3V43A

Crystal structure of moz
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
HMEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Combinatorial readout of unmodified H3R2 and acetylated H3K14 by the tandem PHD finger of MOZ reveals a regulatory mechanism for HOXA9 transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/structural protein
molecule keywords Histone acetyltransferase KAT6A
total genus 22
structure length 112
sequence length 112
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3v43A00
4ZQLA 2VNFA 2YT5A 5AITA 4A4CA 3T7LA 4C9ZA 3L1XA 3ZNIA 5FEYA 5D1MB 2KREA 4A4BA 1MM2A 4F52B 2NAAA 2MA6A 4GNFA 5D1KB 4AUQB 4MSXA 3U5PA 2YSMA 5TRBA 2H0DA 3L11A 4O64A 2Y1NA 2LQ6A 1X4IA 4YAXA 4N3WA 3N9NA 2ZETC 3HCUA 3EB5A 3O35A 2QIZA 4TKPB 3RPGC 4PTBA 1WIMA 1X4JA 3EB6A 2FUIA 3O70A 1CHCA 4FJCA 4LADB 1WEOA 5DINA 5B76A 2LGVA 4N4FA 2KWOA 2XB1A 2FSAA 4A0CD 2LXHC 5AIUA 2JMDA 1WEUA 3ASLA 3C6WA 3O34A 2MIQA 2KU3A 4LJNA 4A49A 1WEQA 2CSYA 2G6QA 4R7EA 5G04B 2KWJA 4WZ0A 4IC2A 2YQMA 5G0FA 3N9MA 3SOXA 1JM7A 2LDRA 1VYXA 2L5UA 3SOUA 2Y43A 2DX8A 2E6SA 3ZPVE 4IC3A 3N9OA 3KNVA 5H9MA 2K1JA 2ECTA 4BBQA 2VPGA 3GV4A 2M6MA 2L43A 1WENA 4AYCB 2L80A 2VJEB 3U5OA 5LKXA 5DKAA 2ECNA 4GNEA 1T1HA 4FO9A 1WEPA 5KH9A 2K4DA 5C13A 3SOWA 2KGIA 3LRQA 1Z6UA 2VJFB 3PUQA 2XEUA 3RPGB 3KQIA 2YQLA 4AVXA 1WFKA 4AYCA 4LLBA 2YU4A 5FB1A 2ECGA 2F6NA 1WILA 2PNXA 4AP4A 3HCTA 5FERA 5EYAF 4XI1A 1WEEA 1LDKC 5JG6A 5TDWA 1XWHA 4GB0A 3M63A 4B86C 2ECJA 4W4UA 2MD8C 4V3KC 2BAYA 4QF3A 4BHWA 2FUUA 2M85A 2K17A 3LQIA 2VPBA 3O36A 4X3GA 4LKAA 4NN2A 4UP5A 2UZGA 2E6RA 4CCGX 4UI9B 2EA6A 2VP7A 2RI7A 3L1ZB 4L7XA 5LCWB 2ECIA 5B75A 4CA1A 4V3LC 4MVTA 4YABA 1WEVA 4I7DA 2LGGA 5KH3A 2F6JA 2KYUA 3FL2A 3NG2A 4WZ2A 3VK6A 1G25A 1WEMA 2YHNA 2L0BA 2LV9A 5G05B 2VPDA 4GNGA 2D8SA 4FK5A 1VFYA 2YHOA 2F42A 3KV6A 1N87A 3DQVR 1WESA 2LRIC 5TDRA 1Z2QA 2HDPA 3LQHA 4I7BA 5B8DA 2MNYA 1IYMA 3KV5A 1WEWA 1U6GB 1JOCA 4R8PK 3MHSA 3O37A 1HYJA 1JM7B 1MM3A 1X4UA 2H0DB 3HTKC 3M99A 2CSZA 5I3LA 4YBTA 5J3XA 4GNDA 2JRJA 1V87A 2CKLA 2K16A 2MA5A 5H1UA 5TABA 4L58A 2ECVA 3SHBA 1RMDA 2VJEA 4P5OB 3PURA 2LXPC 5LKTA 5H1VA 2YSJA 2KGGA 2MUMA 2ECWA 2G45A 3GL6A 1E4UA 2JMIA 5C11A 4R2YA 3ZTGA 4QF2A 2KFTA 3O7AA 2RSDA 3U5NA 3M62A 3N9LA 5B78A 1DVPA 2HYED 4ZUXU 2CT2A 4S3OB 3N9PA 2KIZA 1FP0A 4YBMA 3RTRB 3T6RA 2IDAA 2Y1MA 2YUCA 2PUYA 2LGLA 2JMJA 4PPEA 4ZDTA 2M3HA 3DPLR 2LGKA 2MNZA 5FB0A 2EGPA 2KWNA 