5D1KB

Crystal structure of ubch5b in complex with the ring-u5br fragment of ao7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
110
Chain Sequence
b'NIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGGVQCPVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 D2
publication title Insights into Ubiquitination from the Unique Clamp-like Binding of the RING E3 AO7 to the E2 UbcH5B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 28
structure length 110
sequence length 127
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5d1kB01
4I7CA 2LQ6A 3N9NA 2F6JA 1WE9A 2KE1A 4YBMA 4GNDA 2OXQC 2L43A 3SOXA 3O37A 3N9LA 2RI7A 3L1ZB 1WENA 2HDPA 3HCUA 1WEQA 1WEVA 2KGGA 3LQJA 2MA6A 5AIUA 3ZYQA 2KU3A 5EYAF 5DINA 4B7YC 5LCWB 1WEEA 4MVTA 4XI1A 3O35A 4UI9B 2UZGA 3DQVR 3O7AA 5J3XA 2MA5A 3DPLR 5H1UA 4B86C 3C5KA 3U5MA 4X3GA 2KWNA 3N9QA 2MNYA 4A4CA 2MNZA 4YATA 4WA6A 5B76A 5TRBA 1ZBDB 2YHNA 4N3WA 3N9OA 4UP0A 1CHCA 4LLBA 5C13A 2YT5A 3LQHA 5LKZA 2HYED 4NN2A 2KWOA 3HCSA 3M63A 3RPGC 2ZETC 2E6RA 4F52B 5KH7A 4WZ0A 5I3LA 4FJCA 3EB6A 2JMIA 2Y1MA 2L75A 2LRIC 3M62A 2JMJA 3T6RA 3ASLA 2L0BA 3N9PA 5JG6A 2LDRA 2KGIA 5G04B 2H0DA 3ZPV1 5H1TA 3NG2A 2LGVA 1WEOA 2ECWA 4O64A 2G6QA 3HCTA 2ECIA 4S3OC 4Q6FA 3O33A 4MSXA 4W4UA 3U5OA 2XB1A 5D1LB 2JRJA 2K1JA 1E4UA 4GNGA 1WEPA 5TDWA 3FL2A 2LN0A 4I7DA 2VPBA 2EA6A 2L80A 2ECJA 2JMDA 4L7XA 1BORA 3GV4A 1X4IA 2EGPA 5TBNA 1DVPA 1K2FA 2VP7A 2AN6A 4UP5A 3V43A 4YC9A 2MD7B 1T1HA 5B78A 2CT2A 3M99A 3C6WA 1U6GB 2CKLA 1WEMA 3GL6A 2YSMA 2YSJA 4CCGX 1VD4A 4R8PK 1FBVA 3KV5A 5TDRA 2FUUA 3EB5A 1HYIA 5B77A 2LXPC 2MD8C 1XWHA 4PTBA 3MHHA 2LGLA 2KWJA 3LRQA 1IYMA 2CSZA 4QF2A 4YBSA 2LGGA 3L11A 5KH3A 1G25A 3RPGB 2M3HA 2VJFA 4V3KC 5AITA 4YAXA 4WZ3B 3ZTGA 4C9ZA 2YREA 2K17A 4AVXA 3I2DA 5LKTA 2VPEA 2VNFA 2YUCA 1LDKC 1F62A 5G0FA 2VJFB 1MM3A 2ECVA 2ECNA 2YU4A 3IHPA 3ZVZB 5C11A 1WFKA 1WESA 5LKXA 2FSAA 4ZDTA 4AUQB 3SHBA 4IC2A 3O70A 3RTRB 2E6SA 2MIQA 3PHDA 2KFTA 2C2LA 1Z2QA 1WEWA 2M6MA 2L5UA 4S3OB 2YURA 4P5OB 2H0DB 5D1MB 4A49A 4ZUXU 2ECGA 4LK9A 2Y1NA 4FIPA 3O34A 4V3LC 2I50A 2DX8A 5B8DA 3KV6A 1WEUA 3U5NA 2EODA 2KIZA 2QIZA 5B75A 5D1KB 2XEUA 3ZVYA 2YW8A 2LGKA 2LV9A 5TABA 2QICA 2YQLA 4CA1A 2FUIA 4YADA 5LKUA 4L58A 1JM7A 5FB0A 4A0CD 4IC3A 3MHSA 3O36A 4R7EA 4FK5A 5DKAA 1HYJA 2ECTA 2CKLB 1WILA 4AYCA 2M85A 1FP0A 4WZ2A 5H1VA 2VPDA 2F6NA 2C2VS 1VFYA 2VJEA 5G05B 1JM7B 4LADB 4TKPB 5FB1A 3L1XA 3PUQA 5B79A 4YABA 2K4DA 