3V43A

Crystal structure of moz
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
HMEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Combinatorial readout of unmodified H3R2 and acetylated H3K14 by the tandem PHD finger of MOZ reveals a regulatory mechanism for HOXA9 transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/structural protein
molecule keywords Histone acetyltransferase KAT6A
total genus 22
structure length 112
sequence length 112
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3v43A00
2KR4A 2VPEA 1WGMA 3ZYQA 2KWKA 2JMIA 2LV9A 1CHCA 4GNDA 2ECVA 3N9QA 3U5MA 5H9MA 3O36A 4YC9A 4LADB 1WIMA 2C2VS 5TDWA 1VFYA 4AYCB 4P5OB 3NG2A 3LRQA 1WEUA 2L0BA 2KIZA 4AUQB 4GNGA 2RSDA 2VPDA 5FERA 1WEEA 5LCWB 2BAYA 1HYJA 4YATA 3O34A 2LGVA 3HTKC 3ZVZB 4V3KC 1N87A 4O64A 2MA5A 4WZ3B 3ZPV1 5KH9A 5KH7A 5J3XA 2M3HA 4N4FA 2KGIA 1K2FA 2YT5A 2PUYA 3HCSA 2MNZA 2YQLA 3EB5A 4FJCA 2EA6A 2JRJA 2UZGA 2IDAA 4V3LC 2LDRA 3U5NA 2QIZA 2F42A 5D1KB 3RPGB 1U6GB 2M1RA 2XB1A 3QZVA 4LJNA 3FL2A 2NAAA 3V43A 2ECGA 2K16A 3N9PA 4C9ZA 2VJEA 4CCGX 4GNFA 2Y1MA 1X4UA 5AITA 2YHNA 1WEOA 4I7CA 5TRBA 3SOWA 1WEMA 5G0FA 2KE1A 2LQ6A 2F6JA 4R8PK 4B7YC 1X4JA 3M63A 2LGGA 2G6QA 3MHSA 3C6WA 2VJFA 1WILA 2C2LA 1WEVA 3KNVA 3VK6A 2ECTA 3L1XA 2HYED 3ZNIA 4UI9B 2LRIC 3HCTA 5B78A 5TABA 2QJ0A 3O7AA 4QF3A 2KREA 3LQJA 5B75A 4X3GA 2AN6A 4AYCA 2LN0A 4PTBA 5H1VA 1E4UA 2Y43A 3KV5A 2YURA 2PNXA 4L58A 3KV6A 1RMDA 4A4CA 3N9MA 4FK5A 3PURA 4ZUXU 5H1UA 5G04B 1T1HA 5LKUA 1MM2A 2ECWA 1JOCA 2LGKA 2KFTA 4NN2A 2JMJA 3PHDA 2VPGA 4N3WA 1WEQA 2L43A 1WESA 5LKZA 1IYMA 1BORA 5TDRA 2L5UA 1V87A 2YQMA 4LKAA 1XWHA 5G05B 5B77A 3IHPA 4I7BA 2L75A 2CKLA 3C5KA 2G43A 3I2DA 4IC2A 1LDJB 3ZTGA 4AVXA 2KWOA 3LQHA 3EB6A 2Y1NA 1WEWA 2YHOA 4IC3A 1HYIA 5JG6A 5D1MB 4YADA 3L11A 3SOXA 2L80A 4WZ2A 4ZDTA 3GV4A 1WEPA 3PUQA 3U5PA 2FSAA 4S3OC 2MNYA 2K1JA 3O37A 2KWNA 1VD4A 2ECNA 4MSXA 2MUMA 5EYAF 4TKPB 2MD7B 4BHWA 3L1ZB 3U5OA 5FB0A 4A0CD 5B8DA 2EGPA 2YSJA 3ASLA 1Z60A 2E6RA 4XI1A 3O70A 2ECJA 2E6SA 2H0DB 1LDKC 2VJEB 3SHBA 2ECIA 3T7LA 2G45A 1JM7A 5C11A 5D1LB 4AP4A 3N9LA 4PPEA 2FUIA 4UP0A 2YSMA 5C13A 5TBNA 2LGLA 3DQVR 2YREA 2M85A 2K4DA 2MA6A 2MT5A 1JM7B 5B79A 4R2YA 4Q6FA 5H1TA 2VJFB 2VNFA 4YAXA 3M99A 3ZPVE 1FP0A 2KGGA 2QICA 1X4IA 2F6NA 2YU4A 2HDPA 2OXQC 4MVTA 4BBQA 4YBTA 3T6RA 4R7EA 1MM3A 2LXPC 2FUUA 3RTRB 2YW8A 1DVPA 2JMDA 5FB1A 2CSYA 4YABA 4W4UA 5LKXA 1WE9A 3O33A 4A49A 5B76A 