1ZBDB 2CKLB 2QICA 2VJFA 3U5MA 4YATA 3N9QA 3LQJA 3ZYQA 5TBNA 3I2DA 1VD4A 2YREA 3HCSA 4FIPA 4S3OC 4UP0A 4Q6FA 2YW8A 3MHHA 4YBSA 1WE9A 2YURA 3ZPV1 2LN0A 2I50A 3ZVZB 3ZVYA 2L75A 3PHDA 5KH7A 2KR4A 3IHPA 4LK9A 3C5KA 5B79A 1LDJB 3V43A 2MT5A 2YYRA 2AN6A 2MD7B 4B7YC 2EODA 1HYIA 1BORA 3O33A 4YC9A 5B77A 2C2VS 5LKZA 2VPEA 1Z60A 4I7CA 5D1LB 2G43A 1WGMA 2OXQC 5LKUA 1FBVA 5H1TA 4WA6A 2KE1A 1K2FA 4WZ3B 2M1RA 4YADA 3QZVA 1F62A 2KWKA 2QJ0A 2C2LA
chains in the Genus database with same CATH superfamily
4ZQLA 2VNFA 2YT5A 5AITA 4A4CA 3T7LA 4C9ZA 3L1XA 3ZNIA 5FEYA 5D1MB 2KREA 4A4BA 1MM2A 2CSVA 4F52B 2NAAA 2MA6A 3FAOA 4GNFA 5D1KB 3MDBC 4AUQB 4MSXA 3U5PA 2YSMA 5TRBA 2H0DA 3L11A 3LVRE 4O64A 2Y1NA 4OGCA 2LQ6A 3E2DA 3LVQE 1X4IA 4YAXA 4N3WA 3N9NA 2ZETC 3HCUA 3EB5A 2FD4A 2QIZA 3O35A 4QQ4A 4TKPB 2IQJA 3RPGC 4PTBA 1WIMA 1X4JA 3EB6A 2FUIA 3O70A 1CHCA 4FJCA 4LADB 1WEOA 5DINA 3DWDA 5B76A 2LGVA 4N4FA 3FEHA 2KWOA 2XB1A 2FSAA 4A0CD 4Z0OA 2LXHC 5AIUA 2JMDA 3Q1DA 1WEUA 3ASLA 3C6WA 3O34A 2KKXA 2KU3A 2MIQA 4LJNA 4A49A 1WEQA 2CSYA 2G6QA 4R7EA 5G04B 2KWJA 4WZ0A 4IC2A 2JM3A 2YQMA 5G0FA 3N9MA 3SOXA 1JM7A 2LDRA 1VYXA 2L5UA 3SOUA 2Y43A 2DX8A 2E6SA 3ZPVE 4IC3A 3N9OA 3KNVA 5H9MA 2K1JA 2ECTA 4BBQA 2VPGA 3GV4A 2M6MA 2L43A 2L7PA 1WENA 4AYCB 2L80A 2VJEB 3U5OA 5LKXA 5DKAA 2ECNA 4GNEA 1T1HA 4FO9A 1WEPA 5KH9A 2K4DA 5C13A 3SOWA 2KGIA 3LRQA 1Z6UA 2VJFB 3PUQA 2XEUA 3RPGB 3KQIA 2YQLA 4AVXA 1WFKA 4AYCA 4LLBA 2YU4A 5FB1A 2ECGA 3JUEA 2F6NA 1WILA 2PNXA 2FFWA 3DDTA 4AP4A 3HCTA 5FERA 2EGMA 5EYAF 4XI1A 1WEEA 1LDKC 5JG6A 3KDEC 5SVXA 5TDWA 1XWHA 5SVIB 2LAUA 2XP0A 4GB0A 2OWAA 2CONA 3M63A 5SVYA 2CRRA 4B86C 2ECJA 4W4UA 2MD8C 4V3KC 2BAYA 4QF3A 3PLWA 4BHWA 2FUUA 2M85A 2K17A 3LQIA 2VPBA 3O36A 4X3GA 4LKAA 2XOCA 4NN2A 4UP5A 2UZGA 1MBMA 2E6RA 3FANA 4CCGX 4UI9B 2EA6A 2VP7A 2M13A 2RI7A 3L1ZB 3M7KA 4L7XA 5LCWB 2P57A 2ECIA 5B75A 4CA1A 4V3LC 4MVTA 4YABA 1WEVA 4I7DA 2LGGA 5KH3A 2F6JA 2KYUA 3FL2A 2DSMA 3NG2A 4WZ2A 3VK6A 1G25A 1WEMA 4OGEA 4F1PA 2YHNA 2L0BA 2LV9A 5G05B 2VPDA 3FM8C 2YVRA 5SVIA 4GNGA 2D8SA 4FK5A 1VFYA 2YHOA 2F42A 3KV6A 1N87A 3DQVR 1WESA 2XOYA 2LRIC 5TDRA 1Z2QA 2KKYA 2HDPA 3T9KA 3LQHA 4I7BA 5B8DA 2MNYA 1IYMA 3KV5A 1WEWA 1U6GB 1JOCA 4R8PK 3MHSA 2EXUA 3O37A 1HYJA 1JM7B 1MM3A 1X4UA 2H0DB 3HTKC 3M99A 2CSZA 5I3LA 4YBTA 5J3XA 4GNDA 2JRJA 1V87A 2CKLA 2JUNA 2K16A 2MA5A 5K3QA 5H1UA 5TABA 4L58A 2ECVA 3SHBA 1RMDA 2VJEA 4P5OB 3PURA 2XOZA 2LXPC 5LKTA 2MKEA 5H1VA 