3V43A

Crystal structure of moz
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
HMEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT6A
publication title Combinatorial readout of unmodified H3R2 and acetylated H3K14 by the tandem PHD finger of MOZ reveals a regulatory mechanism for HOXA9 transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/structural protein
total genus 22
structure length 112
sequence length 112
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3v43A00
2L80A 3SOUA 3N9OA 4CA1A 1WEOA 2VNFA 4N4FA 1FP0A 1Z2QA 5C11A 2LV9A 2YHNA 5LKZA 4WA6A 3LRQA 4A0CD 3M99A 3KV5A 4BHWA 1G25A 2EODA 2H0DA 3ZVZB 1WIMA 4B7YC 5C13A 4S3OC 4YATA 4NN2A 2EGPA 2H0DB 1RMDA 4A4CA 1XWHA 1K2FA 2F6NA 2F6JA 3N9PA 1DVPA 4QF2A 5LKXA 1FBVA 2MA5A 2DX8A 1WE9A 2MUMA 4L7XA 2KU3A 2KGIA 3O35A 1Z60A 2JMIA 2HYED 3C5KA 2QICA 4WZ2A 3FL2A 3HCTA 2EA6A 4TKPB 3NG2A 4WZ0A 1MM3A 2M85A 5DINA 2VPEA 4LJNA 3I2DA 3ASLA 1JM7A 3O70A 3O7AA 4GNDA 1CHCA 2G43A 1VFYA 1WEWA 2YURA 2NAAA 2RSDA 1JM7B 1V87A 3O37A 2VJFA 3PURA 2E6SA 4AYCA 1Z6UA 3O33A 3GV4A 4C9ZA 2MA6A 2VPBA 2VJFB 2LGGA 4AYCB 3N9QA 4N3WA 3L11A 2KR4A 4YBTA 4LKAA 2F42A 4GNFA 1JOCA 2L5UA 2FSAA 2VJEA 4I7BA 1WENA 2KE1A 1WEUA 2VJEB 3O34A 3ZNIA 1WESA 2KWKA 4FK5A 2MIQA 3ZPVE 2KREA 2L43A 4UP0A 2Y43A 4FJCA 1BORA 4IC3A 4V3KC 4FIPA 3T6RA 5H1VA 5KH9A 2E6RA 2YW8A 2G45A 4R7EA 4YC9A 2YQMA 3DQVR 4I7CA 3L1ZB 4PPEA 5H9MA 2CSYA 3MHHA 2ECVA 2ECWA 2VPGA 3VK6A 5I3LA 5G04B 1E4UA 4S3OB 4P5OB 3U5MA 4BBQA 2YHOA 2M1RA 2RI7A 3KQIA 2LGKA 1WEEA 2CSZA 5LCWB 2LDRA 2KIZA 5LKUA 4L58A 3LQJA 3N9NA 3DPLR 4O64A 5J3XA 5JG6A 2XEUA 2YSJA 2ZETC 5B79A 1MM2A 4AVXA 5B78A 2I50A 2YSMA 2ECJA 2KWJA 2JMJA 2MD7B 3ZYQA 4A4BA 2BAYA 5FB1A 3QZVA 2UZGA 2ECGA 3PHDA 2M3HA 4MVTA 2M6MA 5FB0A 4X3GA 1X4JA 1VD4A 3U5PA 5D1KB 1T1HA 2Y1NA 3KV6A 2ECTA 4PTBA 3HTKC 5B8DA 4YBSA 3EB6A 5LKTA 5KH7A 2PUYA 4GNEA 3U5OA 2ECIA 5KH3A 5B76A 4GNGA 4LADB 2OXQC 1WFKA 2FUUA 4LLBA 2C2VS 4ZDTA 2YYRA 2AN6A 1WEPA 2LXPC 4AP4A 3M62A 2IDAA 5AITA 3V43A 5TRBA 3HCUA 4F52B 2C2LA 3SHBA 3N9MA 2HDPA 3RTRB 5H1TA 2CT2A 5FERA 1HYJA 1U6GB 5G0FA 2LGLA 3KNVA 5AIUA 3L1XA 3RPGC 3T7LA 2L0BA 4FO9A 3ZPV1 5G05B 3M63A 2YUCA 1WILA 4MSXA 2KWNA 5D1MB 4YBMA 3RPGB 2KFTA 3U5NA 3SOWA 4QF3A 1N87A 4YADA 2KGGA 2FUIA 4R2YA 3GL6A 4Q6FA 4A49A 3MHSA 1LDKC 2VP7A 3O36A 1IYMA 3ZVYA 4UP5A 4R8PK 3ZTGA 2LRIC 3LQHA 3SOXA 1HYIA 5B75A 2D8SA 4ZQLA 1ZBDB 2CKLA 2Y1MA 4W4UA 3LQIA 