2OWAA

Crystal structure of putative gtpase activating protein for adp ribosylation factor from cryptosporidium parvum (cgd5_1040)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
DVDEKGFVSDKLRDNFFQIVRNRPENRTCFDCESRNPTWLSLSFAVFICLNCSSDHRKMGVHISFVRSSDLDKFTPIQLVRMDIGGNGRARNYFKQVLGVNFSPKTKEYASSICGRQYKQILDSEISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Arfgap-like finger domain containing protein
publication title Crystal structure of putative GTPase activating protein for ADP ribosylation factor from Cryptosporidium parvum (cgd5_1040)
rcsb
source organism Cryptosporidium parvum iowa ii
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2owaA01
2CRWA 3SUBA 3FM8C 3FEHA 3LVQE 2B0OE 1DCQA 3JUEA 3DWDA 2P57A 2CRRA 3LVRE 3LJUX 3MDBC 2IQJA 2OWAA 3O47A 4F1PA 3T9KA
chains in the Genus database with same CATH superfamily
3DPLR 2K4DA 4BBQA 4QF2A 3LQIA 4GNDA 4AUQB 2YUCA 4I7CA 2Y1NA 3DDTA 4OGEA 3LQJA 5TDRA 2ECNA 3KQIA 4GNGA 5B76A 4FK5A 4MSXA 3MDBC 2VJFA 3DQVR 3FANA 1WIMA 4CA1A 2KIZA 4YATA 1JOCA 4ZQLA 2D8UA 1E4UA 4YAXA 3SHBA 4BHWA 4C9ZA 1WFKA 5FB1A 4CCGX 2RR4A 2PUYA 2M13A 4NN2A 4L58A 4V3LC 1WEVA 2OWAA 1VYXA 4I7BA 4A0CD 2LDRA 1VFYA 2KFTA 4UI9B 2FSAA 3ZNIA 2JMDA 2VP7A 2M6MA 5B79A 2EGMA 2VPGA 1LDKC 4F52B 2MKEA 3O36A 4R7EA 2LGVA 3N9PA 2EGPA 1Z6UA 5KH9A 2DJAA 5J3XA 4QQ4A 1RMDA 1WEUA 2LN0A 2M3HA 2KYUA 1DCQA 2KWJA 2LXPC 3HTKC 3ZPV1 4PPEA 2XOCA 2UZGA 2BAYA 2LQ6A 2ECWA 1BORA 2XP0A 1X4UA 3KDEC 2L0BA 3EB5A 3H7HA 3Q1DA 5TBNA 2G6QA 2KWKA 3PHDA 2XOYA 2KKYA 2CRWA 2YURA 4YC9A 3U5MA 2MA5A 4WZ2A 2RI7A 3RTRB 4XI1A 2LGGA 3GL6A 3O33A 1JM7B 3KNVA 2AN6A 2L75A 5AIUA 4UP0A 2MT5A 2C2LA 2LV9A 5K3QA 3KV6A 3L1ZB 4S3OB 3FAOA 1FP0A 4MVTA 3HCSA 2C2VS 1WEMA 4WA6A 1Z2QA 4R8PK 4AVXA 3L11A 2YW8A 1WENA 2H0DB 1WGMA 3M63A 4N4FA 5LKXA 4Q6FA 5H1UA 2KWNA 5TDWA 2E61A 1F62A 2CKLA 1WE9A 2JUNA 3KV5A 2L80A 3E2DA 3M99A 5B75A 5DINA 5B78A 2XB1A 5I3LA 1MM2A 2KU3A 3GV4A 5FEYA 3SOUA 2G43A 5AITA 5KH3A 4OGCA 4L7XA 1K2FA 2HYED 2KWOA 2LRIC 2CRRA 5SVXA 3FL2A 1WESA 4YABA 2ECTA 4AYCA 3PURA 1MM3A 1X4JA 1WEOA 2YREA 2YQLA 4AP4A 3U5PA 2FFWA 4IC3A 2F6NA 2YHNA 4LLBA 2LGKA 5H1VA 2LAUA 1HYIA 4V3KC 4I7DA 3O70A 5TABA 4B86C 4WZ0A 4A49A 2QIZA 2ECVA 5SVIA 4A4CA 1CHCA 2JMIA 5EYAF 2JM3A 3M62A 2M1RA 4UP5A 1XWHA 3EB6A 5H1TA 2ECIA 3DWDA 