2YSJA 4H9DA 2KGGA 2MUMA 2ECWA 2G45A 3GL6A 1E4UA 2JMIA 5C11A 4R2YA 3LJUX 3ZTGA 2RR4A 4QF2A 2KFTA 3O7AA 2RSDA 3U5NA 3M62A 3N9LA 5B78A 1DVPA 2HYED 3FJUB 4ZUXU 2CT2A 4S3OB 3N9PA 2KIZA 1DCQA 1FP0A 4YBMA 3RTRB 3T6RA 2IDAA 2Y1MA 2D8UA 2YUCA 2PUYA 2LGLA 2JMJA 2E61A 3SUBA 4PPEA 4ZDTA 2M3HA 3DPLR 2LGKA 2MNZA 5FB0A 2EGPA 2KWNA 4Z0RA 1ZBDB 2CKLB 2QICA 2VJFA 3U5MA 4YATA 3N9QA 3LQJA 3ZYQA 2CRWA 5TBNA 3I2DA 1VD4A 2YREA 3HCSA 4FIPA 4S3OC 4UP0A 4Q6FA 2YW8A 3MHHA 4YBSA 1WE9A 2YURA 3ZPV1 2LN0A 2I50A 3ZVZB 3ZVYA 2L75A 3PHDA 3LDYA 2DJAA 5KH7A 2KR4A 3IHPA 4LK9A 3C5KA 5B79A 1LDJB 3V43A 2MT5A 2YYRA 2AN6A 2MD7B 4B7YC 2EODA 3O47A 1HYIA 1BORA 3O33A 4YC9A 5B77A 2C2VS 5LKZA 2VPEA 1Z60A 3H7HA 4I7CA 5D1LB 2G43A 1WGMA 2OXQC 5LKUA 1FBVA 5H1TA 4WA6A 2KE1A 1K2FA 4WZ3B 2M1RA 4YADA 4O62A 3QZVA 2B0OE 1F62A 2KWKA 2QJ0A 2C2LA
chains in the Genus database with same CATH topology
4ZQLA 2VNFA 2YT5A 5AITA 4A4CA 3T7LA 4C9ZA 3L1XA 3ZNIA 5FEYA 5D1MB 2KREA 4A4BA 1MM2A 4F52B 2NAAA 2MA6A 4GNFA 5D1KB 4AUQB 4MSXA 3U5PA 2YSMA 5TRBA 2H0DA 3L11A 4O64A 2Y1NA 2LQ6A 1X4IA 4YAXA 4N3WA 3N9NA 2ZETC 3HCUA 3EB5A 3O35A 2QIZA 4TKPB 3RPGC 4PTBA 1WIMA 1X4JA 3EB6A 2FUIA 3O70A 1CHCA 4FJCA 4LADB 1WEOA 5DINA 5B76A 2LGVA 4N4FA 2KWOA 2XB1A 2FSAA 4A0CD 2LXHC 5AIUA 2JMDA 1WEUA 3ASLA 3C6WA 3O34A 2MIQA 2KU3A 4LJNA 4A49A 1WEQA 2CSYA 2G6QA 4R7EA 5G04B 2KWJA 4WZ0A 4IC2A 2YQMA 5G0FA 3N9MA 3SOXA 1JM7A 2LDRA 1VYXA 2L5UA 3SOUA 2Y43A 2DX8A 2E6SA 3ZPVE 4IC3A 3N9OA 3KNVA 5H9MA 2K1JA 2ECTA 4BBQA 2VPGA 3GV4A 2M6MA 2L43A 1WENA 4AYCB 2L80A 2VJEB 3U5OA 5LKXA 5DKAA 2ECNA 4GNEA 1T1HA 4FO9A 1WEPA 5KH9A 2K4DA 5C13A 3SOWA 2KGIA 3LRQA 1Z6UA 2VJFB 3PUQA 2XEUA 3RPGB 3KQIA 2YQLA 4AVXA 1WFKA 4AYCA 4LLBA 2YU4A 5FB1A 2ECGA 2F6NA 1WILA 2PNXA 4AP4A 3HCTA 5FERA 5EYAF 4XI1A 1WEEA 1LDKC 5JG6A 5TDWA 1XWHA 4GB0A 3M63A 4B86C 2ECJA 4W4UA 2MD8C 4V3KC 2BAYA 4QF3A 4BHWA 2FUUA 2M85A 2K17A 3LQIA 2VPBA 3O36A 4X3GA 4LKAA 4NN2A 4UP5A 2UZGA 2E6RA 4CCGX 4UI9B 2EA6A 2VP7A 2RI7A 3L1ZB 4L7XA 5LCWB 2ECIA 5B75A 4CA1A 4V3LC 4MVTA 4YABA 1WEVA 4I7DA 2LGGA 5KH3A 2F6JA 2KYUA 3FL2A 3NG2A 4WZ2A 3VK6A 1G25A 1WEMA 2YHNA 2L0BA 2LV9A 5G05B 2VPDA 4GNGA 2D8SA 4FK5A 1VFYA 2YHOA 2F42A 3KV6A 1N87A 3DQVR 1WESA 2LRIC 5TDRA 1Z2QA 2HDPA 3LQHA 4I7BA 5B8DA 2MNYA 1IYMA 3KV5A 1WEWA 1U6GB 1JOCA 4R8PK 3MHSA 3O37A 1HYJA 1JM7B 1MM3A 1X4UA 2H0DB 3HTKC 3M99A 2CSZA 5I3LA 4YBTA 5J3XA 4GNDA 2JRJA 1V87A 2CKLA 2K16A 2MA5A 5H1UA 5TABA 4L58A 