5KH9A 1Z6UA 4QF3A 2F42A 2BAYA 2KYUA 4AYCB 4YBTA 4LKAA 3PURA 2RSDA 4LJNA 3ZPVE 1V87A 2CSYA 2YHOA 2NAAA 2VJEB 3HTKC 4FO9A 1WIMA 2KWKA 5FEYA 4GB0A 4GNEA 2MT5A 4GNFA 2KREA 3SOUA 1N87A 4PPEA 2PUYA 1RMDA 2G45A 2YQMA 2PNXA 3LQIA 4A4BA 2IDAA 3T7LA 4ZQLA 3VK6A 1Z60A 4I7BA 3KNVA 4AP4A 3QZVA 2KR4A 1MM2A 1X4JA 2Y43A 2M1RA 2MUMA 5H9MA 2YYRA 1VYXA 3KQIA 4BBQA 4N4FA 1WGMA 3SOWA 1X4UA 2QJ0A 3U5PA 3ZNIA 5FERA 1LDJB 2LXHC 1JOCA 4R2YA 2VPGA 2D8SA 3N9MA 2K16A 2G43A 4BHWA
chains in the Genus database with same CATH superfamily
4I7CA 2LQ6A 3N9NA 2F6JA 1WE9A 2DSMA 2KE1A 4YBMA 4GNDA 2OXQC 2L43A 3SOXA 2L7PA 3O37A 3N9LA 2RI7A 3L1ZB 1WENA 2HDPA 3HCUA 1WEQA 1WEVA 2KGGA 3LQJA 2MA6A 5AIUA 3O47A 3ZYQA 2KU3A 5EYAF 5DINA 4F1PA 2JM3A 4B7YC 5LCWB 1WEEA 4MVTA 4H9DA 4XI1A 3O35A 4UI9B 2JUNA 2UZGA 3DQVR 3E2DA 3O7AA 2MKEA 5J3XA 2MA5A 3DPLR 5H1UA 4B86C 2EGMA 3C5KA 3U5MA 4X3GA 2KWNA 3N9QA 2MNYA 4A4CA 2MNZA 4YATA 4WA6A 5B76A 4Z0RA 5TRBA 1ZBDB 2YHNA 4OGCA 4N3WA 3N9OA 4UP0A 5SVYA 1CHCA 4LLBA 5C13A 2YT5A 3LQHA 5LKZA 2HYED 4NN2A 2P57A 2KWOA 3HCSA 3M63A 3RPGC 2ZETC 2E6RA 4F52B 5KH7A 4WZ0A 3KDEC 4OGEA 5I3LA 4FJCA 3EB6A 3LVRE 2JMIA 2KKYA 2Y1MA 2L75A 2LRIC 3M62A 2JMJA 4O62A 3T6RA 3ASLA 2L0BA 3N9PA 3MDBC 5JG6A 1MBMA 2LDRA 2KGIA 5G04B 2H0DA 3ZPV1 5H1TA 3NG2A 2XOZA 2LGVA 1WEOA 2ECWA 4O64A 2G6QA 3HCTA 2ECIA 4S3OC 4Q6FA 2LAUA 3O33A 4MSXA 2FD4A 4W4UA 3U5OA 2XB1A 5D1LB 4QQ4A 2JRJA 2K1JA 1E4UA 4GNGA 1WEPA 5TDWA 3FL2A 2LN0A 4I7DA 2VPBA 2EA6A 2L80A 2B0OE 2ECJA 2JMDA 2EXUA 4L7XA 1BORA 3LVQE 3GV4A 2EGPA 1X4IA 5TBNA 2XOYA 1DVPA 1K2FA 2VP7A 2AN6A 4UP5A 3V43A 4YC9A 2MD7B 1T1HA 5B78A 2CT2A 3M99A 3C6WA 1U6GB 2CKLA 1WEMA 3GL6A 2YSMA 2YSJA 4CCGX 1VD4A 4R8PK 1FBVA 2CRWA 3KV5A 5TDRA 2FUUA 3EB5A 1HYIA 5B77A 2LXPC 2MD8C 3FAOA 1XWHA 4PTBA 3MHHA 2LGLA 2KWJA 3LRQA 1IYMA 2CSZA 3FM8C 4QF2A 2XP0A 4YBSA 4Z0OA 2LGGA 3L11A 5KH3A 1G25A 3DWDA 3RPGB 2M3HA 3M7KA 2VJFA 4V3KC 5AITA 4YAXA 4WZ3B 3ZTGA 4C9ZA 2YREA 2K17A 4AVXA 3I2DA 5LKTA 2VPEA 2VNFA 2YUCA 1LDKC 1F62A 1DCQA 5G0FA 2VJFB 1MM3A 2ECVA 2ECNA 2YU4A 3IHPA 3ZVZB 5C11A 1WFKA 1WESA 2CONA 5LKXA 2FSAA 4ZDTA 5SVIA 3H7HA 4AUQB 3SHBA 4IC2A 3FJUB 3O70A 3RTRB 2E6SA 2MIQA 3PHDA 3FANA 2KFTA 2C2LA 1Z2QA 1WEWA 2M6MA 2L5UA 4S3OB 2YURA 3LDYA 4P5OB 2H0DB 5D1MB 4A49A 3LJUX 4ZUXU 5SVIB 2ECGA 4LK9A 2Y1NA 4FIPA 3O34A 4V3LC 2I50A 3JUEA 2DX8A 5B8DA 3KV6A 5K3QA 1WEUA 3U5NA 2EODA 2KIZA 2QIZA 5B75A 5D1KB 2XEUA 3ZVYA 2YW8A 3FEHA 2LGKA 2D8UA 