4FIPA 1WENA 5KH3A 1G25A 4L7XA 4A4BA 2LXHC 3LQIA 3ZVYA 4CA1A 3N9OA 2CSZA 2KWJA 2DX8A 4S3OB 2KYUA 4YBMA 4UP5A 3HCUA 1F62A 3RPGC 5DKAA 3GL6A 4GB0A 2XEUA 2RI7A 4LK9A 2VP7A 2MD8C 2D8SA 5I3LA 3N9NA 2EODA 2ZETC 4QF2A 4I7DA 3DPLR 5DINA 2I50A 1VYXA 1WFKA 5AIUA 4F52B 2CT2A 2MIQA 4B86C 5FEYA 3O35A 1ZBDB 4LLBA 2M6MA 2CKLB 1FBVA 4ZQLA 4WA6A 2KU3A 3MHHA 4GNEA 3M62A 5LKTA 2K17A 4FO9A 2YYRA 1Z2QA 1Z6UA 3SOUA 2VPBA 4YBSA 3KQIA 2H0DA 4WZ0A 2YUCA
chains in the Genus database with same CATH superfamily
2KR4A 2VPEA 1WGMA 3ZYQA 2KWKA 2JMIA 2XOZA 2LV9A 1CHCA 4GNDA 2ECVA 3N9QA 3U5MA 5K3QA 5H9MA 3O36A 2D8UA 4YC9A 4LADB 1WIMA 4Z0OA 2C2VS 2YVRA 5TDWA 1VFYA 4AYCB 4P5OB 3NG2A 5SVXA 3LRQA 1WEUA 2L0BA 2KIZA 4AUQB 2JUNA 4GNGA 2RSDA 2VPDA 3DDTA 1WEEA 5FERA 5LCWB 2BAYA 1HYJA 4YATA 3O34A 2LGVA 3HTKC 4O62A 3ZVZB 4V3KC 1N87A 4O64A 2MA5A 4WZ3B 3ZPV1 5KH9A 5KH7A 5J3XA 2M3HA 4N4FA 2KGIA 1K2FA 2KKXA 2YT5A 3E2DA 2PUYA 3HCSA 2MNZA 2DSMA 2YQLA 3EB5A 4FJCA 2EA6A 2JRJA 2UZGA 2IDAA 4V3LC 2LDRA 2B0OE 3U5NA 2QIZA 2F42A 5D1KB 3RPGB 1U6GB 2M1RA 2MKEA 2XB1A 3QZVA 4LJNA 3FL2A 2NAAA 3V43A 2ECGA 5SVYA 2K16A 3N9PA 4C9ZA 2VJEA 3FANA 2DJAA 4CCGX 4GNFA 2Y1MA 1X4UA 5AITA 2YHNA 1WEOA 4I7CA 5TRBA 3SOWA 1WEMA 5G0FA 2KE1A 2LQ6A 2F6JA 2CRRA 4R8PK 3LDYA 4QQ4A 4B7YC 1X4JA 3M63A 2LGGA 2G6QA 3MHSA 3C6WA 2VJFA 1WILA 2C2LA 1WEVA 3KNVA 3VK6A 2ECTA 3L1XA 4F1PA 2HYED 4OGCA 3ZNIA 3MDBC 4UI9B 2LRIC 3HCTA 5B78A 5TABA 2QJ0A 2CONA 2RR4A 3O7AA 4QF3A 2KREA 3LQJA 3M7KA 5B75A 4X3GA 2AN6A 4AYCA 2LN0A 4PTBA 5H1VA 1E4UA 2Y43A 3KV5A 2YURA 2PNXA 4L58A 3KV6A 1RMDA 4A4CA 3N9MA 4FK5A 3PURA 4ZUXU 2CRWA 5H1UA 5G04B 1T1HA 5LKUA 1MM2A 2ECWA 1JOCA 2LGKA 2KFTA 3LVRE 5SVIA 4NN2A 2JMJA 3PHDA 2EXUA 5SVIB 2VPGA 4N3WA 1WEQA 2L43A 1WESA 5LKZA 1IYMA 1BORA 5TDRA 2L5UA 1V87A 2YQMA 4LKAA 1XWHA 5G05B 5B77A 3IHPA 4I7BA 2L75A 2CKLA 3C5KA 2G43A 2JM3A 3I2DA 4IC2A 2P57A 1LDJB 3ZTGA 4AVXA 3KDEC 2KWOA 3LQHA 3EB6A 3FM8C 2Y1NA 1WEWA 2YHOA 4OGEA 4IC3A 1HYIA 5JG6A 5D1MB 2FFWA 3SUBA 4YADA 3L11A 3SOXA 2XOCA 2L80A 4WZ2A 4ZDTA 3GV4A 1WEPA 3PUQA 3U5PA 2FSAA 4S3OC 2MNYA 2FD4A 2K1JA 3O37A 2KWNA 3DWDA 1VD4A 2ECNA 4MSXA 2MUMA 5EYAF 4TKPB 2MD7B 3PLWA 4BHWA 3L1ZB 3U5OA 5FB0A 4A0CD 5B8DA 2EGPA 2YSJA 3ASLA 1Z60A 2E6RA 4XI1A 3O70A 2ECJA 2E6SA 2H0DB 3FAOA 4Z0RA 1LDKC 2VJEB 3SHBA 2ECIA 3T7LA 2G45A 1JM7A 5C11A 2OWAA 5D1LB 4AP4A 3N9LA 4PPEA 2FUIA 3LVQE 4UP0A 2YSMA 3JUEA 5C13A 5TBNA 2M13A 2LGLA 3DQVR 2YREA 2M85A 