2ECVA 3SHBA 1RMDA 2VJEA 4P5OB 3PURA 2LXPC 5LKTA 5H1VA 2YSJA 2KGGA 2MUMA 2ECWA 2G45A 3GL6A 1E4UA 2JMIA 5C11A 4R2YA 3ZTGA 4QF2A 2KFTA 3O7AA 2RSDA 3U5NA 3M62A 3N9LA 5B78A 1DVPA 2HYED 4ZUXU 2CT2A 4S3OB 3N9PA 2KIZA 1FP0A 4YBMA 3RTRB 3T6RA 2IDAA 2Y1MA 2YUCA 2PUYA 2LGLA 2JMJA 4PPEA 4ZDTA 2M3HA 3DPLR 2LGKA 2MNZA 5FB0A 2EGPA 2KWNA 1ZBDB 2CKLB 2QICA 2VJFA 3U5MA 4YATA 3N9QA 3LQJA 3ZYQA 5TBNA 3I2DA 1VD4A 2YREA 3HCSA 4FIPA 4S3OC 4UP0A 4Q6FA 2YW8A 3MHHA 4YBSA 1WE9A 2YURA 3ZPV1 2LN0A 2I50A 3ZVZB 3ZVYA 2L75A 3PHDA 5KH7A 2KR4A 3IHPA 4LK9A 3C5KA 5B79A 1LDJB 3V43A 2MT5A 2YYRA 2AN6A 2MD7B 4B7YC 2EODA 1HYIA 1BORA 3O33A 4YC9A 5B77A 2C2VS 5LKZA 2VPEA 1Z60A 4I7CA 5D1LB 2G43A 1WGMA 2OXQC 5LKUA 1FBVA 5H1TA 4WA6A 2KE1A 1K2FA 4WZ3B 2M1RA 4YADA 3QZVA 1F62A 2KWKA 2QJ0A 2C2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZQL A;  2VNF A;  2YT5 A;  5AIT A;  4A4C A;  3T7L A;  4C9Z A;  3L1X A;  3ZNI A;  5FEY A;  5D1M B;  2KRE A;  4A4B A;  1MM2 A;  4F52 B;  2NAA A;  2MA6 A;  4GNF A;  5D1K B;  4AUQ B;  4MSX A;  3U5P A;  2YSM A;  5TRB A;  2H0D A;  3L11 A;  4O64 A;  2Y1N A;  2LQ6 A;  1X4I A;  4YAX A;  4N3W A;  3N9N A;  2ZET C;  3HCU A;  3EB5 A;  3O35 A;  2QIZ A;  4TKP B;  3RPG C;  4PTB A;  1WIM A;  1X4J A;  3EB6 A;  2FUI A;  3O70 A;  1CHC A;  4FJC A;  4LAD B;  1WEO A;  5DIN A;  5B76 A;  2LGV A;  4N4F A;  2KWO A;  2XB1 A;  2FSA A;  4A0C D;  2LXH C;  5AIU A;  2JMD A;  1WEU A;  3ASL A;  3C6W A;  3O34 A;  2MIQ A;  2KU3 A;  4LJN A;  4A49 A;  1WEQ A;  2CSY A;  2G6Q A;  4R7E A;  5G04 B;  2KWJ A;  4WZ0 A;  4IC2 A;  2YQM A;  5G0F A;  3N9M A;  3SOX A;  1JM7 A;  2LDR A;  1VYX A;  2L5U A;  3SOU A;  2Y43 A;  2DX8 A;  2E6S A;  3ZPV E;  4IC3 A;  3N9O A;  3KNV A;  5H9M A;  2K1J A;  2ECT A;  4BBQ A;  2VPG A;  3GV4 A;  2M6M A;  2L43 A;  1WEN A;  4AYC B;  2L80 A;  2VJE B;  3U5O A;  5LKX A;  5DKA A;  2ECN A;  4GNE A;  1T1H A;  4FO9 A;  1WEP A;  5KH9 A;  2K4D A;  5C13 A;  3SOW A;  2KGI A;  3LRQ A;  1Z6U A;  2VJF B;  3PUQ A;  2XEU A;  3RPG B;  3KQI A;  2YQL A;  4AVX A;  1WFK A;  4AYC A;  4LLB A;  2YU4 A;  5FB1 A;  2ECG A;  2F6N A;  1WIL A;  2PNX A;  4AP4 A;  3HCT A;  5FER A;  5EYA F;  4XI1 A;  1WEE A;  1LDK C;  5JG6 A;  5TDW A;  1XWH A;  4GB0 A;  3M63 A;  4B86 C;  2ECJ A;  4W4U A;  2MD8 C;  4V3K C;  2BAY A;  4QF3 A;  4BHW A;  2FUU A;  2M85 A;  2K17 A;  3LQI A;  2VPB A;  3O36 A;  4X3G A;  4LKA A;  4NN2 A;  4UP5 A;  2UZG A;  2E6R