2OWAA

Crystal structure of putative gtpase activating protein for adp ribosylation factor from cryptosporidium parvum (cgd5_1040)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
DVDEKGFVSDKLRDNFFQIVRNRPENRTCFDCESRNPTWLSLSFAVFICLNCSSDHRKMGVHISFVRSSDLDKFTPIQLVRMDIGGNGRARNYFKQVLGVNFSPKTKEYASSICGRQYKQILDSEISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arfgap-like finger domain containing protein
publication title Crystal structure of putative GTPase activating protein for ADP ribosylation factor from Cryptosporidium parvum (cgd5_1040)
rcsb
source organism Cryptosporidium parvum iowa ii
molecule tags Protein transport
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2owaA01
3DWDA 2P57A 3SUBA 3T9KA 2CRWA 1DCQA 3O47A 2B0OE 3MDBC 3JUEA 3FM8C 2CRRA 3LVQE 4F1PA 2IQJA 2OWAA 3LVRE 3LJUX 3FEHA
chains in the Genus database with same CATH superfamily
1JM7A 5KH9A 3O37A 3U5PA 1RMDA 3N9PA 4CA1A 3L11A 5TDWA 1MBMA 2EGMA 5TBNA 3FM8C 4GNDA 4S3OB 2JUNA 2YUCA 2HDPA 3SOWA 2KWOA 5SVYA 3MHSA 3QZVA 4XI1A 2KGGA 3PUQA 5G05B 2M1RA 4FK5A 5H1TA 1WIMA 2EODA 4B86C 5FB0A 5C11A 1WE9A 3NG2A 4AUQB 3RPGB 4LLBA 2LN0A 1Z2QA 4ZDTA 5I3LA 2XOCA 2ECGA 4Q6FA 5TABA 2RR4A 2VNFA 4UP0A 3LDYA 2F42A 2DX8A 4A0CD 3DDTA 2QIZA 4YBTA 3O35A 2MNYA 4L58A 4A4BA 1BORA 4QQ4A 2LDRA 2JM3A 3EB6A 4YBMA 2B0OE 3C6WA 2RSDA 1WFKA 3RTRB 2K4DA 5D1MB 4BHWA 5G0FA 1LDJB 2E61A 4YAXA 4C9ZA 1CHCA 2H0DB 2JRJA 3KV5A 4WZ2A 5D1KB 2VPGA 4ZUXU 1WEPA 2D8UA 2FUUA 1G25A 3VK6A 2F6JA 5B76A 2Y43A 2FD4A 5TRBA 2YYRA 4N3WA 3LVRE 2KKXA 4ZQLA 2XEUA 5KH3A 2L75A 2KYUA 1V87A 4LADB 4OGEA 3N9NA 2UZGA 1WGMA 2OXQC 2VJFA 2VPEA 4OGCA 2LRIC 2L0BA 2MNZA 2XP0A 1WESA 1Z6UA 2I50A 2CRRA 2VPBA 5FB1A 4YATA 4FJCA 2BAYA 2ECIA 3O33A 2C2LA 3HCUA 5SVIA 2QJ0A 4GB0A 2L80A 4YC9A 2K17A 2AN6A 2YSMA 1DCQA 2EGPA 3HCTA 2ECJA 3O36A 2G45A 4AVXA 3FL2A 2IQJA 2Y1MA 1HYJA 4R7EA 3FEHA 2CSZA 1N87A 2E6SA 3E2DA 2CSVA 2L43A 1DVPA 3DQVR 5B77A 1X4UA 3M63A 3FAOA 5LKXA 5FERA 2VJEA 4NN2A 4LKAA 1X4IA 4YADA 4IC3A 4GNFA 2KFTA 1WEVA 4WA6A 3SOXA 1FP0A 2LGKA 2H0DA 2M6MA 1VFYA 3L1XA 5J3XA 3U5NA 3T7LA 5G04B 2D8SA 3KNVA 2KR4A 4V3LC 5JG6A 3SOUA 5K3QA 1LDKC 4A4CA 5KH7A 4PPEA 4R8PK 5FEYA 5H1VA 4FIPA 3MDBC 5DKAA 1JM7B 1MM2A 2ECVA 4X3GA 2ECWA 1ZBDB 5D1LB 1X4JA 2KGIA 4BBQA 4AYCA 4YBSA 2FUIA 2YQMA 1K2FA 