5D1KB

Crystal structure of ubch5b in complex with the ring-u5br fragment of ao7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
110
Chain Sequence
NIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELKAQGGVQCPVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGIIDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 D2
publication title Insights into Ubiquitination from the Unique Clamp-like Binding of the RING E3 AO7 to the E2 UbcH5B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 28
structure length 110
sequence length 127
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5d1kB01
2LN0A 1Z6UA 3SOWA 2FSAA 5FB0A 3DQVR 1JM7B 2EODA 4W4UA 2L75A 3GL6A 3EB5A 2Y1MA 4YBTA 1WEQA 2MD8C 4N4FA 5D1LB 5EYAF 2LDRA 2VJEB 3O37A 5DINA 5LKZA 4YAXA 2M6MA 2ECGA 3HTKC 2LGKA 5FERA 5H1VA 2KGGA 5D1KB 1CHCA 2KWNA 5TABA 4WA6A 2YREA 3ZNIA 2QIZA 3M62A 5TBNA 1ZBDB 2KWKA 2QICA 3NG2A 2CSYA 2YHOA 2C2VS 2MA6A 3ZPVE 3O70A 1WGMA 4AUQB 1WILA 4ZUXU 3PURA 4FK5A 5H1TA 2ECJA 1JOCA 1JM7A 3KQIA 4L58A 5G04B 2ZETC 3SOXA 2VNFA 4YADA 5FB1A 4YBSA 2G45A 5AIUA 1K2FA 5D1MB 5KH3A 2G6QA 3I2DA 4YBMA 4PPEA 5C13A 1G25A 2L80A 4N3WA 1VFYA 4AVXA 2E6RA 2RSDA 1F62A 4GB0A 2KWOA 2MD7B 5JG6A 4L7XA 4CA1A 4GNFA 2MNYA 1WESA 1WEWA 2YUCA 5LKTA 3LQHA 2MT5A 2VPDA 3U5MA 2KR4A 3VK6A 3HCUA 1V87A 2K17A 3U5NA 4NN2A 4R8PK 3T7LA 4YATA 2M85A 4A49A 5DKAA 1WFKA 4AYCB 3LRQA 2I50A 1Z60A 2JMDA 4IC3A 2CSZA 1HYJA 2Y43A 2G43A 4FJCA 2VPGA 2JMIA 4GNEA 5LKUA 4QF3A 1WIMA 1WEVA 2UZGA 3T6RA 2LGLA 2NAAA 2CT2A 2LXPC 3FL2A 2KIZA 5B78A 2YQLA 5B76A 2K4DA 5LCWB 5I3LA 4V3KC 3RTRB 2HYED 3N9MA 4AP4A 4F52B 5C11A 2L43A 4XI1A 4O64A 1BORA 4Q6FA 4I7DA 1X4UA 4BHWA 2RI7A 2VP7A 4A4BA 4AYCA 4PTBA 5H9MA 2KE1A 5FEYA 5KH9A 1X4IA 4CCGX 4UP0A 2YT5A 3ZTGA 2VJEA 5KH7A 3ASLA 1WEMA 5H1UA 2AN6A 2LQ6A 3U5PA 4B86C 4LK9A 2Y1NA 2EGPA 2VPBA 1E4UA 1X4JA 2FUIA 2K16A 5TRBA 2CKLB 2YQMA 3M63A 4P5OB 2KU3A 2EA6A 2YYRA 3KV6A 3C6WA 2HDPA 3EB6A 3O35A 2XEUA 3QZVA 3N9PA 3RPGC 2JRJA 1U6GB 2KWJA 1T1HA 1LDJB 2KFTA 4C9ZA 2M3HA 2BAYA 2K1JA 4TKPB 4GNDA 4YABA 2F6JA 2LV9A 2YURA 4UP5A 1MM2A 3L1XA 3HCTA 1LDKC 3N9OA 3DPLR 3HCSA 5G0FA 4S3OC 4LKAA 5B75A 4WZ2A 1WE9A 2H0DB 2VJFB 3O36A 2CKLA 2PNXA 4X3GA 4LJNA 3O33A 2JMJA 4MVTA 5J3XA 2KREA 2ECWA 4R7EA 4R2YA 4V3LC 2KYUA 3GV4A 2ECIA 4UI9B 3N9LA 3N9QA 3SHBA 3N9NA 4B7YC 3ZVZB 1VYXA 4FIPA 2QJ0A 1HYIA 2C2LA 3ZPV1 5LKXA 4I7CA 2L5UA 2M1RA 3PUQA 1N87A 4MSXA 2YSMA 3V43A 2YHNA 