5TABA 5DKAA 4IC2A 3IHPA 5FEYA 3PUQA 4YAXA 2K1JA 2L75A 4UI9B 3EB5A 5TDRA 2CKLB 2QJ0A 2G6QA 4I7DA 2MT5A 3C6WA 2XB1A 2JMDA 2ECNA 2PNXA 2YREA 2LGVA 1F62A 5D1LB 5H1UA 2MNZA 1X4IA 1WEMA 2LXHC 1VYXA 4LK9A 2JRJA 1WGMA 4ZUXU 4B86C 4YABA 2MD8C 2KYUA 4AUQB 2YQLA 1WEQA 1LDJB 2KWOA 4V3LC 1X4UA 1WEVA 2LQ6A 2YU4A 5TDWA 5EYAF 4GB0A 2K17A 4CCGX 2K4DA 3HCSA 5TBNA 3N9LA 4XI1A 2QIZA 4WZ3B 2VPDA 2K16A 2LN0A 2YT5A 2MNYA 5B77A
chains in the Genus database with same CATH superfamily
2L80A 2DJAA 3SOUA 3N9OA 4CA1A 1WEOA 2VNFA 4N4FA 1FP0A 1Z2QA 5C11A 2LV9A 2YHNA 5LKZA 4WA6A 3LRQA 4A0CD 3M99A 3KV5A 4BHWA 4F1PA 1G25A 2EODA 2H0DA 3ZVZB 1WIMA 4B7YC 5C13A 4S3OC 3T9KA 4YATA 4NN2A 2EGPA 2H0DB 1RMDA 2RR4A 3FM8C 4A4CA 1XWHA 1K2FA 2F6NA 2F6JA 3N9PA 1DVPA 4QF2A 3LVQE 5LKXA 1FBVA 2MA5A 2DX8A 2FD4A 1WE9A 2MUMA 4L7XA 2KU3A 2KGIA 3O35A 1Z60A 2JMIA 4OGEA 2HYED 3C5KA 2QICA 4WZ2A 3FL2A 3HCTA 2YVRA 2EA6A 3MDBC 4TKPB 3E2DA 3NG2A 4WZ0A 1MM3A 2M85A 5DINA 2VPEA 4H9DA 4LJNA 3DWDA 3I2DA 3H7HA 3ASLA 1JM7A 3O70A 3O7AA 4GNDA 1CHCA 2G43A 1VFYA 1WEWA 2YURA 2NAAA 2RSDA 2JUNA 2JM3A 1JM7B 1V87A 3O37A 2VJFA 3PURA 2E6SA 4AYCA 3JUEA 1Z6UA 3O33A 3GV4A 2KKXA 4C9ZA 2XOYA 2MA6A 2VPBA 1DCQA 2VJFB 2LGGA 2D8UA 2LAUA 4AYCB 3N9QA 4N3WA 3L11A 2KR4A 3DDTA 4YBTA 2CRWA 4LKAA 2F42A 4GNFA 1JOCA 2L5UA 2CRRA 4QQ4A 2FSAA 2VJEA 3FANA 4I7BA 1WENA 2FFWA 2KE1A 1WEUA 2VJEB 3O34A 3ZNIA 1WESA 2KWKA 4FK5A 2MIQA 3Q1DA 3ZPVE 2KREA 2L43A 4UP0A 2Y43A 4FJCA 3KDEC 1BORA 4IC3A 4V3KC 4FIPA 3T6RA 5H1VA 2M13A 3FEHA 5KH9A 2E6RA 5K3QA 2YW8A 2G45A 4R7EA 4YC9A 2YQMA 3DQVR 4I7CA 3L1ZB 4PPEA 2CSYA 3MHHA 5H9MA 2ECVA 2ECWA 2VPGA 2E61A 3FJUB 3VK6A 5I3LA 5G04B 2KKYA 1E4UA 4S3OB 4P5OB 3U5MA 4BBQA 2YHOA 2M1RA 2RI7A 3KQIA 2LGKA 1WEEA 2CSZA 5LCWB 2LDRA 2KIZA 5LKUA 2IQJA 4L58A 3LQJA 3N9NA 3DPLR 4O64A 5J3XA 5JG6A 2XEUA 2YSJA 2ZETC 5B79A 1MM2A 4AVXA 5B78A 2I50A 2YSMA 2ECJA 2KWJA 2JMJA 2MD7B 3ZYQA 4A4BA 2BAYA 5FB1A 3QZVA 2UZGA 2ECGA 3PHDA 2M3HA 4OGCA 4MVTA 2M6MA 5FB0A 4X3GA 1X4JA 1VD4A 3U5PA 5D1KB 1T1HA 2Y1NA 3KV6A 2ECTA 4PTBA 2EXUA 3HTKC 5B8DA 4YBSA 3EB6A 5LKTA 5KH7A 2PUYA 2P57A 4GNEA 3U5OA 2ECIA 5KH3A 5B76A 4GNGA 4LADB 2OXQC 1WFKA 2FUUA 4LLBA 2C2VS 4ZDTA 2YYRA 2AN6A 1WEPA 2LXPC 4AP4A 3M62A 2IDAA 5AITA 3V43A 5TRBA 3HCUA 4F52B 2XOZA 2C2LA 3SHBA 3N9MA 2HDPA 3RTRB 5H1TA 4Z0RA 2CT2A 5FERA 1HYJA 1U6GB 5G0FA 3O47A 2LGLA 3KNVA 5AIUA 3L1XA 3RPGC 4O62A 3T7LA 2L0BA 5SVIA 4FO9A 2XOCA 3ZPV1 2B0OE 5G05B 