2K4DA 3FEHA 2MA6A 2MT5A 1JM7B 5B79A 4R2YA 4Q6FA 5H1TA 2VJFB 2VNFA 4YAXA 3M99A 3ZPVE 1FP0A 2KGGA 2QICA 1X4IA 2F6NA 2YU4A 2HDPA 2OXQC 4MVTA 4BBQA 4YBTA 3T6RA 4R7EA 1MM3A 2LXPC 2FUUA 3RTRB 2YW8A 1DVPA 2JMDA 1MBMA 2CSYA 2XP0A 5FB1A 4YABA 3Q1DA 4W4UA 5LKXA 1WE9A 3O33A 4A49A 5B76A 4FIPA 3LJUX 1WENA 5KH3A 1G25A 4L7XA 4A4BA 2LXHC 3LQIA 3ZVYA 4CA1A 3N9OA 2CSZA 2XOYA 2KWJA 2DX8A 4S3OB 2KYUA 4YBMA 2L7PA 4UP5A 3HCUA 1F62A 3RPGC 5DKAA 2IQJA 3FJUB 3GL6A 4GB0A 4H9DA 1DCQA 2XEUA 2RI7A 4LK9A 2VP7A 2MD8C 2D8SA 5I3LA 3N9NA 2EODA 2ZETC 4QF2A 4I7DA 3DPLR 2E61A 2I50A 3O47A 5DINA 1VYXA 3T9KA 1WFKA 5AIUA 4F52B 2CT2A 2KKYA 2CSVA 2MIQA 4B86C 5FEYA 3O35A 1ZBDB 4LLBA 2M6MA 2CKLB 1FBVA 4ZQLA 3H7HA 4WA6A 2EGMA 2KU3A 3MHHA 4GNEA 3M62A 5LKTA 2K17A 4FO9A 2YYRA 1Z2QA 1Z6UA 3SOUA 2VPBA 4YBSA 3KQIA 2H0DA 2LAUA 4WZ0A 2YUCA
chains in the Genus database with same CATH topology
2KR4A 2VPEA 1WGMA 3ZYQA 2KWKA 2JMIA 2LV9A 1CHCA 4GNDA 2ECVA 3N9QA 3U5MA 5H9MA 3O36A 4YC9A 4LADB 1WIMA 2C2VS 5TDWA 1VFYA 4AYCB 4P5OB 3NG2A 3LRQA 1WEUA 2L0BA 2KIZA 4AUQB 4GNGA 2RSDA 2VPDA 5FERA 1WEEA 5LCWB 2BAYA 1HYJA 4YATA 3O34A 2LGVA 3HTKC 3ZVZB 4V3KC 1N87A 4O64A 2MA5A 4WZ3B 3ZPV1 5KH9A 5KH7A 5J3XA 2M3HA 4N4FA 2KGIA 1K2FA 2YT5A 2PUYA 3HCSA 2MNZA 2YQLA 3EB5A 4FJCA 2EA6A 2JRJA 2UZGA 2IDAA 4V3LC 2LDRA 3U5NA 2QIZA 2F42A 5D1KB 3RPGB 1U6GB 2M1RA 2XB1A 3QZVA 4LJNA 3FL2A 2NAAA 3V43A 2ECGA 2K16A 3N9PA 4C9ZA 2VJEA 4CCGX 4GNFA 2Y1MA 1X4UA 5AITA 2YHNA 1WEOA 4I7CA 5TRBA 3SOWA 1WEMA 5G0FA 2KE1A 2LQ6A 2F6JA 4R8PK 4B7YC 1X4JA 3M63A 2LGGA 2G6QA 3MHSA 3C6WA 2VJFA 1WILA 2C2LA 1WEVA 3KNVA 3VK6A 2ECTA 3L1XA 2HYED 3ZNIA 4UI9B 2LRIC 3HCTA 5B78A 5TABA 2QJ0A 3O7AA 4QF3A 2KREA 3LQJA 5B75A 4X3GA 2AN6A 4AYCA 2LN0A 4PTBA 5H1VA 1E4UA 2Y43A 3KV5A 2YURA 2PNXA 4L58A 3KV6A 1RMDA 4A4CA 3N9MA 4FK5A 3PURA 4ZUXU 5H1UA 5G04B 1T1HA 5LKUA 1MM2A 2ECWA 1JOCA 2LGKA 2KFTA 4NN2A 2JMJA 3PHDA 2VPGA 4N3WA 1WEQA 2L43A 1WESA 5LKZA 1IYMA 1BORA 5TDRA 2L5UA 1V87A 2YQMA 4LKAA 1XWHA 5G05B 5B77A 3IHPA 4I7BA 2L75A 2CKLA 3C5KA 2G43A 3I2DA 4IC2A 1LDJB 3ZTGA 4AVXA 2KWOA 3LQHA 3EB6A 2Y1NA 1WEWA 2YHOA 4IC3A 1HYIA 5JG6A 5D1MB 4YADA 3L11A 3SOXA 2L80A 4WZ2A 4ZDTA 3GV4A 1WEPA 3PUQA 3U5PA 2FSAA 4S3OC 2MNYA 2K1JA 3O37A 2KWNA 1VD4A 2ECNA 4MSXA 2MUMA 5EYAF 4TKPB 2MD7B 4BHWA 3L1ZB 3U5OA 5FB0A 4A0CD 5B8DA 2EGPA 2YSJA 3ASLA 1Z60A 2E6RA 4XI1A 3O70A 2ECJA 2E6SA 2H0DB 1LDKC 2VJEB 3SHBA 2ECIA 3T7LA 2G45A 1JM7A 5C11A 5D1LB 