2EA6A 2KWNA 1VD4A 2NAAA 2MIQA 3FANA 1WILA 5H1UA 4R2YA 2CSYA 3I2DA 5B75A 4YABA 4MVTA 2C2VS 3ZVYA 4AP4A 3Q1DA 1U6GB 3DWDA 4WZ3B 2LGGA 3T6RA 4WZ0A 5TDRA 2LGVA 2JMIA 3ZNIA 4GNGA 2LGLA 2YT5A 4W4UA 3PHDA 3PURA 3GV4A 2OWAA 2MA5A 2LXPC 3PLWA 3ZYQA 2KKYA 4LJNA 2M13A 3O34A 3U5MA 5DINA 2CKLB 5LKUA 1WEMA 2E6RA 2YHNA 3C5KA 3GL6A 3L1ZB 3U5OA 2LXHC 4FO9A 3ZTGA 3JUEA 4QF2A 3H7HA 4I7BA 4IC2A 1E4UA 1WENA 2L7PA 2MA6A 3N9QA 4GNEA 2KWJA 2CT2A 4I7DA 1WEQA 2FFWA 4Z0RA 5EYAF 4UP5A 2CRWA 2HYED 2YREA 5B78A 3FJUB 4P5OB 3MHHA 2ECTA 2G6QA 1WEWA 4A49A 2VJFB 1FBVA 2VPDA 4QF3A 4F52B 1VYXA 3LJUX 2KU3A 1MM3A 2KREA 3HCSA 3ZPVE 2YQLA 3LRQA 2YSJA 2PUYA 3HTKC 3V43A 4H9DA 2MUMA 2RI7A 2YU4A 3SUBA 3DPLR 4O62A 4UI9B 4N4FA 5C13A 4MSXA 5SVIB 1WEOA 3SHBA 1XWHA 2KIZA 4TKPB 2LV9A 4F1PA 4LK9A 3EB5A 3ASLA 4L7XA 5H9MA 4I7CA 2YHOA 2M3HA 2ZETC 5SVXA 2F6NA 3O7AA 5LKZA 2P57A 3KV6A 3N9MA 2EXUA 3LQIA 2MT5A 1WEUA 3O47A 3N9OA 2YVRA 3LVQE 2DJAA 2CKLA 2VJEB 2MD8C 2DSMA 2PNXA 2L5UA 2YW8A 3ZPV1 2M85A 5LCWB 5AITA 2VP7A 5B79A 4O64A 3N9LA 2KE1A 4V3KC 3IHPA 3O70A 2FSAA 2K16A 3M7KA 3M62A 1JOCA 2JMDA 2XOYA 2G43A 2ECNA 1IYMA 5AIUA 4S3OC 2LQ6A 2IDAA 2XB1A 3KDEC 2QICA 2KWKA 2YURA 3ZVZB 1HYIA 5B8DA 3T9KA 2MKEA 3LQHA 2K1JA 2JMJA 4Z0OA 4AYCB 3M99A 2LAUA 1Z60A 4CCGX 3KQIA 1F62A 2XOZA 5LKTA 3RPGC 4B7YC 2MD7B 3LQJA 1T1HA 4PTBA 2Y1NA 2CONA 1WEEA
chains in the Genus database with same CATH topology
4H9DA 3DDTA 3Q1DA 3DWDA 4OGEA 5K3QA 5SVIA 2P57A 4QQ4A 2FFWA 2EXUA 2JM3A 2D8UA 4Z0RA 3SUBA 3T9KA 2MKEA 3KDEC 4O62A 4OGCA 4Z0OA 2CRWA 1DCQA 2XP0A 2YREA 3O47A 2LAUA 2B0OE 3FJUB 3MDBC 2YVRA 2EGMA 3JUEA 5SVIB 2CRRA 3FM8C 2FD4A 3M7KA 3LVQE 2DJAA 3H7HA 4F1PA 2IQJA 2OWAA 2JUNA 2XOCA 2XOYA 2XOZA 3LVRE 2RR4A 3LJUX 2L7PA 3FEHA 3LDYA 3PLWA 2KKXA 2KKYA 5SVYA 2M13A 5SVXA 2E61A 3E2DA 2CONA 2CSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWD A;  2P57 A;  3SUB A;  3T9K A;  2CRW A;  1DCQ A;  3O47 A;  2B0O E;  3MDB C;  3JUE A;  3FM8 C;  2CRR A;  3LVQ E;  4F1P A;  2IQJ A;  2OWA A;  3LVR E;  3LJU X;  3FEH A; 
#chains in the Genus database with same CATH topology