2LV9A 2RR4A 5TABA 2XOCA 2QICA 2YQLA 4CA1A 2KKXA 2FUIA 2E61A 4YADA 5LKUA 4L58A 1JM7A 2M13A 5FB0A 4A0CD 4IC3A 3MHSA 3O36A 4R7EA 4FK5A 5DKAA 5SVXA 1HYJA 2CRRA 2ECTA 2CKLB 1WILA 4AYCA 2M85A 1FP0A 4WZ2A 5H1VA 2VPDA 2F6NA 2C2VS 1VFYA 2VJEA 5G05B 1JM7B 4LADB 4TKPB 5FB1A 2CSVA 2DJAA 3L1XA 3PUQA 3PLWA 2OWAA 5B79A 4YABA 2K4DA 5KH9A 1Z6UA 4QF3A 2F42A 2BAYA 2KYUA 4AYCB 4YBTA 4LKAA 3PURA 2RSDA 4LJNA 3ZPVE 1V87A 2CSYA 2YHOA 2NAAA 2VJEB 3HTKC 4FO9A 1WIMA 2KWKA 5FEYA 3DDTA 2YVRA 4GB0A 4GNEA 2IQJA 2MT5A 2KREA 3Q1DA 4GNFA 3SOUA 3SUBA 1N87A 4PPEA 2PUYA 1RMDA 2G45A 2YQMA 2PNXA 3LQIA 4A4BA 2IDAA 2FFWA 3T7LA 4ZQLA 3VK6A 1Z60A 4I7BA 3KNVA 4AP4A 3QZVA 2KR4A 1MM2A 1X4JA 2Y43A 2M1RA 2MUMA 5H9MA 2YYRA 1VYXA 3T9KA 3KQIA 4BBQA 4N4FA 1WGMA 3SOWA 1X4UA 2QJ0A 3U5PA 3ZNIA 5FERA 1LDJB 2LXHC 1JOCA 4R2YA 2VPGA 2D8SA 3N9MA 2K16A 2G43A 4BHWA
chains in the Genus database with same CATH topology
4I7CA 2LQ6A 3N9NA 2F6JA 1WE9A 2KE1A 4YBMA 4GNDA 2OXQC 2L43A 3SOXA 3O37A 3N9LA 2RI7A 3L1ZB 1WENA 2HDPA 3HCUA 1WEQA 1WEVA 2KGGA 3LQJA 2MA6A 5AIUA 3ZYQA 2KU3A 5EYAF 5DINA 4B7YC 5LCWB 1WEEA 4MVTA 4XI1A 3O35A 4UI9B 2UZGA 3DQVR 3O7AA 5J3XA 2MA5A 3DPLR 5H1UA 4B86C 3C5KA 3U5MA 4X3GA 2KWNA 3N9QA 2MNYA 4A4CA 2MNZA 4YATA 4WA6A 5B76A 5TRBA 1ZBDB 2YHNA 4N3WA 3N9OA 4UP0A 1CHCA 4LLBA 5C13A 2YT5A 3LQHA 5LKZA 2HYED 4NN2A 2KWOA 3HCSA 3M63A 3RPGC 2ZETC 2E6RA 4F52B 5KH7A 4WZ0A 5I3LA 4FJCA 3EB6A 2JMIA 2Y1MA 2L75A 2LRIC 3M62A 2JMJA 3T6RA 3ASLA 2L0BA 3N9PA 5JG6A 2LDRA 2KGIA 5G04B 2H0DA 3ZPV1 5H1TA 3NG2A 2LGVA 1WEOA 2ECWA 4O64A 2G6QA 3HCTA 2ECIA 4S3OC 4Q6FA 3O33A 4MSXA 4W4UA 3U5OA 2XB1A 5D1LB 2JRJA 2K1JA 1E4UA 4GNGA 1WEPA 5TDWA 3FL2A 2LN0A 4I7DA 2VPBA 2EA6A 2L80A 2ECJA 2JMDA 4L7XA 1BORA 3GV4A 1X4IA 2EGPA 5TBNA 1DVPA 1K2FA 2VP7A 2AN6A 4UP5A 3V43A 4YC9A 2MD7B 1T1HA 5B78A 2CT2A 3M99A 3C6WA 1U6GB 2CKLA 1WEMA 3GL6A 2YSMA 2YSJA 4CCGX 1VD4A 4R8PK 1FBVA 3KV5A 5TDRA 2FUUA 3EB5A 1HYIA 5B77A 2LXPC 2MD8C 1XWHA 4PTBA 3MHHA 2LGLA 2KWJA 3LRQA 1IYMA 2CSZA 4QF2A 4YBSA 2LGGA 3L11A 5KH3A 1G25A 3RPGB 2M3HA 2VJFA 4V3KC 5AITA 4YAXA 4WZ3B 3ZTGA 4C9ZA 2YREA 2K17A 4AVXA 3I2DA 5LKTA 2VPEA 2VNFA 2YUCA 1LDKC 1F62A 5G0FA 2VJFB 1MM3A 2ECVA 2ECNA 2YU4A 3IHPA 3ZVZB 5C11A 1WFKA 1WESA 5LKXA 2FSAA 4ZDTA 4AUQB 3SHBA 4IC2A 3O70A 3RTRB 2E6SA 2MIQA 3PHDA 2KFTA 2C2LA 1Z2QA 1WEWA 2M6MA 2L5UA 4S3OB 2YURA 4P5OB 2H0DB 5D1MB 4A49A 4ZUXU 2ECGA 4LK9A 2Y1NA 4FIPA 3O34A 4V3LC 2I50A 2DX8A 5B8DA 3KV6A 1WEUA 3U5NA 2EODA 2KIZA 2QIZA 5B75A 5D1KB 2XEUA 3ZVYA 2YW8A 2LGKA 2LV9A 5TABA 2QICA 2YQLA 4CA1A 2FUIA 4YADA 5LKUA 4L58A 1JM7A 5FB0A 4A0CD 4IC3A 3MHSA 3O36A 4R7EA 4FK5A 5DKAA 1HYJA 2ECTA 2CKLB 1WILA 4AYCA 2M85A 1FP0A 4WZ2A 5H1VA 2VPDA 2F6NA 2C2VS 1VFYA 2VJEA 5G05B 1JM7B 4LADB 4TKPB 5FB1A 3L1XA 3PUQA 5B79A 4YABA 2K4DA 5KH9A 1Z6UA 4QF3A 2F42A 2BAYA 2KYUA 4AYCB 4YBTA 4LKAA 3PURA 2RSDA 4LJNA 3ZPVE 1V87A 2CSYA 2YHOA 2NAAA 2VJEB 3HTKC 4FO9A 1WIMA 2KWKA 5FEYA 4GB0A 4GNEA 2MT5A 4GNFA 2KREA 3SOUA 1N87A 4PPEA 2PUYA 1RMDA 2G45A 2YQMA 2PNXA 3LQIA 4A4BA 2IDAA 3T7LA 4ZQLA 3VK6A 1Z60A 4I7BA 3KNVA 4AP4A 3QZVA 2KR4A 1MM2A 1X4JA 2Y43A 2M1RA 2MUMA 5H9MA 2YYRA 1VYXA 3KQIA 4BBQA 4N4FA 1WGMA 3SOWA 1X4UA 2QJ0A 3U5PA 3ZNIA 5FERA 1LDJB 2LXHC 1JOCA 4R2YA 2VPGA 2D8SA 3N9MA 2K16A 2G43A 4BHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7C A;  2LQ6 A;  3N9N A;  2F6J A;  1WE9 A;  2KE1 A;  4YBM A;  4GND A;  2OXQ C;  2L43 A;  3SOX A;  3O37 A;  3N9L A;  2RI7 A;  3L1Z B;  1WEN A;  2HDP A;  3HCU A;  1WEQ A;  1WEV A;  2KGG A;  3LQJ A;  2MA6 A;  5AIU A;  3ZYQ A;  2KU3 A;  5EYA F;  5DIN A;  4B7Y C;  5LCW B;  1WEE A;  4MVT A;  4XI1 A;  3O35 A;  4UI9 B;  2UZG A;  3DQV R;  3O7A A;  5J3X A;  2MA5 A;  3DPL R;  5H1U A;  4B86 C;  3C5K A;  3U5M A;  4X3G A;  2KWN A;  3N9Q A;  2MNY A;  4A4C A;  2MNZ A;  4YAT A;  4WA6 A;  5B76 A;  5TRB A;  1ZBD B;  2YHN A;  4N3W A;  3N9O A;  4UP0 A;  1CHC A;  4LLB A;  5C13 A;  2YT5 A;  3LQH A;  5LKZ A;  2HYE D;  4NN2 A;  2KWO A;  3HCS A;  3M63 A;  3RPG C;  2ZET C;  2E6R A;  4F52 B;  5KH7 A;  4WZ0 A;  5I3L A;  4FJC A;  3EB6 A;  2JMI A;  2Y1M A;  2L75 A;  2LRI C;  3M62 A;  2JMJ A;  3T6R A;  3ASL A;  2L0B A;  3N9P A;  5JG6 A;  2LDR A;  2KGI A;  5G04 B;  2H0D A;  3ZPV 1;  5H1T A;  3NG2 A;  2LGV A;  1WEO A;  2ECW A;  4O64 A;  2G6Q A;  3HCT A;  2ECI A;  4S3O C;  4Q6F A;  3O33 A;  4MSX A;  4W4U A;  3U5O A;  2XB1 A;  5D1L B;  2JRJ A;  2K1J A;  1E4U A;  4GNG A;  1WEP A;  5TDW A;  3FL2 A;  2LN0 A;  4I7D A;  2VPB A;  2EA6 A;  2L80 A;  2ECJ A;  2JMD A;  4L7X A;  1BOR A;  3GV4 A;  1X4I A;  2EGP A;  5TBN A;  1DVP A;  1K2F A;  2VP7 A;  2AN6 A;  4UP5 A;  3V43 A;  4YC9 A;  2MD7 B;  1T1H A;  5B78 A;  2CT2 A;  3M99 A;  3C6W A;  1U6G B;  2CKL A;  1WEM A;  3GL6 A;  2YSM A;  2YSJ A;  4CCG X;  1VD4 A;  4R8P K;  1FBV A;  3KV5 A;  5TDR A;  2FUU A;  3EB5 A;  1HYI A;  5B77 A;  2LXP C;  2MD8 C;  1XWH A;  4PTB A;  