2YUCA

Solution structure of the traf-type zinc finger domains (102-164) from human tnf receptor associated factor 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
76
structure length
76
Chain Sequence
GSSGSSGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the TRAF-type zinc finger domains (102-164) from human TNF receptor associated factor 4
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords TNF receptor-associated factor 4
total genus 6
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02176 zf-TRAF TRAF-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yucA01
2C2VS 4GNDA 4NN2A 4ZQLA 2CT2A 5DINA 1IYMA 2VPGA 4N3WA 2L5UA 2YHNA 2YURA 2M6MA 3ASLA 4R8PK 1BORA 1F62A 1WEVA 4IC2A 2G43A 5B78A 4IC3A 4R7EA 2RSDA 3LQHA 3ZVYA 1LDKC 2XB1A 3ZTGA 5LKZA 4XI1A 1WILA 2MIQA 4YABA 2LXPC 3GV4A 2QJ0A 3PHDA 5AIUA 2VJEA 5KH9A 2BAYA 4P5OB 2NAAA 5B75A 4A0CD 4WZ0A 3V43A 2YYRA 3VK6A 2I50A 2KREA 4YC9A 2JMIA 2LGVA 4LADB 2IDAA 4CA1A 2VNFA 4S3OB 4UI9B 5C13A 4FK5A 1VD4A 3L1XA 3O34A 2RI7A 2FSAA 1XWHA 3SOWA 4TKPB 4WZ2A 3HCUA 1Z2QA 4GNGA 3I2DA 1WGMA 4X3GA 2CSZA 5B8DA 4L7XA 4MVTA 3MHSA 4PTBA 5LKTA 2Y1MA 5G04B 4I7BA 2YUCA 2G45A 3HCSA 2VPBA 4A4CA 1FP0A 4B7YC 2G6QA 5FB0A 5B77A 4F52B 5TDRA 1WFKA 3NG2A 3SOXA 2KE1A 1G25A 2VP7A 3IHPA 2KWJA 2EGPA 4LKAA 1WENA 1MM3A 1WEUA 2PNXA 2QICA 3O7AA 2C2LA 4B86C 4QF3A 4AYCA 3ZPVE 1LDJB 2YU4A 2K16A 2M3HA 2KWKA 5LKUA 2LQ6A 2MA5A 2UZGA 5G05B 2F6JA 4QF2A 5FERA 3RTRB 2L0BA 2ZETC 5D1MB 4A49A 1VFYA 2MNZA 4FO9A 3U5NA 3N9NA 1HYIA 2EA6A 2LGKA 5KH3A 3L11A 3QZVA 1WEMA 1WEQA 3M99A 3N9MA 4O64A 4ZDTA 4LLBA 2D8SA 3KQIA 2ECVA 4WZ3B 1X4UA 4YBTA 5TDWA 1WE9A 2ECIA 4I7CA 2EODA 2F42A 4UP5A 3LRQA 1WEOA 4AVXA 1VYXA 4FJCA 2YW8A 2H0DB 4AUQB 3N9LA 2LXHC 5FB1A 1WESA 3EB5A 4YAXA 1MM2A 4GNEA 3DQVR 3T6RA 2MD7B 5LCWB 2CKLA 3SHBA 2LGLA 2YT5A 3O70A 1ZBDB 2YSJA 3SOUA 5LKXA 4V3KC 2VJEB 4LK9A 5KH7A 4S3OC 2PUYA 4C9ZA 2L43A 2L80A 1Z6UA 4WA6A 2FUUA 3U5OA 2K4DA 2E6SA 3L1ZB 2L75A 2M85A 3HTKC 2HYED 4YATA 3U5MA 2JMJA 2KU3A 3DPLR 3ZVZB 2VJFB 3ZPV1 2OXQC 3KV6A 2JRJA 3LQJA 4YADA 2K1JA 3KNVA 5C11A 1E4UA 2Y1NA 4ZUXU 3PUQA 2MT5A 5EYAF 2H0DA 3RPGC 5B76A 4Q6FA 1JOCA 2LRIC 3PURA 2MNYA 1FBVA 2ECJA 5I3LA 3U5PA 2AN6A 2ECGA 5D1LB 2MUMA 2YREA 1WEPA 3KV5A 4YBMA 4V3LC 3M63A 4BHWA 2LV9A 4AYCB 2K17A 3O33A 3EB6A 4L58A 5H9MA 2CSYA 4A4BA 5FEYA 1WEWA 2ECWA 3N9PA 2KWNA 5J3XA 3GL6A 1V87A 2FUIA 2YHOA 3T7LA 1DVPA 