FA 4CA1A 4C9ZA 3ZTGA 2AN6A 2KWKA 2NAAA 1WEQA 4N4FA 4WZ0A 3L1ZB 2XEUA 1IYMA 2LGVA 3LQJA 4BHWA 5FERA 5G04B 1JM7A 1N87A 3QZVA 2KGIA 4W4UA 2KREA 2ECWA 2JMDA 5J3XA 2VJFB 3EB6A 2Y1NA 5B79A 4GNGA 3N9PA 5TBNA 5B8DA 4YAXA 4WZ3B 2L43A 3HCSA 1VD4A 2VJEB 2JRJA 2K17A 2LN0A 4PPEA 1LDJB 3HCUA 4A0CD 3U5OA 2RSDA 4FK5A 2LQ6A 3PHDA 2EA6A 4B7YC 2G43A 4YBMA 3GL6A 2MNYA 3N9QA 2LGGA 2LDRA 3DQVR 1WIMA 5FB0A 2G45A 5G05B 2ECJA 2Y1MA 3V43A 1WE9A 3HCTA 1WEOA 1WGMA 3SOWA 1Z6UA 1XWHA 4LJNA 2LGKA 4TKPB 5B77A 1MM2A 4R2YA 2KU3A 2K16A 1WEVA 3U5PA 5JG6A 5DINA 2YREA 5LKUA 2KWOA 4O64A 2LV9A 2VJFA 2HYED 4B86C 1X4JA 4L7XA 1E4UA 3LRQA 2E6RA 5TDRA 5EYAF 5B78A 4LKAA 4IC2A 2VPGA 3EB5A 5H1VA 2VNFA 1ZBDB 2F42A 2QJ0A 4AP4A 1HYJA 2MT5A 3NG2A 4P5OB 3ZYQA 2OXQC 2KIZA 3M63A 3KV6A 4I7BA 3T7LA 4F52B 3N9MA 5B76A 2JMJA 3O34A 2KE1A 3U5NA 3LQHA 4I7CA 2H0DB 3RPGB 4IC3A 3PUQA 4YATA 4ZQLA 4ZDTA 3O37A 1T1HA 5D1KB 4S3OC 2EODA 2YW8A 5AITA 2VPDA 5DKAA 3VK6A 4R7EA 2ECTA 2ECGA 2KWNA 4MVTA 5G0FA 5TRBA 3MHSA 3ZPVE 5LKXA 2Y43A 3O35A 2ECNA 4GB0A 5KH7A 2F6NA 2QICA 4A4BA 1G25A 2MA6A 2QIZA 2PUYA 5H1UA 2CSYA 3SOUA 3KNVA 2KFTA 3U5MA 1HYIA 4YBTA 1VYXA 3HTKC 2L5UA 1VFYA 1JOCA 5LCWB 2M3HA 3KV5A 3KQIA 4FJCA 4GNDA 4MSXA 2PNXA 4LK9A 1X4UA 4CCGX 2CKLA 2UZGA 4YC9A 4I7DA 3ZVZB 1WFKA 4N3WA 1K2FA 4UP5A 2MNZA 2C2LA 2K1JA 2BAYA 5KH3A 2RI7A 2F6JA 1Z60A 2H0DA 2LXPC 4A4CA 2YUCA
chains in the Genus database with same CATH superfamily
3MHHA 2LXHC 2YYRA 2M85A 1WEWA 3C6WA 4LADB 4OGEA 3N9LA 3O36A 3O47A 3L11A 2YQMA 4ZUXU 3ASLA 4R8PK 2JUNA 1LDKC 5C13A 4L58A 2FUUA 3ZVYA 1X4IA 4FIPA 4NN2A 2MA5A 4AUQB 4S3OB 2C2VS 4UP0A 2ECIA 3O70A 4QF3A 4YABA 2XOYA 4A49A 2YSMA 2M6MA 1MM3A 4QF2A 2VJEA 5FEYA 2CSZA 4FO9A 3LJUX 2XB1A 3ZPV1 2FUIA 3N9NA 5TDWA 2YQLA 2CKLB 4V3LC 3MDBC 2YU4A 1WEMA 5B75A 2CT2A 2D8SA 1WESA 3RTRB 5TABA 2KWJA 4PTBA 2L7PA 2I50A 3M62A 5AIUA 2VPBA 3FL2A 1WEEA 5LKZA 3PURA 2KR4A 2G6QA 2L80A 1BORA 1CHCA 2ZETC 2FSAA 2MIQA 3O33A 4GNFA 3N9OA 2LGLA 2JMIA 5I3LA 4BBQA 2IDAA 5SVXA 1WENA 3M7KA 5D1LB 1F62A 2VPEA 2YHOA 2MUMA 2MD8C 4X3GA 4YADA 2YT5A 2XP0A 4GNEA 4UI9B 3SHBA 5KH9A 4V3KC 1DVPA 1JM7B 1V87A 5D1MB 1Z2QA 3Q1DA 1WEUA 1U6GB 3DWDA 5FB1A 4AVXA 5LKTA 2L0BA 5SVIA 2KGGA 2EGPA 2LRIC 3LVQE 2E61A 2K4DA 2MKEA 