A;  4CCG X;  4UI9 B;  2EA6 A;  2VP7 A;  2RI7 A;  3L1Z B;  4L7X A;  5LCW B;  2ECI A;  5B75 A;  4CA1 A;  4V3L C;  4MVT A;  4YAB A;  1WEV A;  4I7D A;  2LGG A;  5KH3 A;  2F6J A;  2KYU A;  3FL2 A;  3NG2 A;  4WZ2 A;  3VK6 A;  1G25 A;  1WEM A;  2YHN A;  2L0B A;  2LV9 A;  5G05 B;  2VPD A;  4GNG A;  2D8S A;  4FK5 A;  1VFY A;  2YHO A;  2F42 A;  3KV6 A;  1N87 A;  3DQV R;  1WES A;  2LRI C;  5TDR A;  1Z2Q A;  2HDP A;  3LQH A;  4I7B A;  5B8D A;  2MNY A;  1IYM A;  3KV5 A;  1WEW A;  1U6G B;  1JOC A;  4R8P K;  3MHS A;  3O37 A;  1HYJ A;  1JM7 B;  1MM3 A;  1X4U A;  2H0D B;  3HTK C;  3M99 A;  2CSZ A;  5I3L A;  4YBT A;  5J3X A;  4GND A;  2JRJ A;  1V87 A;  2CKL A;  2K16 A;  2MA5 A;  5H1U A;  5TAB A;  4L58 A;  2ECV A;  3SHB A;  1RMD A;  2VJE A;  4P5O B;  3PUR A;  2LXP C;  5LKT A;  5H1V A;  2YSJ A;  2KGG A;  2MUM A;  2ECW A;  2G45 A;  3GL6 A;  1E4U A;  2JMI A;  5C11 A;  4R2Y A;  3ZTG A;  4QF2 A;  2KFT A;  3O7A A;  2RSD A;  3U5N A;  3M62 A;  3N9L A;  5B78 A;  1DVP A;  2HYE D;  4ZUX U;  2CT2 A;  4S3O B;  3N9P A;  2KIZ A;  1FP0 A;  4YBM A;  3RTR B;  3T6R A;  2IDA A;  2Y1M A;  2YUC A;  2PUY A;  2LGL A;  2JMJ A;  4PPE A;  4ZDT A;  2M3H A;  3DPL R;  2LGK A;  2MNZ A;  5FB0 A;  2EGP A;  2KWN A;  1ZBD B;  2CKL B;  2QIC A;  2VJF A;  3U5M A;  4YAT A;  3N9Q A;  3LQJ A;  3ZYQ A;  5TBN A;  3I2D A;  1VD4 A;  2YRE A;  3HCS A;  4FIP A;  4S3O C;  4UP0 A;  4Q6F A;  2YW8 A;  3MHH A;  4YBS A;  1WE9 A;  2YUR A;  3ZPV 1;  2LN0 A;  2I50 A;  3ZVZ B;  3ZVY A;  2L75 A;  3PHD A;  5KH7 A;  2KR4 A;  3IHP A;  4LK9 A;  3C5K A;  5B79 A;  1LDJ B;  3V43 A;  2MT5 A;  2YYR A;  2AN6 A;  2MD7 B;  4B7Y C;  2EOD A;  1HYI A;  1BOR A;  3O33 A;  4YC9 A;  5B77 A;  2C2V S;  5LKZ A;  2VPE A;  1Z60 A;  4I7C A;  5D1L B;  2G43 A;  1WGM A;  2OXQ C;  5LKU A;  1FBV A;  5H1T A;  4WA6 A;  2KE1 A;  1K2F A;  4WZ3 B;  2M1R A;  4YAD A;  3QZV A;  1F62 A;  2KWK A;  2QJ0 A;  2C2L A; 
#chains in the Genus database with same CATH topology
 4ZQL A;  2VNF A;  2YT5 A;  5AIT A;  4A4C A;  3T7L A;  4C9Z A;  3L1X A;  3ZNI A;  5FEY A;  5D1M B;  2KRE A;  4A4B A;  1MM2 A;  2CSV A;  4F52 B;  2NAA A;  2MA6 A;  3FAO A;  4GNF A;  5D1K B;  3MDB C;  4AUQ B;  4MSX A;  3U5P A;  2YSM A;  5TRB A;  2H0D A;  3L11 A;  3LVR E;  4O64 A;  2Y1N A;  4OGC A;  2LQ6 A;  3E2D A;  3LVQ E;  1X4I A;  4YAX A;  4N3W A;  3N9N A;  2ZET C;  3HCU A;  3EB5 A;  2FD4 A;  2QIZ A;  3O35 A;  4QQ4 A;  4TKP B;  