3LQHA 2P57A 3O35A 3NG2A 5D1LB 5LKTA 2Y1MA 2IQJA 2K16A 2VPBA 5C13A 4WZ3B 4FO9A 1WEPA 5C11A 3LDYA 5LKZA 2ECJA 2MD8C 2DX8A 3ASLA 2G45A 5FERA 3VK6A 1WEEA 3FJUB 2D8SA 2CONA 2K1JA 2VPDA 5SVYA 5TRBA 2FUIA 2MNYA 1V87A 2CSYA 4LADB 4LKAA 4PTBA 4A4BA 4YADA 3I2DA 1U6GB 2YSMA 3PUQA 4YBTA 5LKUA 1Z60A 2NAAA 2YSJA 3SOWA 2CSVA 5LCWB 4B7YC 4LJNA 1DVPA 2F6JA 3MHHA 3O47A 5KH7A 3SOXA 2OXQC 4TKPB 5D1MB 3HCUA 3RPGC 2Y43A 5G04B 4QF3A 4YBMA 2ECGA 3N9MA 2EODA 3JUEA 3LRQA 1MBMA 2CT2A 5G05B 2IDAA 2XEUA 3C5KA 1FBVA 4GNFA 2VJEB 3ZYQA 3ZPVE 2LXHC 2K17A 3LVRE 1HYJA 2F42A 3N9QA 2FD4A 3O37A 2EXUA 3ZTGA 2MUMA 3U5NA 4ZUXU 2YHOA 2MNZA 2YT5A 2ZETC 3SUBA 1WEWA 3FM8C 3LVQE 4GB0A 4FJCA 2JMJA 2L43A 3T6RA 2MA6A 3L1XA 4H9DA 4R2YA 2KGIA 3N9OA 2FUUA 2YU4A 2LGLA 1JM7A 3ZVYA 1G25A 1N87A 3PLWA 2E6SA 4F1PA 4S3OC 3N9LA 2E6RA 1WEQA 2QICA 2EA6A 2KGGA 3FEHA 4LK9A 2L7PA 2RSDA 2MD7B 4FIPA 2CKLB 2H0DA 2YYRA 4Z0RA 2KKXA 2DSMA 2VJFB 4YBSA 2QJ0A 5H9MA 5JG6A 1VD4A 2MIQA 3O7AA 3O34A 3RPGB 2YQMA 1X4IA 5FB0A 1ZBDB 3T7LA 2B0OE 4ZDTA 4AYCB 3V43A 2YVRA 2I50A 4O64A 2VPEA 2XOZA 3LJUX 3HCTA 2CSZA 2KR4A 4GNEA 1T1HA 2VJEA 3M7KA 5DKAA 2VNFA 4X3GA 5D1KB 2HDPA 2PNXA 3MHSA 4Z0OA 3U5OA 2L5UA 1IYMA 4N3WA 5SVIB 3IHPA 3ZVZB 4P5OB 3N9NA 4O62A 5B8DA 3QZVA 2M85A 1LDJB 5G0FA 4IC2A 5B77A 1WILA 2KE1A 2KREA 4W4UA 3T9KA 2JRJA 3C6WA
chains in the Genus database with same CATH topology
2KKYA 2CRWA 3SUBA 2LAUA 3FM8C 3FEHA 3LVQE 2B0OE 1DCQA 2D8UA 4Z0OA 3LDYA 2L7PA 3JUEA 3M7KA 3DWDA 4OGEA 2XOCA 3DDTA 5SVIB 2P57A 2YVRA 2EGMA 4OGCA 4Z0RA 2RR4A 2KKXA 2M13A 4H9DA 4O62A 2CSVA 2XP0A 2MKEA 2CRRA 3KDEC 2E61A 3LVRE 2XOZA 3LJUX 5SVXA 5K3QA 2JUNA 3FJUB 5SVIA 2CONA 3PLWA 5SVYA 2FD4A 2IQJA 2OWAA 2EXUA 3E2DA 3H7HA 2YREA 3MDBC 3O47A 2DJAA 3Q1DA 4F1PA 3T9KA 4QQ4A 2FFWA 2JM3A 2XOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRW A;  3SUB A;  3FM8 C;  3FEH A;  3LVQ E;  2B0O E;  1DCQ A;  3JUE A;  3DWD A;  2P57 A;  2CRR A;  3LVR E;  3LJU X;  3MDB C;  2IQJ A;  2OWA A;  3O47 A;  4F1P A;  3T9K A; 
#chains in the Genus database with same CATH topology