2E6SA 3I2DA 1RMDA 2MD7B 3ZNIA 4YBSA 2YHNA 3IHPA 3M99A 2YSJA 5H9MA 1FP0A 3LDYA 3FANA 3GV4A 2EGMA 1WILA 3DPLR 5C11A 4AYCB 3SOXA 4LLBA 3C5KA 1WEPA 2DX8A 3L1XA 2HDPA 5H1TA 2L75A 4WA6A 3T6RA 1FBVA 3LQIA 2M1RA 2VP7A 4XI1A 3O7AA 2YURA 2P57A 2ECVA 2CRWA 2KYUA 4AYCA 4WZ2A 3RPGC 4Q6FA 4CA1A 3LVRE 4C9ZA 3E2DA 3ZTGA 2AN6A 2KWKA 2NAAA 1WEQA 4N4FA 4WZ0A 3L1ZB 2XEUA 1IYMA 2LGVA 3DDTA 3LQJA 4BHWA 5FERA 5G04B 1JM7A 1N87A 3QZVA 2KGIA 4W4UA 2KREA 2ECWA 3SUBA 4O62A 2JMDA 3FEHA 5J3XA 3PLWA 2VJFB 3EB6A 2Y1NA 5B79A 4GNGA 3N9PA 2CSVA 5TBNA 2DSMA 1DCQA 5B8DA 4YAXA 4WZ3B 2LAUA 2L43A 3HCSA 1VD4A 2VJEB 2JRJA 2K17A 2LN0A 4PPEA 3T9KA 4Z0RA 1LDJB 3JUEA 3HCUA 4A0CD 3U5OA 2RSDA 4FK5A 2LQ6A 3PHDA 2EA6A 4B7YC 2OWAA 2G43A 4YBMA 3GL6A 2MNYA 3N9QA 2EXUA 2LGGA 2LDRA 3DQVR 1WIMA 5FB0A 4QQ4A 2G45A 5G05B 2ECJA 2Y1MA 3V43A 1WE9A 2FD4A 3HCTA 1WEOA 1WGMA 4H9DA 3SOWA 1Z6UA 3FM8C 1XWHA 4LJNA 4OGCA 2XOCA 2LGKA 4TKPB 2D8UA 5B77A 2B0OE 1MM2A 4R2YA 3FAOA 2KU3A 2K16A 1WEVA 3U5PA 5JG6A 4Z0OA 5DINA 2YREA 5LKUA 2KWOA 4O64A 2LV9A 2VJFA 2HYED 4B86C 4F1PA 1X4JA 4L7XA 1E4UA 3LRQA 1MBMA 2E6RA 5K3QA 2KKYA 5TDRA 5EYAF 5B78A 4LKAA 4IC2A 2VPGA 5SVYA 3EB5A 5H1VA 2VNFA 2FFWA 1ZBDB 2F42A 2QJ0A 4AP4A 1HYJA 2MT5A 3NG2A 4P5OB 3ZYQA 2OXQC 2KIZA 2RR4A 3M63A 3KV6A 4I7BA 3T7LA 4F52B 3N9MA 5B76A 2JMJA 3O34A 2KE1A 3U5NA 3LQHA 2KKXA 2M13A 4I7CA 2H0DB 3RPGB 4IC3A 3PUQA 4YATA 4ZQLA 4ZDTA 3O37A 1T1HA 5D1KB 4S3OC 2EODA 2YW8A 5AITA 3KDEC 2VPDA 5DKAA 3VK6A 4R7EA 2DJAA 2ECTA 2ECGA 2KWNA 4MVTA 2YVRA 5G0FA 5TRBA 3MHSA 3ZPVE 5LKXA 2Y43A 3O35A 2ECNA 2CRRA 4GB0A 5KH7A 2F6NA 2XOZA 2QICA 4A4BA 1G25A 2MA6A 2QIZA 2PUYA 5H1UA 2CSYA 3SOUA 2IQJA 2KFTA 3KNVA 3U5MA 1HYIA 4YBTA 1VYXA 3HTKC 2L5UA 1VFYA 1JOCA 5LCWB 2M3HA 3KV5A 3KQIA 4FJCA 4GNDA 4MSXA 2PNXA 4LK9A 2CONA 2JM3A 3H7HA 3FJUB 1X4UA 4CCGX 2CKLA 2UZGA 4YC9A 4I7DA 3ZVZB 1WFKA 4N3WA 1K2FA 4UP5A 2MNZA 2C2LA 2K1JA 2BAYA 5KH3A 5SVIB 2RI7A 2F6JA 1Z60A 2H0DA 2LXPC 4A4CA 2YUCA
chains in the Genus database with same CATH topology