4ZDTA 5TDWA 2MNZA 3M99A 5B79A 2LGVA 4WZ0A 2D8SA 1IYMA 1WEUA 2H0DA 2VJFA 3O34A 1MM3A 2FUUA 2VPEA 3O7AA 4A0CD 4BBQA 2YW8A 2L0BA 3PHDA 4FO9A 5AITA 2DX8A 3ZYQA 3IHPA 2LGGA 1FP0A 5B77A 1WEOA 4LADB 1RMDA 1DVPA 3RPGB 1WEPA 3L11A 5B8DA 3U5OA 2IDAA 3L1ZB 3MHSA 3ZVYA 2MIQA 2LRIC 1FBVA 3LQIA 3SOUA 4I7BA 2ECVA 1WENA 2E6SA 4WZ3B 2F6NA 5G05B 2PUYA 1VD4A 4GNGA 3C5KA 4QF2A 4LLBA 2LXHC 4ZQLA 4S3OB 4IC2A 2ECNA 4A4CA 1WEEA 5TDRA 3LQJA 3KNVA 2MA5A 1XWHA 2ECTA 1Z2QA 2KGIA 2OXQC 2F42A 3MHHA 3KV5A 4YC9A 2XB1A 2YU4A 2YSJA 2MUMA
chains in the Genus database with same CATH superfamily
2LN0A 1Z6UA 3SOWA 2FSAA 5FB0A 3DQVR 1JM7B 2FFWA 2EODA 4W4UA 2XP0A 2L75A 3GL6A 3EB5A 2Y1MA 4YBTA 1WEQA 2MD8C 4N4FA 5D1LB 2LDRA 2VJEB 3O37A 5EYAF 5DINA 5LKZA 4YAXA 2M6MA 2ECGA 3HTKC 2LGKA 5FERA 5H1VA 2RR4A 2KGGA 5D1KB 1CHCA 2KWNA 1MBMA 5TABA 4WA6A 2YREA 3ZNIA 2QIZA 3M62A 5TBNA 1ZBDB 2KWKA 3O47A 2QICA 3NG2A 2CSYA 2YHOA 2C2VS 2MA6A 3ZPVE 3O70A 1WGMA 4AUQB 1WILA 4ZUXU 3PURA 2MKEA 4FK5A 5H1TA 2ECJA 1JOCA 1JM7A 3KQIA 4L58A 5G04B 2ZETC 3SOXA 2VNFA 4YADA 5FB1A 4OGEA 5SVIB 4YBSA 2G45A 5AIUA 1K2FA 5D1MB 5KH3A 2G6QA 3I2DA 4Z0OA 3SUBA 2E61A 3LVRE 4YBMA 4PPEA 2JUNA 2IQJA 5C13A 1G25A 2L80A 4N3WA 1VFYA 4AVXA 2E6RA 2RSDA 1F62A 4GB0A 2CSVA 2KWOA 2MD7B 5JG6A 2CRRA 4L7XA 4CA1A 4GNFA 2MNYA 1WESA 1WEWA 2YUCA 2EXUA 5LKTA 4F1PA 3LQHA 2MT5A 2VPDA 3U5MA 2KR4A 3VK6A 3HCUA 1V87A 2K17A 3U5NA 4NN2A 2CRWA 4R8PK 3T7LA 4YATA 3LVQE 2M85A 4A49A 5DKAA 1WFKA 4AYCB 3LRQA 2I50A 3DDTA 1Z60A 2JMDA 2YVRA 4IC3A 2CSZA 1HYJA 2Y43A 2G43A 4FJCA 3FJUB 2VPGA 2JMIA 4GNEA 5LKUA 4QF3A 1WIMA 1WEVA 2UZGA 3T6RA 2LGLA 2NAAA 2CT2A 2LXPC 3FL2A 2KIZA 5B78A 2YQLA 5B76A 2K4DA 2B0OE 5LCWB 5I3LA 4V3KC 3RTRB 4QQ4A 2HYED 3N9MA 4AP4A 4F52B 5C11A 2L43A 4XI1A 3KDEC 4O64A 2JM3A 1BORA 4Q6FA 4I7DA 1X4UA 4BHWA 2RI7A 2VP7A 4A4BA 3PLWA 2M13A 4AYCA 4PTBA 5H9MA 2KE1A 5FEYA 5KH9A 1X4IA 2DJAA 4UP0A 4CCGX 2YT5A 3ZTGA 2VJEA 5KH7A 3ASLA 1WEMA 5H1UA 2AN6A 2LQ6A 4O62A 3U5PA 4B86C 4LK9A 2Y1NA 2EGPA 2VPBA 1E4UA 1X4JA 2FUIA 2K16A 5TRBA 2CKLB 2YQMA 3JUEA 3M63A 4P5OB 2KU3A 2EA6A 2YYRA 3KV6A 3C6WA 2HDPA 3EB6A 3O35A 2XEUA 3QZVA 2XOYA 3N9PA 3RPGC 2JRJA 1U6GB 2KWJA 1T1HA 1LDJB 2KFTA 4C9ZA 2M3HA 2BAYA 2K1JA 4TKPB 4GNDA 4YABA 2F6JA 2LV9A 2YURA 4UP5A 2P57A 1MM2A 5K3QA 3L1XA 4H9DA 3HCTA 1LDKC 3N9OA 3DPLR 3FEHA 3HCSA 5SVIA 3FAOA 5G0FA 3LDYA 4S3OC 4LKAA 5B75A 2XOCA 4WZ2A 3LJUX 1WE9A 2H0DB 2VJFB 3O36A 2CKLA 2PNXA 4X3GA 4LJNA 3O33A 