 1JM7 A;  5KH9 A;  3O37 A;  3U5P A;  1RMD A;  3N9P A;  4CA1 A;  3L11 A;  5TDW A;  1MBM A;  2EGM A;  5TBN A;  3FM8 C;  4GND A;  4S3O B;  2JUN A;  2YUC A;  2HDP A;  3SOW A;  2KWO A;  5SVY A;  3MHS A;  3QZV A;  4XI1 A;  2KGG A;  3PUQ A;  5G05 B;  2M1R A;  4FK5 A;  5H1T A;  1WIM A;  2EOD A;  4B86 C;  5FB0 A;  5C11 A;  1WE9 A;  3NG2 A;  4AUQ B;  3RPG B;  4LLB A;  2LN0 A;  1Z2Q A;  4ZDT A;  5I3L A;  2XOC A;  2ECG A;  4Q6F A;  5TAB A;  2RR4 A;  2VNF A;  4UP0 A;  3LDY A;  2F42 A;  2DX8 A;  4A0C D;  3DDT A;  2QIZ A;  4YBT A;  3O35 A;  2MNY A;  4L58 A;  4A4B A;  1BOR A;  4QQ4 A;  2LDR A;  2JM3 A;  3EB6 A;  4YBM A;  2B0O E;  3C6W A;  2RSD A;  1WFK A;  3RTR B;  2K4D A;  5D1M B;  4BHW A;  5G0F A;  1LDJ B;  2E61 A;  4YAX A;  4C9Z A;  1CHC A;  2H0D B;  2JRJ A;  3KV5 A;  4WZ2 A;  5D1K B;  2VPG A;  4ZUX U;  1WEP A;  2D8U A;  2FUU A;  1G25 A;  3VK6 A;  2F6J A;  5B76 A;  2Y43 A;  2FD4 A;  5TRB A;  2YYR A;  4N3W A;  3LVR E;  2KKX A;  4ZQL A;  2XEU A;  5KH3 A;  2L75 A;  2KYU A;  1V87 A;  4LAD B;  4OGE A;  3N9N A;  2UZG A;  1WGM A;  2OXQ C;  2VJF A;  2VPE A;  4OGC A;  2LRI C;  2L0B A;  2MNZ A;  2XP0 A;  1WES A;  1Z6U A;  2I50 A;  2CRR A;  2VPB A;  5FB1 A;  4YAT A;  4FJC A;  2BAY A;  2ECI A;  3O33 A;  2C2L A;  3HCU A;  5SVI A;  2QJ0 A;  4GB0 A;  2L80 A;  4YC9 A;  2K17 A;  2AN6 A;  2YSM A;  1DCQ A;  2EGP A;  3HCT A;  2ECJ A;  3O36 A;  2G45 A;  4AVX A;  3FL2 A;  2IQJ A;  2Y1M A;  1HYJ A;  4R7E A;  3FEH A;  2CSZ A;  1N87 A;  2E6S A;  3E2D A;  2CSV A;  2L43 A;  1DVP A;  3DQV R;  5B77 A;  1X4U A;  3M63 A;  3FAO A;  5LKX A;  5FER A;  2VJE A;  4NN2 A;  4LKA A;  1X4I A;  4YAD A;  4IC3 A;  4GNF A;  2KFT A;  1WEV A;  4WA6 A;  3SOX A;  1FP0 A;  2LGK A;  2H0D A;  2M6M A;  1VFY A;  3L1X A;  5J3X A;  3U5N A;  3T7L A;  5G04 B;  2D8S A;  3KNV A;  2KR4 A;  4V3L C;  5JG6 A;  3SOU A;  5K3Q A;  1LDK C;  4A4C A;  5KH7 A;  4PPE A;  4R8P K;  5FEY A;  5H1V A;  4FIP A;  3MDB C;  5DKA A;  1JM7 B;  1MM2 A;  2ECV A;  4X3G A;  2ECW A;  1ZBD B;  5D1L B;  1X4J A;  2KGI A;  4BBQ A;  4AYC A;  4YBS A;  2FUI A;  2YQM A;  1K2F A;  2EA6 A;  2KWN A;  1VD4 A;  2NAA A;  2MIQ A;  3FAN A;  1WIL A;  5H1U A;  4R2Y A;  2CSY A;  3I2D A;  5B75 A;  4YAB A;  4MVT A;  2C2V S;  3ZVY A;  4AP4 A;  3Q1D A;  1U6G B;  3DWD A;  4WZ3 B;  2LGG A;  3T6R A;  4WZ0 A;  5TDR A;  2LGV A;  2JMI A;  3ZNI A;  4GNG A;  2LGL A;  2YT5 A;  4W4U A;  3PHD A;  3PUR A;  3GV4 A;  2OWA A;  2MA5 A;  2LXP C;  3PLW A;  3ZYQ A;  2KKY A;  4LJN A;  2M13 A;  3O34 A;  3U5M A;  5DIN