4AP4A 3N9LA 4PPEA 2FUIA 4UP0A 2YSMA 5C13A 5TBNA 2LGLA 3DQVR 2YREA 2M85A 2K4DA 2MA6A 2MT5A 1JM7B 5B79A 4R2YA 4Q6FA 5H1TA 2VJFB 2VNFA 4YAXA 3M99A 3ZPVE 1FP0A 2KGGA 2QICA 1X4IA 2F6NA 2YU4A 2HDPA 2OXQC 4MVTA 4BBQA 4YBTA 3T6RA 4R7EA 1MM3A 2LXPC 2FUUA 3RTRB 2YW8A 1DVPA 2JMDA 5FB1A 2CSYA 4YABA 4W4UA 5LKXA 1WE9A 3O33A 4A49A 5B76A 4FIPA 1WENA 5KH3A 1G25A 4L7XA 4A4BA 2LXHC 3LQIA 3ZVYA 4CA1A 3N9OA 2CSZA 2KWJA 2DX8A 4S3OB 2KYUA 4YBMA 4UP5A 3HCUA 1F62A 3RPGC 5DKAA 3GL6A 4GB0A 2XEUA 2RI7A 4LK9A 2VP7A 2MD8C 2D8SA 5I3LA 3N9NA 2EODA 2ZETC 4QF2A 4I7DA 3DPLR 5DINA 2I50A 1VYXA 1WFKA 5AIUA 4F52B 2CT2A 2MIQA 4B86C 5FEYA 3O35A 1ZBDB 4LLBA 2M6MA 2CKLB 1FBVA 4ZQLA 4WA6A 2KU3A 3MHHA 4GNEA 3M62A 5LKTA 2K17A 4FO9A 2YYRA 1Z2QA 1Z6UA 3SOUA 2VPBA 4YBSA 3KQIA 2H0DA 4WZ0A 2YUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR4 A;  2VPE A;  1WGM A;  3ZYQ A;  2KWK A;  2JMI A;  2LV9 A;  1CHC A;  4GND A;  2ECV A;  3N9Q A;  3U5M A;  5H9M A;  3O36 A;  4YC9 A;  4LAD B;  1WIM A;  2C2V S;  5TDW A;  1VFY A;  4AYC B;  4P5O B;  3NG2 A;  3LRQ A;  1WEU A;  2L0B A;  2KIZ A;  4AUQ B;  4GNG A;  2RSD A;  2VPD A;  5FER A;  1WEE A;  5LCW B;  2BAY A;  1HYJ A;  4YAT A;  3O34 A;  2LGV A;  3HTK C;  3ZVZ B;  4V3K C;  1N87 A;  4O64 A;  2MA5 A;  4WZ3 B;  3ZPV 1;  5KH9 A;  5KH7 A;  5J3X A;  2M3H A;  4N4F A;  2KGI A;  1K2F A;  2YT5 A;  2PUY A;  3HCS A;  2MNZ A;  2YQL A;  3EB5 A;  4FJC A;  2EA6 A;  2JRJ A;  2UZG A;  2IDA A;  4V3L C;  2LDR A;  3U5N A;  2QIZ A;  2F42 A;  5D1K B;  3RPG B;  1U6G B;  2M1R A;  2XB1 A;  3QZV A;  4LJN A;  3FL2 A;  2NAA A;  3V43 A;  2ECG A;  2K16 A;  3N9P A;  4C9Z A;  2VJE A;  4CCG X;  4GNF A;  2Y1M A;  1X4U A;  5AIT A;  2YHN A;  1WEO A;  4I7C A;  5TRB A;  3SOW A;  1WEM A;  5G0F A;  2KE1 A;  2LQ6 A;  2F6J A;  4R8P K;  4B7Y C;  1X4J A;  3M63 A;  2LGG A;  2G6Q A;  3MHS A;  3C6W A;  2VJF A;  1WIL A;  2C2L A;  1WEV A;  3KNV A;  3VK6 A;  2ECT A;  3L1X A;  2HYE D;  3ZNI A;  4UI9 B;  2LRI C;  3HCT A;  5B78 A;  5TAB A;  2QJ0 A;  3O7A A;  4QF3 A;  2KRE A;  3LQJ A;  5B75 A;  4X3G A;  2AN6 A;  4AYC A;  2LN0 A;  4PTB A;  5H1V A;  1E4U A;  2Y43 A;  3KV5 A;  2YUR A;  2PNX A;  4L58 A;  3KV6 A;  1RMD A;  4A4C A;  3N9M A;  4FK5 A;  3PUR A;  4ZUX U;  5H1U A;  5G04 B;  1T1H A;  5LKU A;  1MM2 A;  2ECW A;  1JOC A;  2LGK A;  2KFT A;  4NN2 A;  2JMJ A;  3PHD A;  2VPG A;  4N3W A;  1WEQ A;  2L43 A;  1WES A;  5LKZ A;  1IYM A;  1BOR A;  