2JMJA 4MVTA 5J3XA 2KREA 2ECWA 4R7EA 4R2YA 4V3LC 2KYUA 3GV4A 2ECIA 4UI9B 3N9LA 3N9QA 3SHBA 3N9NA 4B7YC 1DCQA 3ZVZB 1VYXA 4FIPA 2QJ0A 1HYIA 2C2LA 3ZPV1 5LKXA 4I7CA 2L5UA 2M1RA 3PUQA 3Q1DA 1N87A 4MSXA 2YSMA 3V43A 2YHNA 2LAUA 4ZDTA 3T9KA 3H7HA 2MNZA 5TDWA 3M99A 5B79A 2LGVA 4WZ0A 2D8SA 1IYMA 1WEUA 2H0DA 2VJFA 3E2DA 3MDBC 3O34A 1MM3A 2DSMA 3FM8C 2FUUA 2VPEA 3O7AA 2D8UA 4A0CD 4BBQA 2YW8A 4Z0RA 2L0BA 3PHDA 4OGCA 4FO9A 5AITA 2DX8A 3ZYQA 3IHPA 2LGGA 1FP0A 5SVYA 5B77A 1WEOA 4LADB 1RMDA 1DVPA 3RPGB 1WEPA 3L11A 2L7PA 5B8DA 3U5OA 2IDAA 3L1ZB 3MHSA 3ZVYA 2EGMA 2MIQA 2LRIC 1FBVA 3LQIA 3SOUA 4I7BA 2ECVA 1WENA 2E6SA 4WZ3B 2F6NA 5G05B 2OWAA 2PUYA 3FANA 1VD4A 4GNGA 3C5KA 4QF2A 2KKYA 4LLBA 2CONA 2LXHC 2XOZA 4ZQLA 4S3OB 4IC2A 2ECNA 4A4CA 1WEEA 5TDRA 3LQJA 3KNVA 2MA5A 1XWHA 3M7KA 2ECTA 1Z2QA 2KGIA 2OXQC 2F42A 3DWDA 3MHHA 2FD4A 3KV5A 2KKXA 4YC9A 2XB1A 2YU4A 2YSJA 5SVXA 2MUMA
chains in the Genus database with same CATH topology
2LN0A 1Z6UA 3SOWA 2FSAA 5FB0A 3DQVR 1JM7B 2EODA 4W4UA 2L75A 3GL6A 3EB5A 2Y1MA 4YBTA 1WEQA 2MD8C 4N4FA 5D1LB 5EYAF 2LDRA 2VJEB 3O37A 5DINA 5LKZA 4YAXA 2M6MA 2ECGA 3HTKC 2LGKA 5FERA 5H1VA 2KGGA 5D1KB 1CHCA 2KWNA 5TABA 4WA6A 2YREA 3ZNIA 2QIZA 3M62A 5TBNA 1ZBDB 2KWKA 2QICA 3NG2A 2CSYA 2YHOA 2C2VS 2MA6A 3ZPVE 3O70A 1WGMA 4AUQB 1WILA 4ZUXU 3PURA 4FK5A 5H1TA 2ECJA 1JOCA 1JM7A 3KQIA 4L58A 5G04B 2ZETC 3SOXA 2VNFA 4YADA 5FB1A 4YBSA 2G45A 5AIUA 1K2FA 5D1MB 5KH3A 2G6QA 3I2DA 4YBMA 4PPEA 5C13A 1G25A 2L80A 4N3WA 1VFYA 4AVXA 2E6RA 2RSDA 1F62A 4GB0A 2KWOA 2MD7B 5JG6A 4L7XA 4CA1A 4GNFA 2MNYA 1WESA 1WEWA 2YUCA 5LKTA 3LQHA 2MT5A 2VPDA 3U5MA 2KR4A 3VK6A 3HCUA 1V87A 2K17A 3U5NA 4NN2A 4R8PK 3T7LA 4YATA 2M85A 4A49A 5DKAA 1WFKA 4AYCB 3LRQA 2I50A 1Z60A 2JMDA 4IC3A 2CSZA 1HYJA 2Y43A 2G43A 4FJCA 2VPGA 2JMIA 4GNEA 5LKUA 4QF3A 1WIMA 1WEVA 2UZGA 3T6RA 2LGLA 2NAAA 2CT2A 2LXPC 3FL2A 2KIZA 5B78A 2YQLA 5B76A 2K4DA 5LCWB 5I3LA 4V3KC 3RTRB 2HYED 3N9MA 4AP4A 4F52B 5C11A 2L43A 4XI1A 4O64A 1BORA 4Q6FA 4I7DA 1X4UA 4BHWA 2RI7A 2VP7A 4A4BA 4AYCA 4PTBA 5H9MA 2KE1A 5FEYA 5KH9A 1X4IA 4CCGX 4UP0A 2YT5A 3ZTGA 2VJEA 5KH7A 3ASLA 1WEMA 5H1UA 2AN6A 2LQ6A 3U5PA 4B86C 4LK9A 2Y1NA 2EGPA 2VPBA 1E4UA 1X4JA 2FUIA 2K16A 5TRBA 2CKLB 2YQMA 3M63A 4P5OB 2KU3A 2EA6A 2YYRA 3KV6A 3C6WA 2HDPA 3EB6A 3O35A 2XEUA 3QZVA 3N9PA 3RPGC 2JRJA 1U6GB 2KWJA 1T1HA 1LDJB 2KFTA 4C9ZA 2M3HA 2BAYA 2K1JA 4TKPB 4GNDA 4YABA 2F6JA 2LV9A 2YURA 4UP5A 1MM2A 3L1XA 3HCTA 1LDKC 