2IQJ A;  3RPG C;  4PTB A;  1WIM A;  1X4J A;  3EB6 A;  2FUI A;  3O70 A;  1CHC A;  4FJC A;  4LAD B;  1WEO A;  5DIN A;  3DWD A;  5B76 A;  2LGV A;  4N4F A;  3FEH A;  2KWO A;  2XB1 A;  2FSA A;  4A0C D;  4Z0O A;  2LXH C;  5AIU A;  2JMD A;  3Q1D A;  1WEU A;  3ASL A;  3C6W A;  3O34 A;  2KKX A;  2KU3 A;  2MIQ A;  4LJN A;  4A49 A;  1WEQ A;  2CSY A;  2G6Q A;  4R7E A;  5G04 B;  2KWJ A;  4WZ0 A;  4IC2 A;  2JM3 A;  2YQM A;  5G0F A;  3N9M A;  3SOX A;  1JM7 A;  2LDR A;  1VYX A;  2L5U A;  3SOU A;  2Y43 A;  2DX8 A;  2E6S A;  3ZPV E;  4IC3 A;  3N9O A;  3KNV A;  5H9M A;  2K1J A;  2ECT A;  4BBQ A;  2VPG A;  3GV4 A;  2M6M A;  2L43 A;  2L7P A;  1WEN A;  4AYC B;  2L80 A;  2VJE B;  3U5O A;  5LKX A;  5DKA A;  2ECN A;  4GNE A;  1T1H A;  4FO9 A;  1WEP A;  5KH9 A;  2K4D A;  5C13 A;  3SOW A;  2KGI A;  3LRQ A;  1Z6U A;  2VJF B;  3PUQ A;  2XEU A;  3RPG B;  3KQI A;  2YQL A;  4AVX A;  1WFK A;  4AYC A;  4LLB A;  2YU4 A;  5FB1 A;  2ECG A;  3JUE A;  2F6N A;  1WIL A;  2PNX A;  2FFW A;  3DDT A;  4AP4 A;  3HCT A;  5FER A;  2EGM A;  5EYA F;  4XI1 A;  1WEE A;  1LDK C;  5JG6 A;  3KDE C;  5SVX A;  5TDW A;  1XWH A;  5SVI B;  2LAU A;  2XP0 A;  4GB0 A;  2OWA A;  2CON A;  3M63 A;  5SVY A;  2CRR A;  4B86 C;  2ECJ A;  4W4U A;  2MD8 C;  4V3K C;  2BAY A;  4QF3 A;  3PLW A;  4BHW A;  2FUU A;  2M85 A;  2K17 A;  3LQI A;  2VPB A;  3O36 A;  4X3G A;  4LKA A;  2XOC A;  4NN2 A;  4UP5 A;  2UZG A;  1MBM A;  2E6R A;  3FAN A;  4CCG X;  4UI9 B;  2EA6 A;  2VP7 A;  2M13 A;  2RI7 A;  3L1Z B;  3M7K A;  4L7X A;  5LCW B;  2P57 A;  2ECI A;  5B75 A;  4CA1 A;  4V3L C;  4MVT A;  4YAB A;  1WEV A;  4I7D A;  2LGG A;  5KH3 A;  2F6J A;  2KYU A;  3FL2 A;  2DSM A;  3NG2 A;  4WZ2 A;  3VK6 A;  1G25 A;  1WEM A;  4OGE A;  4F1P A;  2YHN A;  2L0B A;  2LV9 A;  5G05 B;  2VPD A;  3FM8 C;  2YVR A;  5SVI A;  4GNG A;  2D8S A;  4FK5 A;  1VFY A;  2YHO A;  2F42 A;  3KV6 A;  1N87 A;  3DQV R;  1WES A;  2XOY A;  2LRI C;  5TDR A;  1Z2Q A;  2KKY A;  2HDP A;  3T9K A;  3LQH A;  4I7B A;  5B8D A;  2MNY A;  1IYM A;  3KV5 A;  1WEW A;  1U6G B;  1JOC A;  4R8P K;  3MHS A;  2EXU A;  3O37 A;  1HYJ A;  1JM7 B;  1MM3 A;  1X4U A;  2H0D B;  3HTK C;  3M99 A;  2CSZ A;  5I3L A;  4YBT A;  5J3X A;  4GND A;  2JRJ A;  1V87 A;  2CKL A;  2JUN A;  2K16 A;  2MA5 A;  5K3Q A;  5H1U A;  5TAB A;  4L58 A;  2ECV A;  3SHB A;  1RMD A;  2VJE A;  4P5O B;  3PUR A;  2XOZ A;  2LXP C;  5LKT A;  2MKE A;  5H1V A;  2YSJ A;  4H9D A;  2KGG A;  2MUM A;  2ECW A;  2G45 A;  3GL6 A;  1E4U A;  2JMI A;  5C11 A;  4R2Y A;  3LJU X;  3ZTG A;  2RR4 A;  4QF2 A;  2KFT A;  3O7A A;  2RSD A;  3U5N A;  3M62 A;  3N9L A;  5B78 A;  1DVP A;  2HYE D;  3FJU B;  4ZUX U;  2CT2 A;  4S3O B;  3N9P A;  2KIZ A;  1DCQ A;  1FP0 A;  4YBM A;  3RTR B;  3T6R A;  2IDA A;  2Y1M A;  2D8U A;  2YUC A;  2PUY A;  2LGL A;  2JMJ A;  2E61 A;  3SUB A;  4PPE A;  4ZDT A;  2M3H A;  3DPL R;  2LGK A;  2MNZ A;  5FB0 A;  2EGP A;  2KWN A;  4Z0R A;  1ZBD B;  2CKL B;  2QIC A;  2VJF A;  3U5M A;  4YAT A;  3N9Q A;  3LQJ A;  3ZYQ A;  2CRW A;  5TBN A;  3I2D A;  1VD4 A;  2YRE A;  3HCS A;  4FIP A;  4S3O C;  4UP0 A;  4Q6F A;  2YW8 A;  3MHH A;  4YBS A;  1WE9 A;  2YUR A;  3ZPV 1;  2LN0 A;  2I50 A;  3ZVZ B;  3ZVY A;  2L75 A;  3PHD A;  3LDY A;  2DJA A;  5KH7 A;  2KR4 A;  3IHP A;  4LK9 A;  3C5K A;  5B79 A;  1LDJ B;  3V43 A;  2MT5 A;  2YYR A;  2AN6 A;  2MD7 B;  4B7Y C;  2EOD A;  3O47 A;  1HYI A;  1BOR A;  3O33 A;  4YC9 A;  5B77 A;  2C2V S;  5LKZ A;  2VPE A;  1Z60 A;  3H7H A;  4I7C A;  5D1L B;  2G43 A;  1WGM A;  2OXQ C;  5LKU A;  1FBV A;  5H1T A;  4WA6 A;  2KE1 A;  1K2F A;  4WZ3 B;  2M1R A;  4YAD A;  4O62 A;  3QZV A;  2B0O E;  1F62 A;  2KWK A;  2QJ0 A;  2C2L A; 
#chains in the Genus database with same CATH homology
 4ZQL A;  2VNF A;  2YT5 A;  5AIT A;  4A4C A;  3T7L A;  4C9Z A;  3L1X A;  3ZNI A;  5FEY A;  5D1M B;  2KRE A;  4A4B A;  1MM2 A;  4F52 B;  2NAA A;  2MA6 A;  4GNF A;  5D1K B;  4AUQ B;  4MSX A;  3U5P A;  2YSM A;  5TRB A;  2H0D A;  3L11 A;  4O64 A;  2Y1N A;  2LQ6 A;  1X4I A;  4YAX A;  4N3W A;  3N9N A;  2ZET C;  3HCU A;  3EB5 A;  3O35 A;  2QIZ A;  4TKP B;  3RPG C;  4PTB A;  1WIM A;  1X4J A;  3EB6 A;  2FUI A;  3O70 A;  1CHC A;  4FJC A;  4LAD B;  1WEO A;  5DIN A;  5B76 A;  2LGV A;  4N4F A;  2KWO A;  2XB1 A;  2FSA A;  4A0C D;  2LXH C;  5AIU A;  2JMD A;  1WEU A;  3ASL A;  3C6W A;  3O34 A;  2MIQ A;  2KU3 A;  4LJN A;  4A49 A;  1WEQ A;  2CSY A;  2G6Q A;  4R7E A;  5G04 B;  2KWJ A;  4WZ0 A;  4IC2 A;  2YQM A;  5G0F A;  3N9M A;  3SOX A;  1JM7 A;  2LDR A;  1VYX A;  2L5U A;  3SOU A;  2Y43 A;  2DX8 A;  2E6S A;  3ZPV E;  4IC3 A;  3N9O A;  3KNV A;  5H9M A;  2K1J A;  2ECT A;  4BBQ A;  2VPG A;  3GV4 A;  2M6M A;  2L43 A;  1WEN A;  4AYC B;  2L80 A;  2VJE B;  3U5O A;  5LKX A;  5DKA A;  2ECN A;  4GNE A;  1T1H A;  4FO9 A;  1WEP A;  5KH9 A;  2K4D A;  5C13 A;  3SOW A;  2KGI A;  3LRQ A;  