3M63A 2YUCA 1WILA 4MSXA 2KWNA 5D1MB 5SVXA 5SVIB 4YBMA 3RPGB 2KFTA 5SVYA 3U5NA 3SOWA 2MKEA 4QF3A 1N87A 4YADA 2KGGA 2FUIA 4R2YA 3GL6A 4Q6FA 2OWAA 4A49A 3MHSA 1LDKC 2VP7A 3O36A 1IYMA 3ZVYA 4UP5A 4R8PK 3ZTGA 2LRIC 3LQHA 3SOXA 1HYIA 2CSVA 5B75A 2XP0A 2D8SA 4ZQLA 1ZBDB 2CKLA 2Y1MA 4W4UA 3LQIA 5TABA 5DKAA 4IC2A 3IHPA 5FEYA 3PUQA 4YAXA 4Z0OA 2K1JA 2L75A 4UI9B 3EB5A 5TDRA 2CKLB 2QJ0A 2G6QA 4I7DA 2MT5A 3SUBA 3C6WA 2XB1A 2JMDA 2ECNA 2PNXA 2YREA 2LGVA 1F62A 5D1LB 5H1UA 3FAOA 2EGMA 2MNZA 1X4IA 3M7KA 1WEMA 2LXHC 2CONA 3PLWA 1VYXA 4LK9A 3LVRE 2JRJA 1WGMA 4ZUXU 3LDYA 4B86C 2L7PA 2DSMA 4YABA 2MD8C 2KYUA 4AUQB 2YQLA 1MBMA 1LDJB 1WEQA 2KWOA 1X4UA 4V3LC 1WEVA 2LQ6A 2YU4A 3LJUX 5TDWA 5EYAF 4GB0A 2K17A 4CCGX 2K4DA 3HCSA 5TBNA 3N9LA 4XI1A 2QIZA 4WZ3B 2VPDA 2K16A 2LN0A 2YT5A 2MNYA 5B77A
chains in the Genus database with same CATH topology
2L80A 3SOUA 3N9OA 4CA1A 1WEOA 2VNFA 4N4FA 1FP0A 1Z2QA 5C11A 2LV9A 2YHNA 5LKZA 4WA6A 3LRQA 4A0CD 3M99A 3KV5A 4BHWA 1G25A 2EODA 2H0DA 3ZVZB 1WIMA 4B7YC 5C13A 4S3OC 4YATA 4NN2A 2EGPA 2H0DB 1RMDA 4A4CA 1XWHA 1K2FA 2F6NA 2F6JA 3N9PA 1DVPA 4QF2A 5LKXA 1FBVA 2MA5A 2DX8A 1WE9A 2MUMA 4L7XA 2KU3A 2KGIA 3O35A 1Z60A 2JMIA 2HYED 3C5KA 2QICA 4WZ2A 3FL2A 3HCTA 2EA6A 4TKPB 3NG2A 4WZ0A 1MM3A 2M85A 5DINA 2VPEA 4LJNA 3I2DA 3ASLA 1JM7A 3O70A 3O7AA 4GNDA 1CHCA 2G43A 1VFYA 1WEWA 2YURA 2NAAA 2RSDA 1JM7B 1V87A 3O37A 2VJFA 3PURA 2E6SA 4AYCA 1Z6UA 3O33A 3GV4A 4C9ZA 2MA6A 2VPBA 2VJFB 2LGGA 4AYCB 3N9QA 4N3WA 3L11A 2KR4A 4YBTA 4LKAA 2F42A 4GNFA 1JOCA 2L5UA 2FSAA 2VJEA 4I7BA 1WENA 2KE1A 1WEUA 2VJEB 3O34A 3ZNIA 1WESA 2KWKA 4FK5A 2MIQA 3ZPVE 2KREA 2L43A 4UP0A 2Y43A 4FJCA 1BORA 4IC3A 4V3KC 4FIPA 3T6RA 5H1VA 5KH9A 2E6RA 2YW8A 2G45A 4R7EA 4YC9A 2YQMA 3DQVR 4I7CA 3L1ZB 4PPEA 5H9MA 2CSYA 3MHHA 2ECVA 2ECWA 2VPGA 3VK6A 5I3LA 5G04B 1E4UA 4S3OB 4P5OB 3U5MA 4BBQA 2YHOA 2M1RA 2RI7A 3KQIA 2LGKA 1WEEA 2CSZA 5LCWB 2LDRA 2KIZA 5LKUA 4L58A 3LQJA 3N9NA 3DPLR 4O64A 5J3XA 5JG6A 2XEUA 2YSJA 2ZETC 5B79A 1MM2A 4AVXA 5B78A 2I50A 2YSMA 2ECJA 2KWJA 2JMJA 2MD7B 3ZYQA 4A4BA 2BAYA 5FB1A 3QZVA 2UZGA 2ECGA 3PHDA 2M3HA 4MVTA 2M6MA 5FB0A 4X3GA 1X4JA 1VD4A 3U5PA 5D1KB 1T1HA 2Y1NA 3KV6A 2ECTA 4PTBA 3HTKC 5B8DA 4YBSA 3EB6A 5LKTA 5KH7A 2PUYA 4GNEA 3U5OA 2ECIA 5KH3A 5B76A 4GNGA 4LADB 2OXQC 1WFKA 2FUUA 4LLBA 2C2VS 4ZDTA 2YYRA 2AN6A 1WEPA 2LXPC 4AP4A 3M62A 2IDAA 5AITA 3V43A 5TRBA 3HCUA 4F52B 2C2LA 3SHBA 3N9MA 2HDPA 3RTRB 5H1TA 2CT2A 