5TDR A;  2L5U A;  1V87 A;  2YQM A;  4LKA A;  1XWH A;  5G05 B;  5B77 A;  3IHP A;  4I7B A;  2L75 A;  2CKL A;  3C5K A;  2G43 A;  3I2D A;  4IC2 A;  1LDJ B;  3ZTG A;  4AVX A;  2KWO A;  3LQH A;  3EB6 A;  2Y1N A;  1WEW A;  2YHO A;  4IC3 A;  1HYI A;  5JG6 A;  5D1M B;  4YAD A;  3L11 A;  3SOX A;  2L80 A;  4WZ2 A;  4ZDT A;  3GV4 A;  1WEP A;  3PUQ A;  3U5P A;  2FSA A;  4S3O C;  2MNY A;  2K1J A;  3O37 A;  2KWN A;  1VD4 A;  2ECN A;  4MSX A;  2MUM A;  5EYA F;  4TKP B;  2MD7 B;  4BHW A;  3L1Z B;  3U5O A;  5FB0 A;  4A0C D;  5B8D A;  2EGP A;  2YSJ A;  3ASL A;  1Z60 A;  2E6R A;  4XI1 A;  3O70 A;  2ECJ A;  2E6S A;  2H0D B;  1LDK C;  2VJE B;  3SHB A;  2ECI A;  3T7L A;  2G45 A;  1JM7 A;  5C11 A;  5D1L B;  4AP4 A;  3N9L A;  4PPE A;  2FUI A;  4UP0 A;  2YSM A;  5C13 A;  5TBN A;  2LGL A;  3DQV R;  2YRE A;  2M85 A;  2K4D A;  2MA6 A;  2MT5 A;  1JM7 B;  5B79 A;  4R2Y A;  4Q6F A;  5H1T A;  2VJF B;  2VNF A;  4YAX A;  3M99 A;  3ZPV E;  1FP0 A;  2KGG A;  2QIC A;  1X4I A;  2F6N A;  2YU4 A;  2HDP A;  2OXQ C;  4MVT A;  4BBQ A;  4YBT A;  3T6R A;  4R7E A;  1MM3 A;  2LXP C;  2FUU A;  3RTR B;  2YW8 A;  1DVP A;  2JMD A;  5FB1 A;  2CSY A;  4YAB A;  4W4U A;  5LKX A;  1WE9 A;  3O33 A;  4A49 A;  5B76 A;  4FIP A;  1WEN A;  5KH3 A;  1G25 A;  4L7X A;  4A4B A;  2LXH C;  3LQI A;  3ZVY A;  4CA1 A;  3N9O A;  2CSZ A;  2KWJ A;  2DX8 A;  4S3O B;  2KYU A;  4YBM A;  4UP5 A;  3HCU A;  1F62 A;  3RPG C;  5DKA A;  3GL6 A;  4GB0 A;  2XEU A;  2RI7 A;  4LK9 A;  2VP7 A;  2MD8 C;  2D8S A;  5I3L A;  3N9N A;  2EOD A;  2ZET C;  4QF2 A;  4I7D A;  3DPL R;  5DIN A;  2I50 A;  1VYX A;  1WFK A;  5AIU A;  4F52 B;  2CT2 A;  2MIQ A;  4B86 C;  5FEY A;  3O35 A;  1ZBD B;  4LLB A;  2M6M A;  2CKL B;  1FBV A;  4ZQL A;  4WA6 A;  2KU3 A;  3MHH A;  4GNE A;  3M62 A;  5LKT A;  2K17 A;  4FO9 A;  2YYR A;  1Z2Q A;  1Z6U A;  3SOU A;  2VPB A;  4YBS A;  3KQI A;  2H0D A;  4WZ0 A;  2YUC A; 
#chains in the Genus database with same CATH topology
 2KR4 A;  2VPE A;  1WGM A;  3ZYQ A;  2KWK A;  2JMI A;  2XOZ A;  2LV9 A;  1CHC A;  4GND A;  2ECV A;  3N9Q A;  3U5M A;  5K3Q A;  5H9M A;  3O36 A;  2D8U A;  4YC9 A;  4LAD B;  1WIM A;  4Z0O A;  2C2V S;  2YVR A;  5TDW A;  1VFY A;  4AYC B;  4P5O B;  3NG2 A;  5SVX A;  3LRQ A;  1WEU A;  2L0B A;  2KIZ A;  4AUQ B;  2JUN A;  4GNG A;  2RSD A;  2VPD A;  3DDT A;  1WEE A;  5FER A;  5LCW B;  2BAY A;  1HYJ A;  4YAT A;  3O34 A;  2LGV A;  3HTK C;  