3N9OA 3DPLR 3HCSA 5G0FA 4S3OC 4LKAA 5B75A 4WZ2A 1WE9A 2H0DB 2VJFB 3O36A 2CKLA 2PNXA 4X3GA 4LJNA 3O33A 2JMJA 4MVTA 5J3XA 2KREA 2ECWA 4R7EA 4R2YA 4V3LC 2KYUA 3GV4A 2ECIA 4UI9B 3N9LA 3N9QA 3SHBA 3N9NA 4B7YC 3ZVZB 1VYXA 4FIPA 2QJ0A 1HYIA 2C2LA 3ZPV1 5LKXA 4I7CA 2L5UA 2M1RA 3PUQA 1N87A 4MSXA 2YSMA 3V43A 2YHNA 4ZDTA 5TDWA 2MNZA 3M99A 5B79A 2LGVA 4WZ0A 2D8SA 1IYMA 1WEUA 2H0DA 2VJFA 3O34A 1MM3A 2FUUA 2VPEA 3O7AA 4A0CD 4BBQA 2YW8A 2L0BA 3PHDA 4FO9A 5AITA 2DX8A 3ZYQA 3IHPA 2LGGA 1FP0A 5B77A 1WEOA 4LADB 1RMDA 1DVPA 3RPGB 1WEPA 3L11A 5B8DA 3U5OA 2IDAA 3L1ZB 3MHSA 3ZVYA 2MIQA 2LRIC 1FBVA 3LQIA 3SOUA 4I7BA 2ECVA 1WENA 2E6SA 4WZ3B 2F6NA 5G05B 2PUYA 1VD4A 4GNGA 3C5KA 4QF2A 4LLBA 2LXHC 4ZQLA 4S3OB 4IC2A 2ECNA 4A4CA 1WEEA 5TDRA 3LQJA 3KNVA 2MA5A 1XWHA 2ECTA 1Z2QA 2KGIA 2OXQC 2F42A 3MHHA 3KV5A 4YC9A 2XB1A 2YU4A 2YSJA 2MUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LN0 A;  1Z6U A;  3SOW A;  2FSA A;  5FB0 A;  3DQV R;  1JM7 B;  2EOD A;  4W4U A;  2L75 A;  3GL6 A;  3EB5 A;  2Y1M A;  4YBT A;  1WEQ A;  2MD8 C;  4N4F A;  5D1L B;  5EYA F;  2LDR A;  2VJE B;  3O37 A;  5DIN A;  5LKZ A;  4YAX A;  2M6M A;  2ECG A;  3HTK C;  2LGK A;  5FER A;  5H1V A;  2KGG A;  5D1K B;  1CHC A;  2KWN A;  5TAB A;  4WA6 A;  2YRE A;  3ZNI A;  2QIZ A;  3M62 A;  5TBN A;  1ZBD B;  2KWK A;  2QIC A;  3NG2 A;  2CSY A;  2YHO A;  2C2V S;  2MA6 A;  3ZPV E;  3O70 A;  1WGM A;  4AUQ B;  1WIL A;  4ZUX U;  3PUR A;  4FK5 A;  5H1T A;  2ECJ A;  1JOC A;  1JM7 A;  3KQI A;  4L58 A;  5G04 B;  2ZET C;  3SOX A;  2VNF A;  4YAD A;  5FB1 A;  4YBS A;  2G45 A;  5AIU A;  1K2F A;  5D1M B;  5KH3 A;  2G6Q A;  3I2D A;  4YBM A;  4PPE A;  5C13 A;  1G25 A;  2L80 A;  4N3W A;  1VFY A;  4AVX A;  2E6R A;  2RSD A;  1F62 A;  4GB0 A;  2KWO A;  2MD7 B;  5JG6 A;  4L7X A;  4CA1 A;  4GNF A;  2MNY A;  1WES A;  1WEW A;  2YUC A;  5LKT A;  3LQH A;  2MT5 A;  2VPD A;  3U5M A;  2KR4 A;  3VK6 A;  3HCU A;  1V87 A;  2K17 A;  3U5N A;  4NN2 A;  4R8P K;  3T7L A;  4YAT A;  2M85 A;  4A49 A;  5DKA A;  1WFK A;  4AYC B;  3LRQ A;  2I50 A;  1Z60 A;  2JMD A;  4IC3 A;  2CSZ A;  1HYJ A;  2Y43 A;  2G43 A;  4FJC A;  2VPG A;  2JMI A;  4GNE A;  5LKU A;  4QF3 A;  1WIM A;  1WEV A;  2UZG A;  3T6R A;  2LGL A;  2NAA A;  2CT2 A;  2LXP C;  3FL2 A;  2KIZ A;  5B78 A;  2YQL A;  5B76 A;  2K4D A;  5LCW B;  5I3L A;  4V3K C;  3RTR B;  2HYE D;  3N9M A;  4AP4 A;  4F52 B;  5C11 A;  2L43 A;  4XI1 A;  4O64 A;  1BOR A;  4Q6F A;  