5FERA 1HYJA 1U6GB 5G0FA 2LGLA 3KNVA 5AIUA 3L1XA 3RPGC 3T7LA 2L0BA 4FO9A 3ZPV1 5G05B 3M63A 2YUCA 1WILA 4MSXA 2KWNA 5D1MB 4YBMA 3RPGB 2KFTA 3U5NA 3SOWA 4QF3A 1N87A 4YADA 2KGGA 2FUIA 4R2YA 3GL6A 4Q6FA 4A49A 3MHSA 1LDKC 2VP7A 3O36A 1IYMA 3ZVYA 4UP5A 4R8PK 3ZTGA 2LRIC 3LQHA 3SOXA 1HYIA 5B75A 2D8SA 4ZQLA 1ZBDB 2CKLA 2Y1MA 4W4UA 3LQIA 5TABA 5DKAA 4IC2A 3IHPA 5FEYA 3PUQA 4YAXA 2K1JA 2L75A 4UI9B 3EB5A 5TDRA 2CKLB 2QJ0A 2G6QA 4I7DA 2MT5A 3C6WA 2XB1A 2JMDA 2ECNA 2PNXA 2YREA 2LGVA 1F62A 5D1LB 5H1UA 2MNZA 1X4IA 1WEMA 2LXHC 1VYXA 4LK9A 2JRJA 1WGMA 4ZUXU 4B86C 4YABA 2MD8C 2KYUA 4AUQB 2YQLA 1WEQA 1LDJB 2KWOA 4V3LC 1X4UA 1WEVA 2LQ6A 2YU4A 5TDWA 5EYAF 4GB0A 2K17A 4CCGX 2K4DA 3HCSA 5TBNA 3N9LA 4XI1A 2QIZA 4WZ3B 2VPDA 2K16A 2LN0A 2YT5A 2MNYA 5B77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L80 A;  3SOU A;  3N9O A;  4CA1 A;  1WEO A;  2VNF A;  4N4F A;  1FP0 A;  1Z2Q A;  5C11 A;  2LV9 A;  2YHN A;  5LKZ A;  4WA6 A;  3LRQ A;  4A0C D;  3M99 A;  3KV5 A;  4BHW A;  1G25 A;  2EOD A;  2H0D A;  3ZVZ B;  1WIM A;  4B7Y C;  5C13 A;  4S3O C;  4YAT A;  4NN2 A;  2EGP A;  2H0D B;  1RMD A;  4A4C A;  1XWH A;  1K2F A;  2F6N A;  2F6J A;  3N9P A;  1DVP A;  4QF2 A;  5LKX A;  1FBV A;  2MA5 A;  2DX8 A;  1WE9 A;  2MUM A;  4L7X A;  2KU3 A;  2KGI A;  3O35 A;  1Z60 A;  2JMI A;  2HYE D;  3C5K A;  2QIC A;  4WZ2 A;  3FL2 A;  3HCT A;  2EA6 A;  4TKP B;  3NG2 A;  4WZ0 A;  1MM3 A;  2M85 A;  5DIN A;  2VPE A;  4LJN A;  3I2D A;  3ASL A;  1JM7 A;  3O70 A;  3O7A A;  4GND A;  1CHC A;  2G43 A;  1VFY A;  1WEW A;  2YUR A;  2NAA A;  2RSD A;  1JM7 B;  1V87 A;  3O37 A;  2VJF A;  3PUR A;  2E6S A;  4AYC A;  1Z6U A;  3O33 A;  3GV4 A;  4C9Z A;  2MA6 A;  2VPB A;  2VJF B;  2LGG A;  4AYC B;  3N9Q A;  4N3W A;  3L11 A;  2KR4 A;  4YBT A;  4LKA A;  2F42 A;  4GNF A;  1JOC A;  2L5U A;  2FSA A;  2VJE A;  4I7B A;  1WEN A;  2KE1 A;  1WEU A;  2VJE B;  3O34 A;  3ZNI A;  1WES A;  2KWK A;  4FK5 A;  2MIQ A;  3ZPV E;  2KRE A;  2L43 A;  4UP0 A;  2Y43 A;  4FJC A;  1BOR A;  4IC3 A;  4V3K C;  4FIP A;  3T6R A;  5H1V A;  5KH9 A;  2E6R A;  2YW8 A;  2G45 A;  4R7E A;  4YC9 A;  2YQM A;  3DQV R;  4I7C A;  3L1Z B;  4PPE A;  5H9M A;  2CSY A;  3MHH A;  2ECV A;  2ECW A;  2VPG A;  3VK6 A;  5I3L A;  5G04 B;  1E4U A;  4S3O B;  4P5O B;  3U5M A;  4BBQ A;  2YHO A;  2M1R A;  2RI7 A;  3KQI A;  2LGK A;  1WEE A;  2CSZ A;  5LCW B;  2LDR A;  2KIZ A;  5LKU A;  4L58 A;  3LQJ A;  3N9N