1Z6U A;  2VJF B;  3PUQ A;  2XEU A;  3RPG B;  3KQI A;  2YQL A;  4AVX A;  1WFK A;  4AYC A;  4LLB A;  2YU4 A;  5FB1 A;  2ECG A;  2F6N A;  1WIL A;  2PNX A;  4AP4 A;  3HCT A;  5FER A;  5EYA F;  4XI1 A;  1WEE A;  1LDK C;  5JG6 A;  5TDW A;  1XWH A;  4GB0 A;  3M63 A;  4B86 C;  2ECJ A;  4W4U A;  2MD8 C;  4V3K C;  2BAY A;  4QF3 A;  4BHW A;  2FUU A;  2M85 A;  2K17 A;  3LQI A;  2VPB A;  3O36 A;  4X3G A;  4LKA A;  4NN2 A;  4UP5 A;  2UZG A;  2E6R A;  4CCG X;  4UI9 B;  2EA6 A;  2VP7 A;  2RI7 A;  3L1Z B;  4L7X A;  5LCW B;  2ECI A;  5B75 A;  4CA1 A;  4V3L C;  4MVT A;  4YAB A;  1WEV A;  4I7D A;  2LGG A;  5KH3 A;  2F6J A;  2KYU A;  3FL2 A;  3NG2 A;  4WZ2 A;  3VK6 A;  1G25 A;  1WEM A;  2YHN A;  2L0B A;  2LV9 A;  5G05 B;  2VPD A;  4GNG A;  2D8S A;  4FK5 A;  1VFY A;  2YHO A;  2F42 A;  3KV6 A;  1N87 A;  3DQV R;  1WES A;  2LRI C;  5TDR A;  1Z2Q A;  2HDP A;  3LQH A;  4I7B A;  5B8D A;  2MNY A;  1IYM A;  3KV5 A;  1WEW A;  1U6G B;  1JOC A;  4R8P K;  3MHS A;  3O37 A;  1HYJ A;  1JM7 B;  1MM3 A;  1X4U A;  2H0D B;  3HTK C;  3M99 A;  2CSZ A;  5I3L A;  4YBT A;  5J3X A;  4GND A;  2JRJ A;  1V87 A;  2CKL A;  2K16 A;  2MA5 A;  5H1U A;  5TAB A;  4L58 A;  2ECV A;  3SHB A;  1RMD A;  2VJE A;  4P5O B;  3PUR A;  2LXP C;  5LKT A;  5H1V A;  2YSJ A;  2KGG A;  2MUM A;  2ECW A;  2G45 A;  3GL6 A;  1E4U A;  2JMI A;  5C11 A;  4R2Y A;  3ZTG A;  4QF2 A;  2KFT A;  3O7A A;  2RSD A;  3U5N A;  3M62 A;  3N9L A;  5B78 A;  1DVP A;  2HYE D;  4ZUX U;  2CT2 A;  4S3O B;  3N9P A;  2KIZ A;  1FP0 A;  4YBM A;  3RTR B;  3T6R A;  2IDA A;  2Y1M A;  2YUC A;  2PUY A;  2LGL A;  2JMJ A;  4PPE A;  4ZDT A;  2M3H A;  3DPL R;  2LGK A;  2MNZ A;  5FB0 A;  2EGP A;  2KWN A;  1ZBD B;  2CKL B;  2QIC A;  2VJF A;  3U5M A;  4YAT A;  3N9Q A;  3LQJ A;  3ZYQ A;  5TBN A;  3I2D A;  1VD4 A;  2YRE A;  3HCS A;  4FIP A;  4S3O C;  4UP0 A;  4Q6F A;  2YW8 A;  3MHH A;  4YBS A;  1WE9 A;  2YUR A;  3ZPV 1;  2LN0 A;  2I50 A;  3ZVZ B;  3ZVY A;  2L75 A;  3PHD A;  5KH7 A;  2KR4 A;  3IHP A;  4LK9 A;  3C5K A;  5B79 A;  1LDJ B;  3V43 A;  2MT5 A;  2YYR A;  2AN6 A;  2MD7 B;  4B7Y C;  2EOD A;  1HYI A;  1BOR A;  3O33 A;  4YC9 A;  5B77 A;  2C2V S;  5LKZ A;  2VPE A;  1Z60 A;  4I7C A;  5D1L B;  2G43 A;  1WGM A;  2OXQ C;  5LKU A;  1FBV A;  5H1T A;  4WA6 A;  2KE1 A;  1K2F A;  4WZ3 B;  2M1R A;  4YAD A;  3QZV A;  1F62 A;  2KWK A;  2QJ0 A;  2C2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...