4O62 A;  3ZVZ B;  4V3K C;  1N87 A;  4O64 A;  2MA5 A;  4WZ3 B;  3ZPV 1;  5KH9 A;  5KH7 A;  5J3X A;  2M3H A;  4N4F A;  2KGI A;  1K2F A;  2KKX A;  2YT5 A;  3E2D A;  2PUY A;  3HCS A;  2MNZ A;  2DSM A;  2YQL A;  3EB5 A;  4FJC A;  2EA6 A;  2JRJ A;  2UZG A;  2IDA A;  4V3L C;  2LDR A;  2B0O E;  3U5N A;  2QIZ A;  2F42 A;  5D1K B;  3RPG B;  1U6G B;  2M1R A;  2MKE A;  2XB1 A;  3QZV A;  4LJN A;  3FL2 A;  2NAA A;  3V43 A;  2ECG A;  5SVY A;  2K16 A;  3N9P A;  4C9Z A;  2VJE A;  3FAN A;  2DJA A;  4CCG X;  4GNF A;  2Y1M A;  1X4U A;  5AIT A;  2YHN A;  1WEO A;  4I7C A;  5TRB A;  3SOW A;  1WEM A;  5G0F A;  2KE1 A;  2LQ6 A;  2F6J A;  2CRR A;  4R8P K;  3LDY A;  4QQ4 A;  4B7Y C;  1X4J A;  3M63 A;  2LGG A;  2G6Q A;  3MHS A;  3C6W A;  2VJF A;  1WIL A;  2C2L A;  1WEV A;  3KNV A;  3VK6 A;  2ECT A;  3L1X A;  4F1P A;  2HYE D;  4OGC A;  3ZNI A;  3MDB C;  4UI9 B;  2LRI C;  3HCT A;  5B78 A;  5TAB A;  2QJ0 A;  2CON A;  2RR4 A;  3O7A A;  4QF3 A;  2KRE A;  3LQJ A;  3M7K A;  5B75 A;  4X3G A;  2AN6 A;  4AYC A;  2LN0 A;  4PTB A;  5H1V A;  1E4U A;  2Y43 A;  3KV5 A;  2YUR A;  2PNX A;  4L58 A;  3KV6 A;  1RMD A;  4A4C A;  3N9M A;  4FK5 A;  3PUR A;  4ZUX U;  2CRW A;  5H1U A;  5G04 B;  1T1H A;  5LKU A;  1MM2 A;  2ECW A;  1JOC A;  2LGK A;  2KFT A;  3LVR E;  5SVI A;  4NN2 A;  2JMJ A;  3PHD A;  2EXU A;  5SVI B;  2VPG A;  4N3W A;  1WEQ A;  2L43 A;  1WES A;  5LKZ A;  1IYM A;  1BOR A;  5TDR A;  2L5U A;  1V87 A;  2YQM A;  4LKA A;  1XWH A;  5G05 B;  5B77 A;  3IHP A;  4I7B A;  2L75 A;  2CKL A;  3C5K A;  2G43 A;  2JM3 A;  3I2D A;  4IC2 A;  2P57 A;  1LDJ B;  3ZTG A;  4AVX A;  3KDE C;  2KWO A;  3LQH A;  3EB6 A;  3FM8 C;  2Y1N A;  1WEW A;  2YHO A;  4OGE A;  4IC3 A;  1HYI A;  5JG6 A;  5D1M B;  2FFW A;  3SUB A;  4YAD A;  3L11 A;  3SOX A;  2XOC A;  2L80 A;  4WZ2 A;  4ZDT A;  3GV4 A;  1WEP A;  3PUQ A;  3U5P A;  2FSA A;  4S3O C;  2MNY A;  2FD4 A;  2K1J A;  3O37 A;  2KWN A;  3DWD A;  1VD4 A;  2ECN A;  4MSX A;  2MUM A;  5EYA F;  4TKP B;  2MD7 B;  3PLW A;  4BHW A;  3L1Z B;  3U5O A;  5FB0 A;  4A0C D;  5B8D A;  2EGP A;  2YSJ A;  3ASL A;  1Z60 A;  2E6R A;  4XI1 A;  3O70 A;  2ECJ A;  2E6S A;  2H0D B;  3FAO A;  4Z0R A;  1LDK C;  2VJE B;  3SHB A;  2ECI A;  3T7L A;  2G45 A;  1JM7 A;  5C11 A;  2OWA A;  5D1L B;  4AP4 A;  3N9L A;  4PPE A;  2FUI A;  3LVQ E;  4UP0 A;  2YSM A;  3JUE A;  5C13 A;  5TBN A;  2M13 A;  2LGL A;  3DQV R;  2YRE A;  2M85 A;  2K4D