3MHHA 2LXHC 2YYRA 2M85A 1WEWA 3C6WA 4LADB 3N9LA 3O36A 3L11A 2YQMA 4ZUXU 3ASLA 4R8PK 1LDKC 5C13A 4L58A 2FUUA 3ZVYA 1X4IA 4FIPA 4NN2A 2MA5A 4AUQB 4S3OB 2C2VS 4UP0A 2ECIA 3O70A 4QF3A 4YABA 4A49A 2YSMA 2M6MA 1MM3A 4QF2A 2VJEA 5FEYA 2CSZA 4FO9A 2XB1A 3ZPV1 2FUIA 3N9NA 5TDWA 2YQLA 2CKLB 4V3LC 2YU4A 1WEMA 5B75A 2CT2A 2D8SA 1WESA 3RTRB 5TABA 2KWJA 4PTBA 3M62A 2I50A 5AIUA 2VPBA 3FL2A 1WEEA 5LKZA 3PURA 2KR4A 2G6QA 2L80A 1BORA 1CHCA 2ZETC 2FSAA 2MIQA 3O33A 4GNFA 3N9OA 2LGLA 2JMIA 5I3LA 4BBQA 2IDAA 1WENA 5D1LB 1F62A 2VPEA 2YHOA 2MUMA 2MD8C 4X3GA 4YADA 2YT5A 4GNEA 4UI9B 3SHBA 5KH9A 4V3KC 1DVPA 1JM7B 1V87A 5D1MB 1Z2QA 1WEUA 1U6GB 5FB1A 4AVXA 5LKTA 2L0BA 2KGGA 2EGPA 2LRIC 2K4DA 2E6SA 3I2DA 1RMDA 2MD7B 3ZNIA 4YBSA 2YHNA 3IHPA 3M99A 2YSJA 5H9MA 1FP0A 3GV4A 1WILA 3DPLR 5C11A 4AYCB 3SOXA 4LLBA 3C5KA 1WEPA 2DX8A 3L1XA 2HDPA 5H1TA 2L75A 4WA6A 3T6RA 1FBVA 3LQIA 2M1RA 2VP7A 4XI1A 3O7AA 2YURA 2ECVA 2KYUA 4AYCA 4WZ2A 3RPGC 4Q6FA 4CA1A 4C9ZA 3ZTGA 2AN6A 2KWKA 2NAAA 1WEQA 4N4FA 4WZ0A 3L1ZB 2XEUA 1IYMA 2LGVA 3LQJA 4BHWA 5FERA 5G04B 1JM7A 1N87A 3QZVA 2KGIA 4W4UA 2KREA 2ECWA 2JMDA 5J3XA 2VJFB 3EB6A 2Y1NA 5B79A 4GNGA 3N9PA 5TBNA 5B8DA 4YAXA 4WZ3B 2L43A 3HCSA 1VD4A 2VJEB 2JRJA 2K17A 2LN0A 4PPEA 1LDJB 3HCUA 4A0CD 3U5OA 2RSDA 4FK5A 2LQ6A 3PHDA 2EA6A 4B7YC 2G43A 4YBMA 3GL6A 2MNYA 3N9QA 2LGGA 2LDRA 3DQVR 1WIMA 5FB0A 2G45A 5G05B 2ECJA 2Y1MA 3V43A 1WE9A 3HCTA 1WEOA 1WGMA 3SOWA 1Z6UA 1XWHA 4LJNA 2LGKA 4TKPB 5B77A 1MM2A 4R2YA 2KU3A 2K16A 1WEVA 3U5PA 5JG6A 5DINA 2YREA 5LKUA 2KWOA 4O64A 2LV9A 2VJFA 2HYED 4B86C 1X4JA 4L7XA 1E4UA 3LRQA 2E6RA 5TDRA 5EYAF 5B78A 4LKAA 4IC2A 2VPGA 3EB5A 5H1VA 2VNFA 1ZBDB 2F42A 2QJ0A 4AP4A 1HYJA 2MT5A 3NG2A 4P5OB 3ZYQA 2OXQC 2KIZA 3M63A 3KV6A 4I7BA 3T7LA 4F52B 3N9MA 5B76A 2JMJA 3O34A 2KE1A 3U5NA 3LQHA 4I7CA 2H0DB 3RPGB 4IC3A 3PUQA 4YATA 4ZQLA 4ZDTA 3O37A 1T1HA 5D1KB 4S3OC 2EODA 2YW8A 5AITA 2VPDA 5DKAA 3VK6A 4R7EA 2ECTA 2ECGA 2KWNA 4MVTA 5G0FA 5TRBA 3MHSA 3ZPVE 5LKXA 2Y43A 3O35A 2ECNA 4GB0A 5KH7A 2F6NA 2QICA 4A4BA 1G25A 2MA6A 2QIZA 2PUYA 5H1UA 2CSYA 3SOUA 3KNVA 2KFTA 3U5MA 1HYIA 4YBTA 1VYXA 3HTKC 2L5UA 1VFYA 1JOCA 5LCWB 2M3HA 3KV5A 3KQIA 4FJCA 4GNDA 4MSXA 2PNXA 4LK9A 1X4UA 4CCGX 2CKLA 2UZGA 4YC9A 4I7DA 3ZVZB 1WFKA 4N3WA 1K2FA 4UP5A 2MNZA 2C2LA 2K1JA 2BAYA 5KH3A 2RI7A 2F6JA 1Z60A 2H0DA 2LXPC 4A4CA 2YUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH A;  2LXH C;  2YYR A;  2M85 A;  1WEW A;  3C6W A;  4LAD B;  3N9L A;  3O36 A;  3L11 A;  