A;  3DPL R;  4O64 A;  5J3X A;  5JG6 A;  2XEU A;  2YSJ A;  2ZET C;  5B79 A;  1MM2 A;  4AVX A;  5B78 A;  2I50 A;  2YSM A;  2ECJ A;  2KWJ A;  2JMJ A;  2MD7 B;  3ZYQ A;  4A4B A;  2BAY A;  5FB1 A;  3QZV A;  2UZG A;  2ECG A;  3PHD A;  2M3H A;  4MVT A;  2M6M A;  5FB0 A;  4X3G A;  1X4J A;  1VD4 A;  3U5P A;  5D1K B;  1T1H A;  2Y1N A;  3KV6 A;  2ECT A;  4PTB A;  3HTK C;  5B8D A;  4YBS A;  3EB6 A;  5LKT A;  5KH7 A;  2PUY A;  4GNE A;  3U5O A;  2ECI A;  5KH3 A;  5B76 A;  4GNG A;  4LAD B;  2OXQ C;  1WFK A;  2FUU A;  4LLB A;  2C2V S;  4ZDT A;  2YYR A;  2AN6 A;  1WEP A;  2LXP C;  4AP4 A;  3M62 A;  2IDA A;  5AIT A;  3V43 A;  5TRB A;  3HCU A;  4F52 B;  2C2L A;  3SHB A;  3N9M A;  2HDP A;  3RTR B;  5H1T A;  2CT2 A;  5FER A;  1HYJ A;  1U6G B;  5G0F A;  2LGL A;  3KNV A;  5AIU A;  3L1X A;  3RPG C;  3T7L A;  2L0B A;  4FO9 A;  3ZPV 1;  5G05 B;  3M63 A;  2YUC A;  1WIL A;  4MSX A;  2KWN A;  5D1M B;  4YBM A;  3RPG B;  2KFT A;  3U5N A;  3SOW A;  4QF3 A;  1N87 A;  4YAD A;  2KGG A;  2FUI A;  4R2Y A;  3GL6 A;  4Q6F A;  4A49 A;  3MHS A;  1LDK C;  2VP7 A;  3O36 A;  1IYM A;  3ZVY A;  4UP5 A;  4R8P K;  3ZTG A;  2LRI C;  3LQH A;  3SOX A;  1HYI A;  5B75 A;  2D8S A;  4ZQL A;  1ZBD B;  2CKL A;  2Y1M A;  4W4U A;  3LQI A;  5TAB A;  5DKA A;  4IC2 A;  3IHP A;  5FEY A;  3PUQ A;  4YAX A;  2K1J A;  2L75 A;  4UI9 B;  3EB5 A;  5TDR A;  2CKL B;  2QJ0 A;  2G6Q A;  4I7D A;  2MT5 A;  3C6W A;  2XB1 A;  2JMD A;  2ECN A;  2PNX A;  2YRE A;  2LGV A;  1F62 A;  5D1L B;  5H1U A;  2MNZ A;  1X4I A;  1WEM A;  2LXH C;  1VYX A;  4LK9 A;  2JRJ A;  1WGM A;  4ZUX U;  4B86 C;  4YAB A;  2MD8 C;  2KYU A;  4AUQ B;  2YQL A;  1WEQ A;  1LDJ B;  2KWO A;  4V3L C;  1X4U A;  1WEV A;  2LQ6 A;  2YU4 A;  5TDW A;  5EYA F;  4GB0 A;  2K17 A;  4CCG X;  2K4D A;  3HCS A;  5TBN A;  3N9L A;  4XI1 A;  2QIZ A;  4WZ3 B;  2VPD A;  2K16 A;  2LN0 A;  2YT5 A;  2MNY A;  5B77 A; 
#chains in the Genus database with same CATH topology
 2L80 A;  2DJA A;  3SOU A;  3N9O A;  4CA1 A;  1WEO A;  2VNF A;  4N4F A;  1FP0 A;  1Z2Q A;  5C11 A;  2LV9 A;  2YHN A;  5LKZ A;  4WA6 A;  3LRQ A;  4A0C D;  3M99 A;  3KV5 A;  4BHW A;  4F1P A;  1G25 A;  2EOD A;  2H0D A;  3ZVZ B;  1WIM A;  4B7Y C;  5C13 A;  4S3O C;  3T9K A;  4YAT A;  4NN2 A;  2EGP A;  2H0D B;  1RMD A;  2RR4 A;  3FM8 C;  4A4C A;  1XWH A;  1K2F A;  2F6N A;  2F6J A;  3N9P A;  1DVP A;  4QF2 A;  3LVQ E;  5LKX A;  1FBV A;  2MA5 A;  2DX8 