 3DPL R;  2K4D A;  4BBQ A;  4QF2 A;  3LQI A;  4GND A;  4AUQ B;  2YUC A;  4I7C A;  2Y1N A;  3DDT A;  4OGE A;  3LQJ A;  5TDR A;  2ECN A;  3KQI A;  4GNG A;  5B76 A;  4FK5 A;  4MSX A;  3MDB C;  2VJF A;  3DQV R;  3FAN A;  1WIM A;  4CA1 A;  2KIZ A;  4YAT A;  1JOC A;  4ZQL A;  2D8U A;  1E4U A;  4YAX A;  3SHB A;  4BHW A;  4C9Z A;  1WFK A;  5FB1 A;  4CCG X;  2RR4 A;  2PUY A;  2M13 A;  4NN2 A;  4L58 A;  4V3L C;  1WEV A;  2OWA A;  1VYX A;  4I7B A;  4A0C D;  2LDR A;  1VFY A;  2KFT A;  4UI9 B;  2FSA A;  3ZNI A;  2JMD A;  2VP7 A;  2M6M A;  5B79 A;  2EGM A;  2VPG A;  1LDK C;  4F52 B;  2MKE A;  3O36 A;  4R7E A;  2LGV A;  3N9P A;  2EGP A;  1Z6U A;  5KH9 A;  2DJA A;  5J3X A;  4QQ4 A;  1RMD A;  1WEU A;  2LN0 A;  2M3H A;  2KYU A;  1DCQ A;  2KWJ A;  2LXP C;  3HTK C;  3ZPV 1;  4PPE A;  2XOC A;  2UZG A;  2BAY A;  2LQ6 A;  2ECW A;  1BOR A;  2XP0 A;  1X4U A;  3KDE C;  2L0B A;  3EB5 A;  3H7H A;  3Q1D A;  5TBN A;  2G6Q A;  2KWK A;  3PHD A;  2XOY A;  2KKY A;  2CRW A;  2YUR A;  4YC9 A;  3U5M A;  2MA5 A;  4WZ2 A;  2RI7 A;  3RTR B;  4XI1 A;  2LGG A;  3GL6 A;  3O33 A;  1JM7 B;  3KNV A;  2AN6 A;  2L75 A;  5AIU A;  4UP0 A;  2MT5 A;  2C2L A;  2LV9 A;  5K3Q A;  3KV6 A;  3L1Z B;  4S3O B;  3FAO A;  1FP0 A;  4MVT A;  3HCS A;  2C2V S;  1WEM A;  4WA6 A;  1Z2Q A;  4R8P K;  4AVX A;  3L11 A;  2YW8 A;  1WEN A;  2H0D B;  1WGM A;  3M63 A;  4N4F A;  5LKX A;  4Q6F A;  5H1U A;  2KWN A;  5TDW A;  2E61 A;  1F62 A;  2CKL A;  1WE9 A;  2JUN A;  3KV5 A;  2L80 A;  3E2D A;  3M99 A;  5B75 A;  5DIN A;  5B78 A;  2XB1 A;  5I3L A;  1MM2 A;  2KU3 A;  3GV4 A;  5FEY A;  3SOU A;  2G43 A;  5AIT A;  5KH3 A;  4OGC A;  4L7X A;  1K2F A;  2HYE D;  2KWO A;  2LRI C;  2CRR A;  5SVX A;  3FL2 A;  1WES A;  4YAB A;  2ECT A;  4AYC A;  3PUR A;  1MM3 A;  1X4J A;  1WEO A;  2YRE A;  2YQL A;  4AP4 A;  3U5P A;  2FFW A;  4IC3 A;  2F6N A;  2YHN A;  4LLB A;  2LGK A;  5H1V A;  2LAU A;  1HYI A;  4V3K C;  4I7D A;  3O70 A;  5TAB A;  4B86 C;  4WZ0 A;  4A49 A;  2QIZ A;  2ECV A;  5SVI A;  4A4C A;  1CHC A;  2JMI A;  5EYA F;  2JM3 A;  3M62 A;  2M1R A;  4UP5 A;  1XWH A;  3EB6 A;  5H1T A;  2ECI A;  3DWD A;  3LQH A;  2P57 A;  3O35 A;  3NG2 A;  5D1L B;  5LKT A;  2Y1M A;  2IQJ A;  2K16 A;  2VPB A;  5C13 A;  4WZ3 B;  4FO9 A;  1WEP A;  5C11 A;  3LDY A;  5LKZ A;  2ECJ A;  2MD8 C;  2DX8 A;  3ASL A;  2G45 A;  5FER A;  3VK6 A;  1WEE A;  3FJU B;  2D8S A;  2CON A;  2K1J A;  2VPD A;  5SVY A;  5TRB A;  2FUI A;  2MNY A;  1V87 A;  2CSY A;  4LAD B;  4LKA A;  4PTB A;  4A4B A;  4YAD A;  3I2D A;  1U6G