2YQM A;  4ZUX U;  3ASL A;  4R8P K;  1LDK C;  5C13 A;  4L58 A;  2FUU A;  3ZVY A;  1X4I A;  4FIP A;  4NN2 A;  2MA5 A;  4AUQ B;  4S3O B;  2C2V S;  4UP0 A;  2ECI A;  3O70 A;  4QF3 A;  4YAB A;  4A49 A;  2YSM A;  2M6M A;  1MM3 A;  4QF2 A;  2VJE A;  5FEY A;  2CSZ A;  4FO9 A;  2XB1 A;  3ZPV 1;  2FUI A;  3N9N A;  5TDW A;  2YQL A;  2CKL B;  4V3L C;  2YU4 A;  1WEM A;  5B75 A;  2CT2 A;  2D8S A;  1WES A;  3RTR B;  5TAB A;  2KWJ A;  4PTB A;  3M62 A;  2I50 A;  5AIU A;  2VPB A;  3FL2 A;  1WEE A;  5LKZ A;  3PUR A;  2KR4 A;  2G6Q A;  2L80 A;  1BOR A;  1CHC A;  2ZET C;  2FSA A;  2MIQ A;  3O33 A;  4GNF A;  3N9O A;  2LGL A;  2JMI A;  5I3L A;  4BBQ A;  2IDA A;  1WEN A;  5D1L B;  1F62 A;  2VPE A;  2YHO A;  2MUM A;  2MD8 C;  4X3G A;  4YAD A;  2YT5 A;  4GNE A;  4UI9 B;  3SHB A;  5KH9 A;  4V3K C;  1DVP A;  1JM7 B;  1V87 A;  5D1M B;  1Z2Q A;  1WEU A;  1U6G B;  5FB1 A;  4AVX A;  5LKT A;  2L0B A;  2KGG A;  2EGP A;  2LRI C;  2K4D A;  2E6S A;  3I2D A;  1RMD A;  2MD7 B;  3ZNI A;  4YBS A;  2YHN A;  3IHP A;  3M99 A;  2YSJ A;  5H9M A;  1FP0 A;  3GV4 A;  1WIL A;  3DPL R;  5C11 A;  4AYC B;  3SOX A;  4LLB A;  3C5K A;  1WEP A;  2DX8 A;  3L1X A;  2HDP A;  5H1T A;  2L75 A;  4WA6 A;  3T6R A;  1FBV A;  3LQI A;  2M1R A;  2VP7 A;  4XI1 A;  3O7A A;  2YUR A;  2ECV A;  2KYU A;  4AYC A;  4WZ2 A;  3RPG C;  4Q6F A;  4CA1 A;  4C9Z A;  3ZTG A;  2AN6 A;  2KWK A;  2NAA A;  1WEQ A;  4N4F A;  4WZ0 A;  3L1Z B;  2XEU A;  1IYM A;  2LGV A;  3LQJ A;  4BHW A;  5FER A;  5G04 B;  1JM7 A;  1N87 A;  3QZV A;  2KGI A;  4W4U A;  2KRE A;  2ECW A;  2JMD A;  5J3X A;  2VJF B;  3EB6 A;  2Y1N A;  5B79 A;  4GNG A;  3N9P A;  5TBN A;  5B8D A;  4YAX A;  4WZ3 B;  2L43 A;  3HCS A;  1VD4 A;  2VJE B;  2JRJ A;  2K17 A;  2LN0 A;  4PPE A;  1LDJ B;  3HCU A;  4A0C D;  3U5O A;  2RSD A;  4FK5 A;  2LQ6 A;  3PHD A;  2EA6 A;  4B7Y C;  2G43 A;  4YBM A;  3GL6 A;  2MNY A;  3N9Q A;  2LGG A;  2LDR A;  3DQV R;  1WIM A;  5FB0 A;  2G45 A;  5G05 B;  2ECJ A;  2Y1M A;  3V43 A;  1WE9 A;  3HCT A;  1WEO A;  1WGM A;  3SOW A;  1Z6U A;  1XWH A;  4LJN A;  2LGK A;  4TKP B;  5B77 A;  1MM2 A;  4R2Y A;  2KU3 A;  2K16 A;  1WEV A;  3U5P A;  5JG6 A;  5DIN A;  2YRE A;  5LKU A;  2KWO A;  4O64 A;  2LV9 A;  2VJF A;  2HYE