A;  2FD4 A;  1WE9 A;  2MUM A;  4L7X A;  2KU3 A;  2KGI A;  3O35 A;  1Z60 A;  2JMI A;  4OGE A;  2HYE D;  3C5K A;  2QIC A;  4WZ2 A;  3FL2 A;  3HCT A;  2YVR A;  2EA6 A;  3MDB C;  4TKP B;  3E2D A;  3NG2 A;  4WZ0 A;  1MM3 A;  2M85 A;  5DIN A;  2VPE A;  4H9D A;  4LJN A;  3DWD A;  3I2D A;  3H7H A;  3ASL A;  1JM7 A;  3O70 A;  3O7A A;  4GND A;  1CHC A;  2G43 A;  1VFY A;  1WEW A;  2YUR A;  2NAA A;  2RSD A;  2JUN A;  2JM3 A;  1JM7 B;  1V87 A;  3O37 A;  2VJF A;  3PUR A;  2E6S A;  4AYC A;  3JUE A;  1Z6U A;  3O33 A;  3GV4 A;  2KKX A;  4C9Z A;  2XOY A;  2MA6 A;  2VPB A;  1DCQ A;  2VJF B;  2LGG A;  2D8U A;  2LAU A;  4AYC B;  3N9Q A;  4N3W A;  3L11 A;  2KR4 A;  3DDT A;  4YBT A;  2CRW A;  4LKA A;  2F42 A;  4GNF A;  1JOC A;  2L5U A;  2CRR A;  4QQ4 A;  2FSA A;  2VJE A;  3FAN A;  4I7B A;  1WEN A;  2FFW A;  2KE1 A;  1WEU A;  2VJE B;  3O34 A;  3ZNI A;  1WES A;  2KWK A;  4FK5 A;  2MIQ A;  3Q1D A;  3ZPV E;  2KRE A;  2L43 A;  4UP0 A;  2Y43 A;  4FJC A;  3KDE C;  1BOR A;  4IC3 A;  4V3K C;  4FIP A;  3T6R A;  5H1V A;  2M13 A;  3FEH A;  5KH9 A;  2E6R A;  5K3Q A;  2YW8 A;  2G45 A;  4R7E A;  4YC9 A;  2YQM A;  3DQV R;  4I7C A;  3L1Z B;  4PPE A;  2CSY A;  3MHH A;  5H9M A;  2ECV A;  2ECW A;  2VPG A;  2E61 A;  3FJU B;  3VK6 A;  5I3L A;  5G04 B;  2KKY A;  1E4U A;  4S3O B;  4P5O B;  3U5M A;  4BBQ A;  2YHO A;  2M1R A;  2RI7 A;  3KQI A;  2LGK A;  1WEE A;  2CSZ A;  5LCW B;  2LDR A;  2KIZ A;  5LKU A;  2IQJ A;  4L58 A;  3LQJ A;  3N9N A;  3DPL R;  4O64 A;  5J3X A;  5JG6 A;  2XEU A;  2YSJ A;  2ZET C;  5B79 A;  1MM2 A;  4AVX A;  5B78 A;  2I50 A;  2YSM A;  2ECJ A;  2KWJ A;  2JMJ A;  2MD7 B;  3ZYQ A;  4A4B A;  2BAY A;  5FB1 A;  3QZV A;  2UZG A;  2ECG A;  3PHD A;  2M3H A;  4OGC A;  4MVT A;  2M6M A;  5FB0 A;  4X3G A;  1X4J A;  1VD4 A;  3U5P A;  5D1K B;  1T1H A;  2Y1N A;  3KV6 A;  2ECT A;  4PTB A;  2EXU A;  3HTK C;  5B8D A;  4YBS A;  3EB6 A;  5LKT A;  5KH7 A;  2PUY A;  2P57 A;  4GNE A;  3U5O A;  2ECI A;  5KH3 A;  5B76 A;  4GNG A;  4LAD B;  2OXQ C;  1WFK A;  2FUU A;  4LLB A;  2C2V S;  4ZDT A;  2YYR A;  2AN6 A;  1WEP A;  2LXP C;  4AP4 A;  3M62 A;  2IDA A;  5AIT A;  3V43 A;  5TRB A;  3HCU A;  4F52 B;  2XOZ A;  2C2L A;  3SHB A;  3N9M A;  2HDP A;  3RTR B;  5H1T A;  4Z0R A;  2CT2 A;  5FER A;  1HYJ A;  1U6G B;  5G0F A;  3O47 A;  2LGL A;  3KNV A;  5AIU A;  3L1X A;  3RPG C;  4O62 A;  3T7L A;  2L0B A;  5SVI A;  4FO9 A;  2XOC A;  3ZPV 