4I7D A;  1X4U A;  4BHW A;  2RI7 A;  2VP7 A;  4A4B A;  4AYC A;  4PTB A;  5H9M A;  2KE1 A;  5FEY A;  5KH9 A;  1X4I A;  4CCG X;  4UP0 A;  2YT5 A;  3ZTG A;  2VJE A;  5KH7 A;  3ASL A;  1WEM A;  5H1U A;  2AN6 A;  2LQ6 A;  3U5P A;  4B86 C;  4LK9 A;  2Y1N A;  2EGP A;  2VPB A;  1E4U A;  1X4J A;  2FUI A;  2K16 A;  5TRB A;  2CKL B;  2YQM A;  3M63 A;  4P5O B;  2KU3 A;  2EA6 A;  2YYR A;  3KV6 A;  3C6W A;  2HDP A;  3EB6 A;  3O35 A;  2XEU A;  3QZV A;  3N9P A;  3RPG C;  2JRJ A;  1U6G B;  2KWJ A;  1T1H A;  1LDJ B;  2KFT A;  4C9Z A;  2M3H A;  2BAY A;  2K1J A;  4TKP B;  4GND A;  4YAB A;  2F6J A;  2LV9 A;  2YUR A;  4UP5 A;  1MM2 A;  3L1X A;  3HCT A;  1LDK C;  3N9O A;  3DPL R;  3HCS A;  5G0F A;  4S3O C;  4LKA A;  5B75 A;  4WZ2 A;  1WE9 A;  2H0D B;  2VJF B;  3O36 A;  2CKL A;  2PNX A;  4X3G A;  4LJN A;  3O33 A;  2JMJ A;  4MVT A;  5J3X A;  2KRE A;  2ECW A;  4R7E A;  4R2Y A;  4V3L C;  2KYU A;  3GV4 A;  2ECI A;  4UI9 B;  3N9L A;  3N9Q A;  3SHB A;  3N9N A;  4B7Y C;  3ZVZ B;  1VYX A;  4FIP A;  2QJ0 A;  1HYI A;  2C2L A;  3ZPV 1;  5LKX A;  4I7C A;  2L5U A;  2M1R A;  3PUQ A;  1N87 A;  4MSX A;  2YSM A;  3V43 A;  2YHN A;  4ZDT A;  5TDW A;  2MNZ A;  3M99 A;  5B79 A;  2LGV A;  4WZ0 A;  2D8S A;  1IYM A;  1WEU A;  2H0D A;  2VJF A;  3O34 A;  1MM3 A;  2FUU A;  2VPE A;  3O7A A;  4A0C D;  4BBQ A;  2YW8 A;  2L0B A;  3PHD A;  4FO9 A;  5AIT A;  2DX8 A;  3ZYQ A;  3IHP A;  2LGG A;  1FP0 A;  5B77 A;  1WEO A;  4LAD B;  1RMD A;  1DVP A;  3RPG B;  1WEP A;  3L11 A;  5B8D A;  3U5O A;  2IDA A;  3L1Z B;  3MHS A;  3ZVY A;  2MIQ A;  2LRI C;  1FBV A;  3LQI A;  3SOU A;  4I7B A;  2ECV A;  1WEN A;  2E6S A;  4WZ3 B;  2F6N A;  5G05 B;  2PUY A;  1VD4 A;  4GNG A;  3C5K A;  4QF2 A;  4LLB A;  2LXH C;  4ZQL A;  4S3O B;  4IC2 A;  2ECN A;  4A4C A;  1WEE A;  5TDR A;  3LQJ A;  3KNV A;  2MA5 A;  1XWH A;  2ECT A;  1Z2Q A;  2KGI A;  2OXQ C;  2F42 A;  3MHH A;  3KV5 A;  4YC9 A;  2XB1 A;  2YU4 A;  2YSJ A;  2MUM A; 
#chains in the Genus database with same CATH topology
 2LN0 A;  1Z6U A;  3SOW A;  2FSA A;  5FB0 A;  3DQV R;  1JM7 B;  2FFW A;  2EOD A;  4W4U A;  2XP0 A;  2L75 A;  3GL6 A;  3EB5 A;  2Y1M A;  4YBT A;  1WEQ A;  2MD8 C;  4N4F A;  5D1L B;  2LDR A;  2VJE B;  3O37 A;  5EYA F;  5DIN A;  5LKZ A;  4YAX A;  2M6M A;  2ECG A;  3HTK C;  2LGK A;  5FER A;  5H1V A;  2RR4 A;  2KGG A;  5D1K B;  1CHC A;  2KWN A;  1MBM A;  5TAB A;  4WA6 A;  2YRE A;  3ZNI A;  2QIZ A;  3M62 