D;  4B86 C;  1X4J A;  4L7X A;  1E4U A;  3LRQ A;  2E6R A;  5TDR A;  5EYA F;  5B78 A;  4LKA A;  4IC2 A;  2VPG A;  3EB5 A;  5H1V A;  2VNF A;  1ZBD B;  2F42 A;  2QJ0 A;  4AP4 A;  1HYJ A;  2MT5 A;  3NG2 A;  4P5O B;  3ZYQ A;  2OXQ C;  2KIZ A;  3M63 A;  3KV6 A;  4I7B A;  3T7L A;  4F52 B;  3N9M A;  5B76 A;  2JMJ A;  3O34 A;  2KE1 A;  3U5N A;  3LQH A;  4I7C A;  2H0D B;  3RPG B;  4IC3 A;  3PUQ A;  4YAT A;  4ZQL A;  4ZDT A;  3O37 A;  1T1H A;  5D1K B;  4S3O C;  2EOD A;  2YW8 A;  5AIT A;  2VPD A;  5DKA A;  3VK6 A;  4R7E A;  2ECT A;  2ECG A;  2KWN A;  4MVT A;  5G0F A;  5TRB A;  3MHS A;  3ZPV E;  5LKX A;  2Y43 A;  3O35 A;  2ECN A;  4GB0 A;  5KH7 A;  2F6N A;  2QIC A;  4A4B A;  1G25 A;  2MA6 A;  2QIZ A;  2PUY A;  5H1U A;  2CSY A;  3SOU A;  3KNV A;  2KFT A;  3U5M A;  1HYI A;  4YBT A;  1VYX A;  3HTK C;  2L5U A;  1VFY A;  1JOC A;  5LCW B;  2M3H A;  3KV5 A;  3KQI A;  4FJC A;  4GND A;  4MSX A;  2PNX A;  4LK9 A;  1X4U A;  4CCG X;  2CKL A;  2UZG A;  4YC9 A;  4I7D A;  3ZVZ B;  1WFK A;  4N3W A;  1K2F A;  4UP5 A;  2MNZ A;  2C2L A;  2K1J A;  2BAY A;  5KH3 A;  2RI7 A;  2F6J A;  1Z60 A;  2H0D A;  2LXP C;  4A4C A;  2YUC A; 
#chains in the Genus database with same CATH topology
 3MHH A;  2LXH C;  2YYR A;  2M85 A;  1WEW A;  3C6W A;  4LAD B;  4OGE A;  3N9L A;  3O36 A;  3O47 A;  3L11 A;  2YQM A;  4ZUX U;  3ASL A;  4R8P K;  2JUN A;  1LDK C;  5C13 A;  4L58 A;  2FUU A;  3ZVY A;  1X4I A;  4FIP A;  4NN2 A;  2MA5 A;  4AUQ B;  4S3O B;  2C2V S;  4UP0 A;  2ECI A;  3O70 A;  4QF3 A;  4YAB A;  2XOY A;  4A49 A;  2YSM A;  2M6M A;  1MM3 A;  4QF2 A;  2VJE A;  5FEY A;  2CSZ A;  4FO9 A;  3LJU X;  2XB1 A;  3ZPV 1;  2FUI A;  3N9N A;  5TDW A;  2YQL A;  2CKL B;  4V3L C;  3MDB C;  2YU4 A;  1WEM A;  5B75 A;  2CT2 A;  2D8S A;  1WES A;  3RTR B;  5TAB A;  2KWJ A;  4PTB A;  2L7P A;  2I50 A;  3M62 A;  5AIU A;  2VPB A;  3FL2 A;  1WEE A;  5LKZ A;  3PUR A;  2KR4 A;  2G6Q A;  2L80 A;  1BOR A;  1CHC A;  2ZET C;  2FSA A;  2MIQ A;  3O33 A;  4GNF A;  3N9O A;  2LGL A;  2JMI A;  5I3L A;  4BBQ A;  2IDA A;  5SVX A;  1WEN A;  3M7K A;  5D1L B;  1F62 A;  2VPE A;  2YHO A;  2MUM A;  2MD8 C;  4X3G A;  4YAD A;  2YT5 A;  2XP0 A;  4GNE A;  4UI9 B;  3SHB A;  5KH9 A;  4V3K C;  1DVP A;  