1;  2B0O E;  5G05 B;  3M63 A;  2YUC A;  1WIL A;  4MSX A;  2KWN A;  5D1M B;  5SVX A;  5SVI B;  4YBM A;  3RPG B;  2KFT A;  5SVY A;  3U5N A;  3SOW A;  2MKE A;  4QF3 A;  1N87 A;  4YAD A;  2KGG A;  2FUI A;  4R2Y A;  3GL6 A;  4Q6F A;  2OWA A;  4A49 A;  3MHS A;  1LDK C;  2VP7 A;  3O36 A;  1IYM A;  3ZVY A;  4UP5 A;  4R8P K;  3ZTG A;  2LRI C;  3LQH A;  3SOX A;  1HYI A;  2CSV A;  5B75 A;  2XP0 A;  2D8S A;  4ZQL A;  1ZBD B;  2CKL A;  2Y1M A;  4W4U A;  3LQI A;  5TAB A;  5DKA A;  4IC2 A;  3IHP A;  5FEY A;  3PUQ A;  4YAX A;  4Z0O A;  2K1J A;  2L75 A;  4UI9 B;  3EB5 A;  5TDR A;  2CKL B;  2QJ0 A;  2G6Q A;  4I7D A;  2MT5 A;  3SUB A;  3C6W A;  2XB1 A;  2JMD A;  2ECN A;  2PNX A;  2YRE A;  2LGV A;  1F62 A;  5D1L B;  5H1U A;  3FAO A;  2EGM A;  2MNZ A;  1X4I A;  3M7K A;  1WEM A;  2LXH C;  2CON A;  3PLW A;  1VYX A;  4LK9 A;  3LVR E;  2JRJ A;  1WGM A;  4ZUX U;  3LDY A;  4B86 C;  2L7P A;  2DSM A;  4YAB A;  2MD8 C;  2KYU A;  4AUQ B;  2YQL A;  1MBM A;  1LDJ B;  1WEQ A;  2KWO A;  1X4U A;  4V3L C;  1WEV A;  2LQ6 A;  2YU4 A;  3LJU X;  5TDW A;  5EYA F;  4GB0 A;  2K17 A;  4CCG X;  2K4D A;  3HCS A;  5TBN A;  3N9L A;  4XI1 A;  2QIZ A;  4WZ3 B;  2VPD A;  2K16 A;  2LN0 A;  2YT5 A;  2MNY A;  5B77 A; 
#chains in the Genus database with same CATH homology
 2L80 A;  3SOU A;  3N9O A;  4CA1 A;  1WEO A;  2VNF A;  4N4F A;  1FP0 A;  1Z2Q A;  5C11 A;  2LV9 A;  2YHN A;  5LKZ A;  4WA6 A;  3LRQ A;  4A0C D;  3M99 A;  3KV5 A;  4BHW A;  1G25 A;  2EOD A;  2H0D A;  3ZVZ B;  1WIM A;  4B7Y C;  5C13 A;  4S3O C;  4YAT A;  4NN2 A;  2EGP A;  2H0D B;  1RMD A;  4A4C A;  1XWH A;  1K2F A;  2F6N A;  2F6J A;  3N9P A;  1DVP A;  4QF2 A;  5LKX A;  1FBV A;  2MA5 A;  2DX8 A;  1WE9 A;  2MUM A;  4L7X A;  2KU3 A;  2KGI A;  3O35 A;  1Z60 A;  2JMI A;  2HYE D;  3C5K A;  2QIC A;  4WZ2 A;  3FL2 A;  3HCT A;  2EA6 A;  4TKP B;  3NG2 A;  4WZ0 A;  1MM3 A;  2M85 A;  5DIN A;  2VPE A;  4LJN A;  3I2D A;  3ASL A;  1JM7 A;  3O70 A;  3O7A A;  4GND A;  1CHC A;  2G43 A;  1VFY A;  1WEW A;  2YUR A;  2NAA A;  2RSD A;  1JM7 B;  1V87 A;  3O37 A;  2VJF A;  3PUR A;  2E6S A;  4AYC A;  1Z6U A;  3O33 A;  3GV4 A;  4C9Z A;  2MA6 A;  2VPB A;  2VJF B;  2LGG A;  4AYC B;  3N9Q A;  4N3W A;  3L11 A;  2KR4 A;  4YBT A;  4LKA A;  2F42 A;  4GNF A;  1JOC A;  2L5U A;  2FSA A;  2VJE A;  4I7B A;  1WEN A;  2KE1 A;  1WEU A;  2VJE B;  3O34 A;  3ZNI A;  1WES A;  2KWK A;  4FK5 A;  2MIQ A;  3ZPV