A;  3FEH A;  2MA6 A;  2MT5 A;  1JM7 B;  5B79 A;  4R2Y A;  4Q6F A;  5H1T A;  2VJF B;  2VNF A;  4YAX A;  3M99 A;  3ZPV E;  1FP0 A;  2KGG A;  2QIC A;  1X4I A;  2F6N A;  2YU4 A;  2HDP A;  2OXQ C;  4MVT A;  4BBQ A;  4YBT A;  3T6R A;  4R7E A;  1MM3 A;  2LXP C;  2FUU A;  3RTR B;  2YW8 A;  1DVP A;  2JMD A;  1MBM A;  2CSY A;  2XP0 A;  5FB1 A;  4YAB A;  3Q1D A;  4W4U A;  5LKX A;  1WE9 A;  3O33 A;  4A49 A;  5B76 A;  4FIP A;  3LJU X;  1WEN A;  5KH3 A;  1G25 A;  4L7X A;  4A4B A;  2LXH C;  3LQI A;  3ZVY A;  4CA1 A;  3N9O A;  2CSZ A;  2XOY A;  2KWJ A;  2DX8 A;  4S3O B;  2KYU A;  4YBM A;  2L7P A;  4UP5 A;  3HCU A;  1F62 A;  3RPG C;  5DKA A;  2IQJ A;  3FJU B;  3GL6 A;  4GB0 A;  4H9D A;  1DCQ A;  2XEU A;  2RI7 A;  4LK9 A;  2VP7 A;  2MD8 C;  2D8S A;  5I3L A;  3N9N A;  2EOD A;  2ZET C;  4QF2 A;  4I7D A;  3DPL R;  2E61 A;  2I50 A;  3O47 A;  5DIN A;  1VYX A;  3T9K A;  1WFK A;  5AIU A;  4F52 B;  2CT2 A;  2KKY A;  2CSV A;  2MIQ A;  4B86 C;  5FEY A;  3O35 A;  1ZBD B;  4LLB A;  2M6M A;  2CKL B;  1FBV A;  4ZQL A;  3H7H A;  4WA6 A;  2EGM A;  2KU3 A;  3MHH A;  4GNE A;  3M62 A;  5LKT A;  2K17 A;  4FO9 A;  2YYR A;  1Z2Q A;  1Z6U A;  3SOU A;  2VPB A;  4YBS A;  3KQI A;  2H0D A;  2LAU A;  4WZ0 A;  2YUC A; 
#chains in the Genus database with same CATH homology
 2KR4 A;  2VPE A;  1WGM A;  3ZYQ A;  2KWK A;  2JMI A;  2LV9 A;  1CHC A;  4GND A;  2ECV A;  3N9Q A;  3U5M A;  5H9M A;  3O36 A;  4YC9 A;  4LAD B;  1WIM A;  2C2V S;  5TDW A;  1VFY A;  4AYC B;  4P5O B;  3NG2 A;  3LRQ A;  1WEU A;  2L0B A;  2KIZ A;  4AUQ B;  4GNG A;  2RSD A;  2VPD A;  5FER A;  1WEE A;  5LCW B;  2BAY A;  1HYJ A;  4YAT A;  3O34 A;  2LGV A;  3HTK C;  3ZVZ B;  4V3K C;  1N87 A;  4O64 A;  2MA5 A;  4WZ3 B;  3ZPV 1;  5KH9 A;  5KH7 A;  5J3X A;  2M3H A;  4N4F A;  2KGI A;  1K2F A;  2YT5 A;  2PUY A;  3HCS A;  2MNZ A;  2YQL A;  3EB5 A;  4FJC A;  2EA6 A;  2JRJ A;  2UZG A;  2IDA A;  4V3L C;  2LDR A;  3U5N A;  2QIZ A;  2F42 A;  5D1K B;  3RPG B;  1U6G B;  2M1R A;  2XB1 A;  3QZV A;  4LJN A;  3FL2 A;  2NAA A;  3V43 A;  2ECG A;  2K16 A;  3N9P A;  4C9Z A;  2VJE A;  4CCG X;  4GNF A;  2Y1M A;  1X4U A;  5AIT A;  2YHN A;  1WEO A;  4I7C A;  5TRB A;  3SOW A;  1WEM A;  5G0F A;  2KE1 A;  2LQ6 A;  2F6J A;  4R8P K;  4B7Y C;  1X4J A;  3M63 A;  2LGG A;  2G6Q A;  3MHS A;  3C6W A;  2VJF A;  1WIL A;  2C2L A;  1WEV A;  3KNV A;  3VK6 A;  2ECT A;  3L1X A;  2HYE D;  3ZNI A;  4UI9 B;  