1JM7 B;  1V87 A;  5D1M B;  1Z2Q A;  3Q1D A;  1WEU A;  1U6G B;  3DWD A;  5FB1 A;  4AVX A;  5LKT A;  2L0B A;  5SVI A;  2KGG A;  2EGP A;  2LRI C;  3LVQ E;  2E61 A;  2K4D A;  2MKE A;  2E6S A;  3I2D A;  1RMD A;  2MD7 B;  3ZNI A;  4YBS A;  2YHN A;  3IHP A;  3M99 A;  2YSJ A;  5H9M A;  1FP0 A;  3LDY A;  3FAN A;  3GV4 A;  2EGM A;  1WIL A;  3DPL R;  5C11 A;  4AYC B;  3SOX A;  4LLB A;  3C5K A;  1WEP A;  2DX8 A;  3L1X A;  2HDP A;  5H1T A;  2L75 A;  4WA6 A;  3T6R A;  1FBV A;  3LQI A;  2M1R A;  2VP7 A;  4XI1 A;  3O7A A;  2YUR A;  2P57 A;  2ECV A;  2CRW A;  2KYU A;  4AYC A;  4WZ2 A;  3RPG C;  4Q6F A;  4CA1 A;  3LVR E;  4C9Z A;  3E2D A;  3ZTG A;  2AN6 A;  2KWK A;  2NAA A;  1WEQ A;  4N4F A;  4WZ0 A;  3L1Z B;  2XEU A;  1IYM A;  2LGV A;  3DDT A;  3LQJ A;  4BHW A;  5FER A;  5G04 B;  1JM7 A;  1N87 A;  3QZV A;  2KGI A;  4W4U A;  2KRE A;  2ECW A;  3SUB A;  4O62 A;  2JMD A;  3FEH A;  5J3X A;  3PLW A;  2VJF B;  3EB6 A;  2Y1N A;  5B79 A;  4GNG A;  3N9P A;  2CSV A;  5TBN A;  2DSM A;  1DCQ A;  5B8D A;  4YAX A;  4WZ3 B;  2LAU A;  2L43 A;  3HCS A;  1VD4 A;  2VJE B;  2JRJ A;  2K17 A;  2LN0 A;  4PPE A;  3T9K A;  4Z0R A;  1LDJ B;  3JUE A;  3HCU A;  4A0C D;  3U5O A;  2RSD A;  4FK5 A;  2LQ6 A;  3PHD A;  2EA6 A;  4B7Y C;  2OWA A;  2G43 A;  4YBM A;  3GL6 A;  2MNY A;  3N9Q A;  2EXU A;  2LGG A;  2LDR A;  3DQV R;  1WIM A;  5FB0 A;  4QQ4 A;  2G45 A;  5G05 B;  2ECJ A;  2Y1M A;  3V43 A;  1WE9 A;  2FD4 A;  3HCT A;  1WEO A;  1WGM A;  4H9D A;  3SOW A;  1Z6U A;  3FM8 C;  1XWH A;  4LJN A;  4OGC A;  2XOC A;  2LGK A;  4TKP B;  2D8U A;  5B77 A;  2B0O E;  1MM2 A;  4R2Y A;  3FAO A;  2KU3 A;  2K16 A;  1WEV A;  3U5P A;  5JG6 A;  4Z0O A;  5DIN A;  2YRE A;  5LKU A;  2KWO A;  4O64 A;  2LV9 A;  2VJF A;  2HYE D;  4B86 C;  4F1P A;  1X4J A;  4L7X A;  1E4U A;  3LRQ A;  1MBM A;  2E6R A;  5K3Q A;  2KKY A;  5TDR A;  5EYA F;  5B78 A;  4LKA A;  4IC2 A;  2VPG A;  5SVY A;  3EB5 A;  5H1V A;  2VNF A;  2FFW A;  1ZBD B;  2F42 A;  2QJ0 A;  4AP4 A;  1HYJ A;  2MT5 A;  3NG2 A;  4P5O B;  3ZYQ A;  2OXQ C;  2KIZ A;  2RR4 A;  3M63 A;  3KV6 A;  4I7B A;  3T7L A;  4F52 B;  3N9M A;  5B76 A;  2JMJ A;  3O34 A;  2KE1 A;  3U5N A;  3LQH A;  2KKX A;  2M13 A;  4I7C A;  2H0D B;  3RPG B;  4IC3 