A;  5TBN A;  1ZBD B;  2KWK A;  3O47 A;  2QIC A;  3NG2 A;  2CSY A;  2YHO A;  2C2V S;  2MA6 A;  3ZPV E;  3O70 A;  1WGM A;  4AUQ B;  1WIL A;  4ZUX U;  3PUR A;  2MKE A;  4FK5 A;  5H1T A;  2ECJ A;  1JOC A;  1JM7 A;  3KQI A;  4L58 A;  5G04 B;  2ZET C;  3SOX A;  2VNF A;  4YAD A;  5FB1 A;  4OGE A;  5SVI B;  4YBS A;  2G45 A;  5AIU A;  1K2F A;  5D1M B;  5KH3 A;  2G6Q A;  3I2D A;  4Z0O A;  3SUB A;  2E61 A;  3LVR E;  4YBM A;  4PPE A;  2JUN A;  2IQJ A;  5C13 A;  1G25 A;  2L80 A;  4N3W A;  1VFY A;  4AVX A;  2E6R A;  2RSD A;  1F62 A;  4GB0 A;  2CSV A;  2KWO A;  2MD7 B;  5JG6 A;  2CRR A;  4L7X A;  4CA1 A;  4GNF A;  2MNY A;  1WES A;  1WEW A;  2YUC A;  2EXU A;  5LKT A;  4F1P A;  3LQH A;  2MT5 A;  2VPD A;  3U5M A;  2KR4 A;  3VK6 A;  3HCU A;  1V87 A;  2K17 A;  3U5N A;  4NN2 A;  2CRW A;  4R8P K;  3T7L A;  4YAT A;  3LVQ E;  2M85 A;  4A49 A;  5DKA A;  1WFK A;  4AYC B;  3LRQ A;  2I50 A;  3DDT A;  1Z60 A;  2JMD A;  2YVR A;  4IC3 A;  2CSZ A;  1HYJ A;  2Y43 A;  2G43 A;  4FJC A;  3FJU B;  2VPG A;  2JMI A;  4GNE A;  5LKU A;  4QF3 A;  1WIM A;  1WEV A;  2UZG A;  3T6R A;  2LGL A;  2NAA A;  2CT2 A;  2LXP C;  3FL2 A;  2KIZ A;  5B78 A;  2YQL A;  5B76 A;  2K4D A;  2B0O E;  5LCW B;  5I3L A;  4V3K C;  3RTR B;  4QQ4 A;  2HYE D;  3N9M A;  4AP4 A;  4F52 B;  5C11 A;  2L43 A;  4XI1 A;  3KDE C;  4O64 A;  2JM3 A;  1BOR A;  4Q6F A;  4I7D A;  1X4U A;  4BHW A;  2RI7 A;  2VP7 A;  4A4B A;  3PLW A;  2M13 A;  4AYC A;  4PTB A;  5H9M A;  2KE1 A;  5FEY A;  5KH9 A;  1X4I A;  2DJA A;  4UP0 A;  4CCG X;  2YT5 A;  3ZTG A;  2VJE A;  5KH7 A;  3ASL A;  1WEM A;  5H1U A;  2AN6 A;  2LQ6 A;  4O62 A;  3U5P A;  4B86 C;  4LK9 A;  2Y1N A;  2EGP A;  2VPB A;  1E4U A;  1X4J A;  2FUI A;  2K16 A;  5TRB A;  2CKL B;  2YQM A;  3JUE A;  3M63 A;  4P5O B;  2KU3 A;  2EA6 A;  2YYR A;  3KV6 A;  3C6W A;  2HDP A;  3EB6 A;  3O35 A;  2XEU A;  3QZV A;  2XOY A;  3N9P A;  3RPG C;  2JRJ A;  1U6G B;  2KWJ A;  1T1H A;  1LDJ B;  2KFT A;  4C9Z A;  2M3H A;  2BAY A;  2K1J A;  4TKP B;  4GND A;  4YAB A;  2F6J A;  2LV9 A;  2YUR A;  4UP5 A;  2P57 A;  1MM2 A;  5K3Q A;  3L1X A;  4H9D A;  3HCT A;  1LDK C;  3N9O A;  3DPL R;  3FEH A;  3HCS A;  5SVI A;  3FAO A;  5G0F A;  3LDY A;  4S3O C;  4LKA A;  5B75 A;  2XOC A;  4WZ2 A;  3LJU X;  1WE9 A;  2H0D B;  2VJF B;  3O36 A;  2CKL A;  2PNX A;  4X3G A;  4LJN A;  3O33 A;  2JMJ A;  4MVT A;  5J3X A;  2KRE A;  2ECW A;  4R7E A;  4R2Y A;  4V3L C;  2KYU A;  