3MHH A;  2LGL A;  2KWJ A;  3LRQ A;  1IYM A;  2CSZ A;  4QF2 A;  4YBS A;  2LGG A;  3L11 A;  5KH3 A;  1G25 A;  3RPG B;  2M3H A;  2VJF A;  4V3K C;  5AIT A;  4YAX A;  4WZ3 B;  3ZTG A;  4C9Z A;  2YRE A;  2K17 A;  4AVX A;  3I2D A;  5LKT A;  2VPE A;  2VNF A;  2YUC A;  1LDK C;  1F62 A;  5G0F A;  2VJF B;  1MM3 A;  2ECV A;  2ECN A;  2YU4 A;  3IHP A;  3ZVZ B;  5C11 A;  1WFK A;  1WES A;  5LKX A;  2FSA A;  4ZDT A;  4AUQ B;  3SHB A;  4IC2 A;  3O70 A;  3RTR B;  2E6S A;  2MIQ A;  3PHD A;  2KFT A;  2C2L A;  1Z2Q A;  1WEW A;  2M6M A;  2L5U A;  4S3O B;  2YUR A;  4P5O B;  2H0D B;  5D1M B;  4A49 A;  4ZUX U;  2ECG A;  4LK9 A;  2Y1N A;  4FIP A;  3O34 A;  4V3L C;  2I50 A;  2DX8 A;  5B8D A;  3KV6 A;  1WEU A;  3U5N A;  2EOD A;  2KIZ A;  2QIZ A;  5B75 A;  5D1K B;  2XEU A;  3ZVY A;  2YW8 A;  2LGK A;  2LV9 A;  5TAB A;  2QIC A;  2YQL A;  4CA1 A;  2FUI A;  4YAD A;  5LKU A;  4L58 A;  1JM7 A;  5FB0 A;  4A0C D;  4IC3 A;  3MHS A;  3O36 A;  4R7E A;  4FK5 A;  5DKA A;  1HYJ A;  2ECT A;  2CKL B;  1WIL A;  4AYC A;  2M85 A;  1FP0 A;  4WZ2 A;  5H1V A;  2VPD A;  2F6N A;  2C2V S;  1VFY A;  2VJE A;  5G05 B;  1JM7 B;  4LAD B;  4TKP B;  5FB1 A;  3L1X A;  3PUQ A;  5B79 A;  4YAB A;  2K4D A;  5KH9 A;  1Z6U A;  4QF3 A;  2F42 A;  2BAY A;  2KYU A;  4AYC B;  4YBT A;  4LKA A;  3PUR A;  2RSD A;  4LJN A;  3ZPV E;  1V87 A;  2CSY A;  2YHO A;  2NAA A;  2VJE B;  3HTK C;  4FO9 A;  1WIM A;  2KWK A;  5FEY A;  4GB0 A;  4GNE A;  2MT5 A;  4GNF A;  2KRE A;  3SOU A;  1N87 A;  4PPE A;  2PUY A;  1RMD A;  2G45 A;  2YQM A;  2PNX A;  3LQI A;  4A4B A;  2IDA A;  3T7L A;  4ZQL A;  3VK6 A;  1Z60 A;  4I7B A;  3KNV A;  4AP4 A;  3QZV A;  2KR4 A;  1MM2 A;  1X4J A;  2Y43 A;  2M1R A;  2MUM A;  5H9M A;  2YYR A;  1VYX A;  3KQI A;  4BBQ A;  4N4F A;  1WGM A;  3SOW A;  1X4U A;  2QJ0 A;  3U5P A;  3ZNI A;  5FER A;  1LDJ B;  2LXH C;  1JOC A;  4R2Y A;  2VPG A;  2D8S A;  3N9M A;  2K16 A;  2G43 A;  4BHW A; 
#chains in the Genus database with same CATH topology
 4I7C A;  2LQ6 A;  3N9N A;  2F6J A;  1WE9 A;  2DSM A;  2KE1 A;  4YBM A;  4GND A;  2OXQ C;  2L43 A;  3SOX A;  2L7P A;  3O37 A;  3N9L A;  2RI7 A;  3L1Z B;  1WEN A;  2HDP A;  3HCU A;  1WEQ A;  1WEV A;  2KGG A;  3LQJ A;  2MA6 A;  5AIU A;  3O47 A;  3ZYQ A;  2KU3 A;  5EYA F;  5DIN A;  4F1P A;  2JM3 A;  4B7Y C;  5LCW B;  1WEE A;  4MVT A;  4H9D A;  4XI1 A;  3O35 A;  4UI9 B;  2JUN A;  2UZG A;  3DQV R;  3E2D A;  3O7A A;  2MKE A;  