A;  3PUQ A;  4YAT A;  4ZQL A;  4ZDT A;  3O37 A;  1T1H A;  5D1K B;  4S3O C;  2EOD A;  2YW8 A;  5AIT A;  3KDE C;  2VPD A;  5DKA A;  3VK6 A;  4R7E A;  2DJA A;  2ECT A;  2ECG A;  2KWN A;  4MVT A;  2YVR A;  5G0F A;  5TRB A;  3MHS A;  3ZPV E;  5LKX A;  2Y43 A;  3O35 A;  2ECN A;  2CRR A;  4GB0 A;  5KH7 A;  2F6N A;  2XOZ A;  2QIC A;  4A4B A;  1G25 A;  2MA6 A;  2QIZ A;  2PUY A;  5H1U A;  2CSY A;  3SOU A;  2IQJ A;  2KFT A;  3KNV A;  3U5M A;  1HYI A;  4YBT A;  1VYX A;  3HTK C;  2L5U A;  1VFY A;  1JOC A;  5LCW B;  2M3H A;  3KV5 A;  3KQI A;  4FJC A;  4GND A;  4MSX A;  2PNX A;  4LK9 A;  2CON A;  2JM3 A;  3H7H A;  3FJU B;  1X4U A;  4CCG X;  2CKL A;  2UZG A;  4YC9 A;  4I7D A;  3ZVZ B;  1WFK A;  4N3W A;  1K2F A;  4UP5 A;  2MNZ A;  2C2L A;  2K1J A;  2BAY A;  5KH3 A;  5SVI B;  2RI7 A;  2F6J A;  1Z60 A;  2H0D A;  2LXP C;  4A4C A;  2YUC A; 
#chains in the Genus database with same CATH homology
 3MHH A;  2LXH C;  2YYR A;  2M85 A;  1WEW A;  3C6W A;  4LAD B;  3N9L A;  3O36 A;  3L11 A;  2YQM A;  4ZUX U;  3ASL A;  4R8P K;  1LDK C;  5C13 A;  4L58 A;  2FUU A;  3ZVY A;  1X4I A;  4FIP A;  4NN2 A;  2MA5 A;  4AUQ B;  4S3O B;  2C2V S;  4UP0 A;  2ECI A;  3O70 A;  4QF3 A;  4YAB A;  4A49 A;  2YSM A;  2M6M A;  1MM3 A;  4QF2 A;  2VJE A;  5FEY A;  2CSZ A;  4FO9 A;  2XB1 A;  3ZPV 1;  2FUI A;  3N9N A;  5TDW A;  2YQL A;  2CKL B;  4V3L C;  2YU4 A;  1WEM A;  5B75 A;  2CT2 A;  2D8S A;  1WES A;  3RTR B;  5TAB A;  2KWJ A;  4PTB A;  3M62 A;  2I50 A;  5AIU A;  2VPB A;  3FL2 A;  1WEE A;  5LKZ A;  3PUR A;  2KR4 A;  2G6Q A;  2L80 A;  1BOR A;  1CHC A;  2ZET C;  2FSA A;  2MIQ A;  3O33 A;  4GNF A;  3N9O A;  2LGL A;  2JMI A;  5I3L A;  4BBQ A;  2IDA A;  1WEN A;  5D1L B;  1F62 A;  2VPE A;  2YHO A;  2MUM A;  2MD8 C;  4X3G A;  4YAD A;  2YT5 A;  4GNE A;  4UI9 B;  3SHB A;  5KH9 A;  4V3K C;  1DVP A;  1JM7 B;  1V87 A;  5D1M B;  1Z2Q A;  1WEU A;  1U6G B;  5FB1 A;  4AVX A;  5LKT A;  2L0B A;  2KGG A;  2EGP A;  2LRI C;  2K4D A;  2E6S A;  3I2D A;  1RMD A;  2MD7 B;  3ZNI A;  4YBS A;  2YHN A;  3IHP A;  3M99 A;  2YSJ A;  5H9M A;  1FP0 A;  3GV4 A;  1WIL A;  3DPL R;  5C11 A;  4AYC B;  3SOX A;  4LLB A;  3C5K A;  1WEP A;  2DX8 A;  3L1X A;  2HDP A;  5H1T A;  2L75 A;  4WA6 A;  