3GV4 A;  2ECI A;  4UI9 B;  3N9L A;  3N9Q A;  3SHB A;  3N9N A;  4B7Y C;  1DCQ A;  3ZVZ B;  1VYX A;  4FIP A;  2QJ0 A;  1HYI A;  2C2L A;  3ZPV 1;  5LKX A;  4I7C A;  2L5U A;  2M1R A;  3PUQ A;  3Q1D A;  1N87 A;  4MSX A;  2YSM A;  3V43 A;  2YHN A;  2LAU A;  4ZDT A;  3T9K A;  3H7H A;  2MNZ A;  5TDW A;  3M99 A;  5B79 A;  2LGV A;  4WZ0 A;  2D8S A;  1IYM A;  1WEU A;  2H0D A;  2VJF A;  3E2D A;  3MDB C;  3O34 A;  1MM3 A;  2DSM A;  3FM8 C;  2FUU A;  2VPE A;  3O7A A;  2D8U A;  4A0C D;  4BBQ A;  2YW8 A;  4Z0R A;  2L0B A;  3PHD A;  4OGC A;  4FO9 A;  5AIT A;  2DX8 A;  3ZYQ A;  3IHP A;  2LGG A;  1FP0 A;  5SVY A;  5B77 A;  1WEO A;  4LAD B;  1RMD A;  1DVP A;  3RPG B;  1WEP A;  3L11 A;  2L7P A;  5B8D A;  3U5O A;  2IDA A;  3L1Z B;  3MHS A;  3ZVY A;  2EGM A;  2MIQ A;  2LRI C;  1FBV A;  3LQI A;  3SOU A;  4I7B A;  2ECV A;  1WEN A;  2E6S A;  4WZ3 B;  2F6N A;  5G05 B;  2OWA A;  2PUY A;  3FAN A;  1VD4 A;  4GNG A;  3C5K A;  4QF2 A;  2KKY A;  4LLB A;  2CON A;  2LXH C;  2XOZ A;  4ZQL A;  4S3O B;  4IC2 A;  2ECN A;  4A4C A;  1WEE A;  5TDR A;  3LQJ A;  3KNV A;  2MA5 A;  1XWH A;  3M7K A;  2ECT A;  1Z2Q A;  2KGI A;  2OXQ C;  2F42 A;  3DWD A;  3MHH A;  2FD4 A;  3KV5 A;  2KKX A;  4YC9 A;  2XB1 A;  2YU4 A;  2YSJ A;  5SVX A;  2MUM A; 
#chains in the Genus database with same CATH homology
 2LN0 A;  1Z6U A;  3SOW A;  2FSA A;  5FB0 A;  3DQV R;  1JM7 B;  2EOD A;  4W4U A;  2L75 A;  3GL6 A;  3EB5 A;  2Y1M A;  4YBT A;  1WEQ A;  2MD8 C;  4N4F A;  5D1L B;  5EYA F;  2LDR A;  2VJE B;  3O37 A;  5DIN A;  5LKZ A;  4YAX A;  2M6M A;  2ECG A;  3HTK C;  2LGK A;  5FER A;  5H1V A;  2KGG A;  5D1K B;  1CHC A;  2KWN A;  5TAB A;  4WA6 A;  2YRE A;  3ZNI A;  2QIZ A;  3M62 A;  5TBN A;  1ZBD B;  2KWK A;  2QIC A;  3NG2 A;  2CSY A;  2YHO A;  2C2V S;  2MA6 A;  3ZPV E;  3O70 A;  1WGM A;  4AUQ B;  1WIL A;  4ZUX U;  3PUR A;  4FK5 A;  5H1T A;  2ECJ A;  1JOC A;  1JM7 A;  3KQI A;  4L58 A;  5G04 B;  2ZET C;  3SOX A;  2VNF A;  4YAD A;  5FB1 A;  4YBS A;  2G45 A;  5AIU A;  1K2F A;  5D1M B;  5KH3 A;  2G6Q A;  3I2D A;  4YBM A;  4PPE A;  5C13 A;  1G25 A;  2L80 A;  4N3W A;  1VFY A;  4AVX A;  2E6R A;  2RSD A;  1F62 A;  4GB0 A;  2KWO A;  2MD7 B;  5JG6 A;  4L7X A;  4CA1 A;  4GNF A;  2MNY A;  1WES A;  1WEW A;  2YUC A;  5LKT A;  3LQH A;  2MT5 A;  2VPD A;  3U5M A;  2KR4 A;  3VK6 A;  3HCU A;  1V87 A;  2K17 A;  3U5N A;  4NN2 A;  4R8P K;  3T7L A;  4YAT A;  2M85 A;  4A49 A;  5DKA A;  