E;  2KRE A;  2L43 A;  4UP0 A;  2Y43 A;  4FJC A;  1BOR A;  4IC3 A;  4V3K C;  4FIP A;  3T6R A;  5H1V A;  5KH9 A;  2E6R A;  2YW8 A;  2G45 A;  4R7E A;  4YC9 A;  2YQM A;  3DQV R;  4I7C A;  3L1Z B;  4PPE A;  5H9M A;  2CSY A;  3MHH A;  2ECV A;  2ECW A;  2VPG A;  3VK6 A;  5I3L A;  5G04 B;  1E4U A;  4S3O B;  4P5O B;  3U5M A;  4BBQ A;  2YHO A;  2M1R A;  2RI7 A;  3KQI A;  2LGK A;  1WEE A;  2CSZ A;  5LCW B;  2LDR A;  2KIZ A;  5LKU A;  4L58 A;  3LQJ A;  3N9N A;  3DPL R;  4O64 A;  5J3X A;  5JG6 A;  2XEU A;  2YSJ A;  2ZET C;  5B79 A;  1MM2 A;  4AVX A;  5B78 A;  2I50 A;  2YSM A;  2ECJ A;  2KWJ A;  2JMJ A;  2MD7 B;  3ZYQ A;  4A4B A;  2BAY A;  5FB1 A;  3QZV A;  2UZG A;  2ECG A;  3PHD A;  2M3H A;  4MVT A;  2M6M A;  5FB0 A;  4X3G A;  1X4J A;  1VD4 A;  3U5P A;  5D1K B;  1T1H A;  2Y1N A;  3KV6 A;  2ECT A;  4PTB A;  3HTK C;  5B8D A;  4YBS A;  3EB6 A;  5LKT A;  5KH7 A;  2PUY A;  4GNE A;  3U5O A;  2ECI A;  5KH3 A;  5B76 A;  4GNG A;  4LAD B;  2OXQ C;  1WFK A;  2FUU A;  4LLB A;  2C2V S;  4ZDT A;  2YYR A;  2AN6 A;  1WEP A;  2LXP C;  4AP4 A;  3M62 A;  2IDA A;  5AIT A;  3V43 A;  5TRB A;  3HCU A;  4F52 B;  2C2L A;  3SHB A;  3N9M A;  2HDP A;  3RTR B;  5H1T A;  2CT2 A;  5FER A;  1HYJ A;  1U6G B;  5G0F A;  2LGL A;  3KNV A;  5AIU A;  3L1X A;  3RPG C;  3T7L A;  2L0B A;  4FO9 A;  3ZPV 1;  5G05 B;  3M63 A;  2YUC A;  1WIL A;  4MSX A;  2KWN A;  5D1M B;  4YBM A;  3RPG B;  2KFT A;  3U5N A;  3SOW A;  4QF3 A;  1N87 A;  4YAD A;  2KGG A;  2FUI A;  4R2Y A;  3GL6 A;  4Q6F A;  4A49 A;  3MHS A;  1LDK C;  2VP7 A;  3O36 A;  1IYM A;  3ZVY A;  4UP5 A;  4R8P K;  3ZTG A;  2LRI C;  3LQH A;  3SOX A;  1HYI A;  5B75 A;  2D8S A;  4ZQL A;  1ZBD B;  2CKL A;  2Y1M A;  4W4U A;  3LQI A;  5TAB A;  5DKA A;  4IC2 A;  3IHP A;  5FEY A;  3PUQ A;  4YAX A;  2K1J A;  2L75 A;  4UI9 B;  3EB5 A;  5TDR A;  2CKL B;  2QJ0 A;  2G6Q A;  4I7D A;  2MT5 A;  3C6W A;  2XB1 A;  2JMD A;  2ECN A;  2PNX A;  2YRE A;  2LGV A;  1F62 A;  5D1L B;  5H1U A;  2MNZ A;  1X4I A;  1WEM A;  2LXH C;  1VYX A;  4LK9 A;  2JRJ A;  1WGM A;  4ZUX U;  4B86 C;  4YAB A;  2MD8 C;  2KYU A;  4AUQ B;  2YQL A;  1WEQ A;  1LDJ B;  2KWO A;  4V3L C;  1X4U A;  1WEV A;  2LQ6 A;  2YU4 A;  5TDW A;  5EYA F;  4GB0 A;  2K17 A;  4CCG X;  2K4D A;  3HCS A;  5TBN A;  3N9L A;  4XI1 A;  2QIZ A;  4WZ3 B;  2VPD A;  2K16 A;  2LN0 A;  2YT5 A;  2MNY A;  5B77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...