3T6R A;  1FBV A;  3LQI A;  2M1R A;  2VP7 A;  4XI1 A;  3O7A A;  2YUR A;  2ECV A;  2KYU A;  4AYC A;  4WZ2 A;  3RPG C;  4Q6F A;  4CA1 A;  4C9Z A;  3ZTG A;  2AN6 A;  2KWK A;  2NAA A;  1WEQ A;  4N4F A;  4WZ0 A;  3L1Z B;  2XEU A;  1IYM A;  2LGV A;  3LQJ A;  4BHW A;  5FER A;  5G04 B;  1JM7 A;  1N87 A;  3QZV A;  2KGI A;  4W4U A;  2KRE A;  2ECW A;  2JMD A;  5J3X A;  2VJF B;  3EB6 A;  2Y1N A;  5B79 A;  4GNG A;  3N9P A;  5TBN A;  5B8D A;  4YAX A;  4WZ3 B;  2L43 A;  3HCS A;  1VD4 A;  2VJE B;  2JRJ A;  2K17 A;  2LN0 A;  4PPE A;  1LDJ B;  3HCU A;  4A0C D;  3U5O A;  2RSD A;  4FK5 A;  2LQ6 A;  3PHD A;  2EA6 A;  4B7Y C;  2G43 A;  4YBM A;  3GL6 A;  2MNY A;  3N9Q A;  2LGG A;  2LDR A;  3DQV R;  1WIM A;  5FB0 A;  2G45 A;  5G05 B;  2ECJ A;  2Y1M A;  3V43 A;  1WE9 A;  3HCT A;  1WEO A;  1WGM A;  3SOW A;  1Z6U A;  1XWH A;  4LJN A;  2LGK A;  4TKP B;  5B77 A;  1MM2 A;  4R2Y A;  2KU3 A;  2K16 A;  1WEV A;  3U5P A;  5JG6 A;  5DIN A;  2YRE A;  5LKU A;  2KWO A;  4O64 A;  2LV9 A;  2VJF A;  2HYE D;  4B86 C;  1X4J A;  4L7X A;  1E4U A;  3LRQ A;  2E6R A;  5TDR A;  5EYA F;  5B78 A;  4LKA A;  4IC2 A;  2VPG A;  3EB5 A;  5H1V A;  2VNF A;  1ZBD B;  2F42 A;  2QJ0 A;  4AP4 A;  1HYJ A;  2MT5 A;  3NG2 A;  4P5O B;  3ZYQ A;  2OXQ C;  2KIZ A;  3M63 A;  3KV6 A;  4I7B A;  3T7L A;  4F52 B;  3N9M A;  5B76 A;  2JMJ A;  3O34 A;  2KE1 A;  3U5N A;  3LQH A;  4I7C A;  2H0D B;  3RPG B;  4IC3 A;  3PUQ A;  4YAT A;  4ZQL A;  4ZDT A;  3O37 A;  1T1H A;  5D1K B;  4S3O C;  2EOD A;  2YW8 A;  5AIT A;  2VPD A;  5DKA A;  3VK6 A;  4R7E A;  2ECT A;  2ECG A;  2KWN A;  4MVT A;  5G0F A;  5TRB A;  3MHS A;  3ZPV E;  5LKX A;  2Y43 A;  3O35 A;  2ECN A;  4GB0 A;  5KH7 A;  2F6N A;  2QIC A;  4A4B A;  1G25 A;  2MA6 A;  2QIZ A;  2PUY A;  5H1U A;  2CSY A;  3SOU A;  3KNV A;  2KFT A;  3U5M A;  1HYI A;  4YBT A;  1VYX A;  3HTK C;  2L5U A;  1VFY A;  1JOC A;  5LCW B;  2M3H A;  3KV5 A;  3KQI A;  4FJC A;  4GND A;  4MSX A;  2PNX A;  4LK9 A;  1X4U A;  4CCG X;  2CKL A;  2UZG A;  4YC9 A;  4I7D A;  3ZVZ B;  1WFK A;  4N3W A;  1K2F A;  4UP5 A;  2MNZ A;  2C2L A;  2K1J A;  2BAY A;  5KH3 A;  2RI7 A;  2F6J A;  1Z60 A;  2H0D A;  2LXP C;  4A4C A;  2YUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...