1WFK A;  4AYC B;  3LRQ A;  2I50 A;  1Z60 A;  2JMD A;  4IC3 A;  2CSZ A;  1HYJ A;  2Y43 A;  2G43 A;  4FJC A;  2VPG A;  2JMI A;  4GNE A;  5LKU A;  4QF3 A;  1WIM A;  1WEV A;  2UZG A;  3T6R A;  2LGL A;  2NAA A;  2CT2 A;  2LXP C;  3FL2 A;  2KIZ A;  5B78 A;  2YQL A;  5B76 A;  2K4D A;  5LCW B;  5I3L A;  4V3K C;  3RTR B;  2HYE D;  3N9M A;  4AP4 A;  4F52 B;  5C11 A;  2L43 A;  4XI1 A;  4O64 A;  1BOR A;  4Q6F A;  4I7D A;  1X4U A;  4BHW A;  2RI7 A;  2VP7 A;  4A4B A;  4AYC A;  4PTB A;  5H9M A;  2KE1 A;  5FEY A;  5KH9 A;  1X4I A;  4CCG X;  4UP0 A;  2YT5 A;  3ZTG A;  2VJE A;  5KH7 A;  3ASL A;  1WEM A;  5H1U A;  2AN6 A;  2LQ6 A;  3U5P A;  4B86 C;  4LK9 A;  2Y1N A;  2EGP A;  2VPB A;  1E4U A;  1X4J A;  2FUI A;  2K16 A;  5TRB A;  2CKL B;  2YQM A;  3M63 A;  4P5O B;  2KU3 A;  2EA6 A;  2YYR A;  3KV6 A;  3C6W A;  2HDP A;  3EB6 A;  3O35 A;  2XEU A;  3QZV A;  3N9P A;  3RPG C;  2JRJ A;  1U6G B;  2KWJ A;  1T1H A;  1LDJ B;  2KFT A;  4C9Z A;  2M3H A;  2BAY A;  2K1J A;  4TKP B;  4GND A;  4YAB A;  2F6J A;  2LV9 A;  2YUR A;  4UP5 A;  1MM2 A;  3L1X A;  3HCT A;  1LDK C;  3N9O A;  3DPL R;  3HCS A;  5G0F A;  4S3O C;  4LKA A;  5B75 A;  4WZ2 A;  1WE9 A;  2H0D B;  2VJF B;  3O36 A;  2CKL A;  2PNX A;  4X3G A;  4LJN A;  3O33 A;  2JMJ A;  4MVT A;  5J3X A;  2KRE A;  2ECW A;  4R7E A;  4R2Y A;  4V3L C;  2KYU A;  3GV4 A;  2ECI A;  4UI9 B;  3N9L A;  3N9Q A;  3SHB A;  3N9N A;  4B7Y C;  3ZVZ B;  1VYX A;  4FIP A;  2QJ0 A;  1HYI A;  2C2L A;  3ZPV 1;  5LKX A;  4I7C A;  2L5U A;  2M1R A;  3PUQ A;  1N87 A;  4MSX A;  2YSM A;  3V43 A;  2YHN A;  4ZDT A;  5TDW A;  2MNZ A;  3M99 A;  5B79 A;  2LGV A;  4WZ0 A;  2D8S A;  1IYM A;  1WEU A;  2H0D A;  2VJF A;  3O34 A;  1MM3 A;  2FUU A;  2VPE A;  3O7A A;  4A0C D;  4BBQ A;  2YW8 A;  2L0B A;  3PHD A;  4FO9 A;  5AIT A;  2DX8 A;  3ZYQ A;  3IHP A;  2LGG A;  1FP0 A;  5B77 A;  1WEO A;  4LAD B;  1RMD A;  1DVP A;  3RPG B;  1WEP A;  3L11 A;  5B8D A;  3U5O A;  2IDA A;  3L1Z B;  3MHS A;  3ZVY A;  2MIQ A;  2LRI C;  1FBV A;  3LQI A;  3SOU A;  4I7B A;  2ECV A;  1WEN A;  2E6S A;  4WZ3 B;  2F6N A;  5G05 B;  2PUY A;  1VD4 A;  4GNG A;  3C5K A;  4QF2 A;  4LLB A;  2LXH C;  4ZQL A;  4S3O B;  4IC2 A;  2ECN A;  4A4C A;  1WEE A;  5TDR A;  3LQJ A;  3KNV A;  2MA5 A;  1XWH A;  2ECT A;  1Z2Q A;  2KGI A;  2OXQ C;  2F42 A;  3MHH A;  3KV5 A;  4YC9 A;  2XB1 A;  2YU4 A;  2YSJ A;  2MUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...