5J3X A;  2MA5 A;  3DPL R;  5H1U A;  4B86 C;  2EGM A;  3C5K A;  3U5M A;  4X3G A;  2KWN A;  3N9Q A;  2MNY A;  4A4C A;  2MNZ A;  4YAT A;  4WA6 A;  5B76 A;  4Z0R A;  5TRB A;  1ZBD B;  2YHN A;  4OGC A;  4N3W A;  3N9O A;  4UP0 A;  5SVY A;  1CHC A;  4LLB A;  5C13 A;  2YT5 A;  3LQH A;  5LKZ A;  2HYE D;  4NN2 A;  2P57 A;  2KWO A;  3HCS A;  3M63 A;  3RPG C;  2ZET C;  2E6R A;  4F52 B;  5KH7 A;  4WZ0 A;  3KDE C;  4OGE A;  5I3L A;  4FJC A;  3EB6 A;  3LVR E;  2JMI A;  2KKY A;  2Y1M A;  2L75 A;  2LRI C;  3M62 A;  2JMJ A;  4O62 A;  3T6R A;  3ASL A;  2L0B A;  3N9P A;  3MDB C;  5JG6 A;  1MBM A;  2LDR A;  2KGI A;  5G04 B;  2H0D A;  3ZPV 1;  5H1T A;  3NG2 A;  2XOZ A;  2LGV A;  1WEO A;  2ECW A;  4O64 A;  2G6Q A;  3HCT A;  2ECI A;  4S3O C;  4Q6F A;  2LAU A;  3O33 A;  4MSX A;  2FD4 A;  4W4U A;  3U5O A;  2XB1 A;  5D1L B;  4QQ4 A;  2JRJ A;  2K1J A;  1E4U A;  4GNG A;  1WEP A;  5TDW A;  3FL2 A;  2LN0 A;  4I7D A;  2VPB A;  2EA6 A;  2L80 A;  2B0O E;  2ECJ A;  2JMD A;  2EXU A;  4L7X A;  1BOR A;  3LVQ E;  3GV4 A;  2EGP A;  1X4I A;  5TBN A;  2XOY A;  1DVP A;  1K2F A;  2VP7 A;  2AN6 A;  4UP5 A;  3V43 A;  4YC9 A;  2MD7 B;  1T1H A;  5B78 A;  2CT2 A;  3M99 A;  3C6W A;  1U6G B;  2CKL A;  1WEM A;  3GL6 A;  2YSM A;  2YSJ A;  4CCG X;  1VD4 A;  4R8P K;  1FBV A;  2CRW A;  3KV5 A;  5TDR A;  2FUU A;  3EB5 A;  1HYI A;  5B77 A;  2LXP C;  2MD8 C;  3FAO A;  1XWH A;  4PTB A;  3MHH A;  2LGL A;  2KWJ A;  3LRQ A;  1IYM A;  2CSZ A;  3FM8 C;  4QF2 A;  2XP0 A;  4YBS A;  4Z0O A;  2LGG A;  3L11 A;  5KH3 A;  1G25 A;  3DWD A;  3RPG B;  2M3H A;  3M7K A;  2VJF A;  4V3K C;  5AIT A;  4YAX A;  4WZ3 B;  3ZTG A;  4C9Z A;  2YRE A;  2K17 A;  4AVX A;  3I2D A;  5LKT A;  2VPE A;  2VNF A;  2YUC A;  1LDK C;  1F62 A;  1DCQ A;  5G0F A;  2VJF B;  1MM3 A;  2ECV A;  2ECN A;  2YU4 A;  3IHP A;  3ZVZ B;  5C11 A;  1WFK A;  1WES A;  2CON A;  5LKX A;  2FSA A;  4ZDT A;  5SVI A;  3H7H A;  4AUQ B;  3SHB A;  4IC2 A;  3FJU B;  3O70 A;  3RTR B;  2E6S A;  2MIQ A;  3PHD A;  3FAN A;  2KFT A;  2C2L A;  1Z2Q A;  1WEW A;  2M6M A;  2L5U A;  4S3O B;  2YUR A;  3LDY A;  4P5O B;  2H0D B;  5D1M B;  4A49 A;  3LJU X;  4ZUX U;  5SVI B;  2ECG A;  4LK9 A;  2Y1N A;  4FIP A;  3O34 A;  4V3L C;  2I50 A;  3JUE A;  2DX8 A;  5B8D A;  3KV6 A;  5K3Q A;  1WEU A;  3U5N A;  2EOD A;  2KIZ A;  2QIZ A;  5B75 A;  5D1K B;  2XEU A;  3ZVY A;  2YW8 A;  3FEH A;  2LGK A;  2D8U A;  2LV9 A;  2RR4 A;  5TAB A;  