2LRI C;  3HCT A;  5B78 A;  5TAB A;  2QJ0 A;  3O7A A;  4QF3 A;  2KRE A;  3LQJ A;  5B75 A;  4X3G A;  2AN6 A;  4AYC A;  2LN0 A;  4PTB A;  5H1V A;  1E4U A;  2Y43 A;  3KV5 A;  2YUR A;  2PNX A;  4L58 A;  3KV6 A;  1RMD A;  4A4C A;  3N9M A;  4FK5 A;  3PUR A;  4ZUX U;  5H1U A;  5G04 B;  1T1H A;  5LKU A;  1MM2 A;  2ECW A;  1JOC A;  2LGK A;  2KFT A;  4NN2 A;  2JMJ A;  3PHD A;  2VPG A;  4N3W A;  1WEQ A;  2L43 A;  1WES A;  5LKZ A;  1IYM A;  1BOR A;  5TDR A;  2L5U A;  1V87 A;  2YQM A;  4LKA A;  1XWH A;  5G05 B;  5B77 A;  3IHP A;  4I7B A;  2L75 A;  2CKL A;  3C5K A;  2G43 A;  3I2D A;  4IC2 A;  1LDJ B;  3ZTG A;  4AVX A;  2KWO A;  3LQH A;  3EB6 A;  2Y1N A;  1WEW A;  2YHO A;  4IC3 A;  1HYI A;  5JG6 A;  5D1M B;  4YAD A;  3L11 A;  3SOX A;  2L80 A;  4WZ2 A;  4ZDT A;  3GV4 A;  1WEP A;  3PUQ A;  3U5P A;  2FSA A;  4S3O C;  2MNY A;  2K1J A;  3O37 A;  2KWN A;  1VD4 A;  2ECN A;  4MSX A;  2MUM A;  5EYA F;  4TKP B;  2MD7 B;  4BHW A;  3L1Z B;  3U5O A;  5FB0 A;  4A0C D;  5B8D A;  2EGP A;  2YSJ A;  3ASL A;  1Z60 A;  2E6R A;  4XI1 A;  3O70 A;  2ECJ A;  2E6S A;  2H0D B;  1LDK C;  2VJE B;  3SHB A;  2ECI A;  3T7L A;  2G45 A;  1JM7 A;  5C11 A;  5D1L B;  4AP4 A;  3N9L A;  4PPE A;  2FUI A;  4UP0 A;  2YSM A;  5C13 A;  5TBN A;  2LGL A;  3DQV R;  2YRE A;  2M85 A;  2K4D A;  2MA6 A;  2MT5 A;  1JM7 B;  5B79 A;  4R2Y A;  4Q6F A;  5H1T A;  2VJF B;  2VNF A;  4YAX A;  3M99 A;  3ZPV E;  1FP0 A;  2KGG A;  2QIC A;  1X4I A;  2F6N A;  2YU4 A;  2HDP A;  2OXQ C;  4MVT A;  4BBQ A;  4YBT A;  3T6R A;  4R7E A;  1MM3 A;  2LXP C;  2FUU A;  3RTR B;  2YW8 A;  1DVP A;  2JMD A;  5FB1 A;  2CSY A;  4YAB A;  4W4U A;  5LKX A;  1WE9 A;  3O33 A;  4A49 A;  5B76 A;  4FIP A;  1WEN A;  5KH3 A;  1G25 A;  4L7X A;  4A4B A;  2LXH C;  3LQI A;  3ZVY A;  4CA1 A;  3N9O A;  2CSZ A;  2KWJ A;  2DX8 A;  4S3O B;  2KYU A;  4YBM A;  4UP5 A;  3HCU A;  1F62 A;  3RPG C;  5DKA A;  3GL6 A;  4GB0 A;  2XEU A;  2RI7 A;  4LK9 A;  2VP7 A;  2MD8 C;  2D8S A;  5I3L A;  3N9N A;  2EOD A;  2ZET C;  4QF2 A;  4I7D A;  3DPL R;  5DIN A;  2I50 A;  1VYX A;  1WFK A;  5AIU A;  4F52 B;  2CT2 A;  2MIQ A;  4B86 C;  5FEY A;  3O35 A;  1ZBD B;  4LLB A;  2M6M A;  2CKL B;  1FBV A;  4ZQL A;  4WA6 A;  2KU3 A;  3MHH A;  4GNE A;  3M62 A;  5LKT A;  2K17 A;  4FO9 A;  2YYR A;  1Z2Q A;  1Z6U A;  3SOU A;  2VPB A;  4YBS A;  3KQI A;  2H0D A;  4WZ0 A;  2YUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...