A;  2CKL B;  5LKU A;  1WEM A;  2E6R A;  2YHN A;  3C5K A;  3GL6 A;  3L1Z B;  3U5O A;  2LXH C;  4FO9 A;  3ZTG A;  3JUE A;  4QF2 A;  3H7H A;  4I7B A;  4IC2 A;  1E4U A;  1WEN A;  2L7P A;  2MA6 A;  3N9Q A;  4GNE A;  2KWJ A;  2CT2 A;  4I7D A;  1WEQ A;  2FFW A;  4Z0R A;  5EYA F;  4UP5 A;  2CRW A;  2HYE D;  2YRE A;  5B78 A;  3FJU B;  4P5O B;  3MHH A;  2ECT A;  2G6Q A;  1WEW A;  4A49 A;  2VJF B;  1FBV A;  2VPD A;  4QF3 A;  4F52 B;  1VYX A;  3LJU X;  2KU3 A;  1MM3 A;  2KRE A;  3HCS A;  3ZPV E;  2YQL A;  3LRQ A;  2YSJ A;  2PUY A;  3HTK C;  3V43 A;  4H9D A;  2MUM A;  2RI7 A;  2YU4 A;  3SUB A;  3DPL R;  4O62 A;  4UI9 B;  4N4F A;  5C13 A;  4MSX A;  5SVI B;  1WEO A;  3SHB A;  1XWH A;  2KIZ A;  4TKP B;  2LV9 A;  4F1P A;  4LK9 A;  3EB5 A;  3ASL A;  4L7X A;  5H9M A;  4I7C A;  2YHO A;  2M3H A;  2ZET C;  5SVX A;  2F6N A;  3O7A A;  5LKZ A;  2P57 A;  3KV6 A;  3N9M A;  2EXU A;  3LQI A;  2MT5 A;  1WEU A;  3O47 A;  3N9O A;  2YVR A;  3LVQ E;  2DJA A;  2CKL A;  2VJE B;  2MD8 C;  2DSM A;  2PNX A;  2L5U A;  2YW8 A;  3ZPV 1;  2M85 A;  5LCW B;  5AIT A;  2VP7 A;  5B79 A;  4O64 A;  3N9L A;  2KE1 A;  4V3K C;  3IHP A;  3O70 A;  2FSA A;  2K16 A;  3M7K A;  3M62 A;  1JOC A;  2JMD A;  2XOY A;  2G43 A;  2ECN A;  1IYM A;  5AIU A;  4S3O C;  2LQ6 A;  2IDA A;  2XB1 A;  3KDE C;  2QIC A;  2KWK A;  2YUR A;  3ZVZ B;  1HYI A;  5B8D A;  3T9K A;  2MKE A;  3LQH A;  2K1J A;  2JMJ A;  4Z0O A;  4AYC B;  3M99 A;  2LAU A;  1Z60 A;  4CCG X;  3KQI A;  1F62 A;  2XOZ A;  5LKT A;  3RPG C;  4B7Y C;  2MD7 B;  3LQJ A;  1T1H A;  4PTB A;  2Y1N A;  2CON A;  1WEE A; 
#chains in the Genus database with same CATH homology
 4H9D A;  3DDT A;  3Q1D A;  3DWD A;  4OGE A;  5K3Q A;  5SVI A;  2P57 A;  4QQ4 A;  2FFW A;  2EXU A;  2JM3 A;  2D8U A;  4Z0R A;  3SUB A;  3T9K A;  2MKE A;  3KDE C;  4O62 A;  4OGC A;  4Z0O A;  2CRW A;  1DCQ A;  2XP0 A;  2YRE A;  3O47 A;  2LAU A;  2B0O E;  3FJU B;  3MDB C;  2YVR A;  2EGM A;  3JUE A;  5SVI B;  2CRR A;  3FM8 C;  2FD4 A;  3M7K A;  3LVQ E;  2DJA A;  3H7H A;  4F1P A;  2IQJ A;  2OWA A;  2JUN A;  2XOC A;  2XOY A;  2XOZ A;  3LVR E;  2RR4 A;  3LJU X;  2L7P A;  3FEH A;  3LDY A;  3PLW A;  2KKX A;  2KKY A;  5SVY A;  2M13 A;  5SVX A;  2E61 A;  3E2D A;  2CON A;  2CSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...