2XOC A;  2QIC A;  2YQL A;  4CA1 A;  2KKX A;  2FUI A;  2E61 A;  4YAD A;  5LKU A;  4L58 A;  1JM7 A;  2M13 A;  5FB0 A;  4A0C D;  4IC3 A;  3MHS A;  3O36 A;  4R7E A;  4FK5 A;  5DKA A;  5SVX A;  1HYJ A;  2CRR A;  2ECT A;  2CKL B;  1WIL A;  4AYC A;  2M85 A;  1FP0 A;  4WZ2 A;  5H1V A;  2VPD A;  2F6N A;  2C2V S;  1VFY A;  2VJE A;  5G05 B;  1JM7 B;  4LAD B;  4TKP B;  5FB1 A;  2CSV A;  2DJA A;  3L1X A;  3PUQ A;  3PLW A;  2OWA A;  5B79 A;  4YAB A;  2K4D A;  5KH9 A;  1Z6U A;  4QF3 A;  2F42 A;  2BAY A;  2KYU A;  4AYC B;  4YBT A;  4LKA A;  3PUR A;  2RSD A;  4LJN A;  3ZPV E;  1V87 A;  2CSY A;  2YHO A;  2NAA A;  2VJE B;  3HTK C;  4FO9 A;  1WIM A;  2KWK A;  5FEY A;  3DDT A;  2YVR A;  4GB0 A;  4GNE A;  2IQJ A;  2MT5 A;  2KRE A;  3Q1D A;  4GNF A;  3SOU A;  3SUB A;  1N87 A;  4PPE A;  2PUY A;  1RMD A;  2G45 A;  2YQM A;  2PNX A;  3LQI A;  4A4B A;  2IDA A;  2FFW A;  3T7L A;  4ZQL A;  3VK6 A;  1Z60 A;  4I7B A;  3KNV A;  4AP4 A;  3QZV A;  2KR4 A;  1MM2 A;  1X4J A;  2Y43 A;  2M1R A;  2MUM A;  5H9M A;  2YYR A;  1VYX A;  3T9K A;  3KQI A;  4BBQ A;  4N4F A;  1WGM A;  3SOW A;  1X4U A;  2QJ0 A;  3U5P A;  3ZNI A;  5FER A;  1LDJ B;  2LXH C;  1JOC A;  4R2Y A;  2VPG A;  2D8S A;  3N9M A;  2K16 A;  2G43 A;  4BHW A; 
#chains in the Genus database with same CATH homology
 4I7C A;  2LQ6 A;  3N9N A;  2F6J A;  1WE9 A;  2KE1 A;  4YBM A;  4GND A;  2OXQ C;  2L43 A;  3SOX A;  3O37 A;  3N9L A;  2RI7 A;  3L1Z B;  1WEN A;  2HDP A;  3HCU A;  1WEQ A;  1WEV A;  2KGG A;  3LQJ A;  2MA6 A;  5AIU A;  3ZYQ A;  2KU3 A;  5EYA F;  5DIN A;  4B7Y C;  5LCW B;  1WEE A;  4MVT A;  4XI1 A;  3O35 A;  4UI9 B;  2UZG A;  3DQV R;  3O7A A;  5J3X A;  2MA5 A;  3DPL R;  5H1U A;  4B86 C;  3C5K A;  3U5M A;  4X3G A;  2KWN A;  3N9Q A;  2MNY A;  4A4C A;  2MNZ A;  4YAT A;  4WA6 A;  5B76 A;  5TRB A;  1ZBD B;  2YHN A;  4N3W A;  3N9O A;  4UP0 A;  1CHC A;  4LLB A;  5C13 A;  2YT5 A;  3LQH A;  5LKZ A;  2HYE D;  4NN2 A;  2KWO A;  3HCS A;  3M63 A;  3RPG C;  2ZET C;  2E6R A;  4F52 B;  5KH7 A;  4WZ0 A;  5I3L A;  4FJC A;  3EB6 A;  2JMI A;  2Y1M A;  2L75 A;  2LRI C;  3M62 A;  2JMJ A;  3T6R A;  3ASL A;  2L0B A;  3N9P A;  5JG6 A;  2LDR A;  2KGI A;  5G04 B;  2H0D A;  3ZPV 1;  5H1T A;  3NG2 A;  2LGV A;  1WEO A;  2ECW A;  4O64 A;  2G6Q A;  3HCT A;  2ECI A;  4S3O C;  4Q6F A;  3O33 A;  4MSX A;  4W4U A;  3U5O A;  2XB1 A;  5D1L B;  2JRJ A;  2K1J A;  1E4U A;  4GNG A;  1WEP A;  5TDW