B;  2YSM A;  3PUQ A;  4YBT A;  5LKU A;  1Z60 A;  2NAA A;  2YSJ A;  3SOW A;  2CSV A;  5LCW B;  4B7Y C;  4LJN A;  1DVP A;  2F6J A;  3MHH A;  3O47 A;  5KH7 A;  3SOX A;  2OXQ C;  4TKP B;  5D1M B;  3HCU A;  3RPG C;  2Y43 A;  5G04 B;  4QF3 A;  4YBM A;  2ECG A;  3N9M A;  2EOD A;  3JUE A;  3LRQ A;  1MBM A;  2CT2 A;  5G05 B;  2IDA A;  2XEU A;  3C5K A;  1FBV A;  4GNF A;  2VJE B;  3ZYQ A;  3ZPV E;  2LXH C;  2K17 A;  3LVR E;  1HYJ A;  2F42 A;  3N9Q A;  2FD4 A;  3O37 A;  2EXU A;  3ZTG A;  2MUM A;  3U5N A;  4ZUX U;  2YHO A;  2MNZ A;  2YT5 A;  2ZET C;  3SUB A;  1WEW A;  3FM8 C;  3LVQ E;  4GB0 A;  4FJC A;  2JMJ A;  2L43 A;  3T6R A;  2MA6 A;  3L1X A;  4H9D A;  4R2Y A;  2KGI A;  3N9O A;  2FUU A;  2YU4 A;  2LGL A;  1JM7 A;  3ZVY A;  1G25 A;  1N87 A;  3PLW A;  2E6S A;  4F1P A;  4S3O C;  3N9L A;  2E6R A;  1WEQ A;  2QIC A;  2EA6 A;  2KGG A;  3FEH A;  4LK9 A;  2L7P A;  2RSD A;  2MD7 B;  4FIP A;  2CKL B;  2H0D A;  2YYR A;  4Z0R A;  2KKX A;  2DSM A;  2VJF B;  4YBS A;  2QJ0 A;  5H9M A;  5JG6 A;  1VD4 A;  2MIQ A;  3O7A A;  3O34 A;  3RPG B;  2YQM A;  1X4I A;  5FB0 A;  1ZBD B;  3T7L A;  2B0O E;  4ZDT A;  4AYC B;  3V43 A;  2YVR A;  2I50 A;  4O64 A;  2VPE A;  2XOZ A;  3LJU X;  3HCT A;  2CSZ A;  2KR4 A;  4GNE A;  1T1H A;  2VJE A;  3M7K A;  5DKA A;  2VNF A;  4X3G A;  5D1K B;  2HDP A;  2PNX A;  3MHS A;  4Z0O A;  3U5O A;  2L5U A;  1IYM A;  4N3W A;  5SVI B;  3IHP A;  3ZVZ B;  4P5O B;  3N9N A;  4O62 A;  5B8D A;  3QZV A;  2M85 A;  1LDJ B;  5G0F A;  4IC2 A;  5B77 A;  1WIL A;  2KE1 A;  2KRE A;  4W4U A;  3T9K A;  2JRJ A;  3C6W A; 
#chains in the Genus database with same CATH homology
 2KKY A;  2CRW A;  3SUB A;  2LAU A;  3FM8 C;  3FEH A;  3LVQ E;  2B0O E;  1DCQ A;  2D8U A;  4Z0O A;  3LDY A;  2L7P A;  3JUE A;  3M7K A;  3DWD A;  4OGE A;  2XOC A;  3DDT A;  5SVI B;  2P57 A;  2YVR A;  2EGM A;  4OGC A;  4Z0R A;  2RR4 A;  2KKX A;  2M13 A;  4H9D A;  4O62 A;  2CSV A;  2XP0 A;  2MKE A;  2CRR A;  3KDE C;  2E61 A;  3LVR E;  2XOZ A;  3LJU X;  5SVX A;  5K3Q A;  2JUN A;  3FJU B;  5SVI A;  2CON A;  3PLW A;  5SVY A;  2FD4 A;  2IQJ A;  2OWA A;  2EXU A;  3E2D A;  3H7H A;  2YRE A;  3MDB C;  3O47 A;  2DJA A;  3Q1D A;  4F1P A;  3T9K A;  4QQ4 A;  2FFW A;  2JM3 A;  2XOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...