A;  3FL2 A;  2LN0 A;  4I7D A;  2VPB A;  2EA6 A;  2L80 A;  2ECJ A;  2JMD A;  4L7X A;  1BOR A;  3GV4 A;  1X4I A;  2EGP A;  5TBN A;  1DVP A;  1K2F A;  2VP7 A;  2AN6 A;  4UP5 A;  3V43 A;  4YC9 A;  2MD7 B;  1T1H A;  5B78 A;  2CT2 A;  3M99 A;  3C6W A;  1U6G B;  2CKL A;  1WEM A;  3GL6 A;  2YSM A;  2YSJ A;  4CCG X;  1VD4 A;  4R8P K;  1FBV A;  3KV5 A;  5TDR A;  2FUU A;  3EB5 A;  1HYI A;  5B77 A;  2LXP C;  2MD8 C;  1XWH A;  4PTB A;  3MHH A;  2LGL A;  2KWJ A;  3LRQ A;  1IYM A;  2CSZ A;  4QF2 A;  4YBS A;  2LGG A;  3L11 A;  5KH3 A;  1G25 A;  3RPG B;  2M3H A;  2VJF A;  4V3K C;  5AIT A;  4YAX A;  4WZ3 B;  3ZTG A;  4C9Z A;  2YRE A;  2K17 A;  4AVX A;  3I2D A;  5LKT A;  2VPE A;  2VNF A;  2YUC A;  1LDK C;  1F62 A;  5G0F A;  2VJF B;  1MM3 A;  2ECV A;  2ECN A;  2YU4 A;  3IHP A;  3ZVZ B;  5C11 A;  1WFK A;  1WES A;  5LKX A;  2FSA A;  4ZDT A;  4AUQ B;  3SHB A;  4IC2 A;  3O70 A;  3RTR B;  2E6S A;  2MIQ A;  3PHD A;  2KFT A;  2C2L A;  1Z2Q A;  1WEW A;  2M6M A;  2L5U A;  4S3O B;  2YUR A;  4P5O B;  2H0D B;  5D1M B;  4A49 A;  4ZUX U;  2ECG A;  4LK9 A;  2Y1N A;  4FIP A;  3O34 A;  4V3L C;  2I50 A;  2DX8 A;  5B8D A;  3KV6 A;  1WEU A;  3U5N A;  2EOD A;  2KIZ A;  2QIZ A;  5B75 A;  5D1K B;  2XEU A;  3ZVY A;  2YW8 A;  2LGK A;  2LV9 A;  5TAB A;  2QIC A;  2YQL A;  4CA1 A;  2FUI A;  4YAD A;  5LKU A;  4L58 A;  1JM7 A;  5FB0 A;  4A0C D;  4IC3 A;  3MHS A;  3O36 A;  4R7E A;  4FK5 A;  5DKA A;  1HYJ A;  2ECT A;  2CKL B;  1WIL A;  4AYC A;  2M85 A;  1FP0 A;  4WZ2 A;  5H1V A;  2VPD A;  2F6N A;  2C2V S;  1VFY A;  2VJE A;  5G05 B;  1JM7 B;  4LAD B;  4TKP B;  5FB1 A;  3L1X A;  3PUQ A;  5B79 A;  4YAB A;  2K4D A;  5KH9 A;  1Z6U A;  4QF3 A;  2F42 A;  2BAY A;  2KYU A;  4AYC B;  4YBT A;  4LKA A;  3PUR A;  2RSD A;  4LJN A;  3ZPV E;  1V87 A;  2CSY A;  2YHO A;  2NAA A;  2VJE B;  3HTK C;  4FO9 A;  1WIM A;  2KWK A;  5FEY A;  4GB0 A;  4GNE A;  2MT5 A;  4GNF A;  2KRE A;  3SOU A;  1N87 A;  4PPE A;  2PUY A;  1RMD A;  2G45 A;  2YQM A;  2PNX A;  3LQI A;  4A4B A;  2IDA A;  3T7L A;  4ZQL A;  3VK6 A;  1Z60 A;  4I7B A;  3KNV A;  4AP4 A;  3QZV A;  2KR4 A;  1MM2 A;  1X4J A;  2Y43 A;  2M1R A;  2MUM A;  5H9M A;  2YYR A;  1VYX A;  3KQI A;  4BBQ A;  4N4F A;  1WGM A;  3SOW A;  1X4U A;  2QJ0 A;  3U5P A;  3ZNI A;  5FER A;  1LDJ B;  2LXH C;  1JOC A;  4R2Y A;  2VPG A;  2D8S A;  3N9M A;  2K16 A;  2G43 A;  4BHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...