4FIPA 3ZYQA 2MA6A 3HCTA 2LGGA 2HDPA 3M62A 5H1VA 3N9QA 5AITA 2XEUA 4MSXA 3RPGB 5H1UA 3O35A 2KR4A 4GB0A 2JMDA 3O37A 2Y43A 2DX8A 1HYJA 2KIZA 1N87A 2VPDA 2LN0A 4I7DA 3LQIA 5TRBA 1X4IA 2YQLA 2KYUA 3O36A 3C5KA 3ZNIA 1JM7A 5TBNA 2LDRA 4N4FA 3N9OA 2KFTA 2CKLB 4LJNA 2MD8C 5G0FA 4YBSA 4GNFA 5H1TA 2E6RA 1CHCA 3C6WA 3MHHA 2KGIA 2YQMA 1JM7B 2VJFA 1U6GB 2VPEA 2ECTA 2YSMA 1X4JA 2ECNA 1Z60A 1WIMA 4AP4A 4PPEA 4BBQA 5TABA 3FL2A 2KGGA 1WEEA 1T1HA 5D1KB 5DKAA 5JG6A 1RMDA 4UP0A 4R2YA 2QIZA 2M1RA 4W4UA 4CCGX 2KWOA 2F6NA 5B79A 1K2FA
chains in the Genus database with same CATH superfamily
2C2VS 4GNDA 4NN2A 2M13A 2CT2A 4ZQLA 2KKYA 5DINA 3O47A 4O62A 1IYMA 2VPGA 3FJUB 4N3WA 2L5UA 2YHNA 3PLWA 2YURA 2KKXA 2M6MA 3ASLA 4R8PK 1BORA 1F62A 3FANA 1WEVA 4IC2A 2G43A 5B78A 4IC3A 4R7EA 2RSDA 3LQHA 3ZVYA 1LDKC 2JM3A 2XB1A 3ZTGA 5LKZA 5K3QA 4XI1A 1WILA 3H7HA 3DWDA 2MIQA 4YABA 5SVYA 2LXPC 3GV4A 2EXUA 2QJ0A 3PHDA 5AIUA 2VJEA 5KH9A 2BAYA 4P5OB 2NAAA 5B75A 4A0CD 4WZ0A 3V43A 2YYRA 3VK6A 2I50A 2KREA 4YC9A 2JMIA 2LGVA 4LADB 2IDAA 4CA1A 2VNFA 4S3OB 4UI9B 5C13A 4FK5A 1VD4A 3L1XA 3O34A 2RI7A 2FSAA 1XWHA 3SOWA 2L7PA 4TKPB 4WZ2A 3HCUA 1Z2QA 4GNGA 3I2DA 1WGMA 4X3GA 2CSZA 5B8DA 4L7XA 4MVTA 3MHSA 4PTBA 5LKTA 2P57A 2Y1MA 5G04B 4I7BA 2YUCA 2G45A 3HCSA 2VPBA 4A4CA 1FP0A 4B7YC 2G6QA 5FB0A 5B77A 4QQ4A 4F52B 5TDRA 2CRWA 1WFKA 3NG2A 5SVXA 3SOXA 2KE1A 2XOYA 1G25A 2VP7A 3IHPA 3Q1DA 2KWJA 2EGPA 4LKAA 1WENA 1MM3A 1WEUA 2PNXA 2QICA 3O7AA 2C2LA 4B86C 4QF3A 4AYCA 3ZPVE 1LDJB 5SVIA 2YU4A 2K16A 2M3HA 2KWKA 1MBMA 5LKUA 2LQ6A 2MA5A 2UZGA 5G05B 2F6JA 4QF2A 5FERA 3RTRB 2L0BA 2D8UA 2ZETC 5D1MB 3DDTA 4A49A 1VFYA 2MNZA 4FO9A 3U5NA 3LDYA 3N9NA 3JUEA 1HYIA 2EA6A 2LGKA 5KH3A 3L11A 3QZVA 3M7KA 1WEMA 1WEQA 3M99A 2LAUA 3N9MA 4O64A 4ZDTA 4LLBA 2D8SA 3KQIA 4Z0RA 2ECVA 4WZ3B 1X4UA 4YBTA 5TDWA 3T9KA 1WE9A 2ECIA 4I7CA 2EODA 2F42A 2XOZA 4UP5A 3LRQA 1WEOA 4AVXA 1VYXA 4FJCA 2YW8A 2H0DB 4AUQB 2B0OE 3N9LA 2LXHC 5FB1A 1WESA 4OGCA 3LVRE 2OWAA 2IQJA 3EB5A 4YAXA 1MM2A 4GNEA 3FEHA 3FAOA 3DQVR 3T6RA 2MD7B 5LCWB 2CKLA 3SHBA 2LGLA 2YT5A 3O70A 1ZBDB 2YSJA 3SOUA 5LKXA 4V3KC 2VJEB 4H9DA 4LK9A 5KH7A 4S3OC 2PUYA 4C9ZA 2L43A 2L80A 1Z6UA 4WA6A 2FUUA 3U5OA 2K4DA 2E6SA 3L1ZB 2L75A 2M85A 3HTKC 2HYED 4YATA 3U5MA 2JMJA 2KU3A 3MDBC 3DPLR 3ZVZB 2VJFB 3ZPV1 2OXQC 2EGMA 3KV6A 2JRJA 3LQJA 3LVQE 4YADA 2K1JA 3KNVA 5C11A 1E4UA 2Y1NA 3FM8C 4OGEA 4ZUXU 3PUQA 2MT5A 5EYAF 2H0DA 3SUBA 2FFWA 3RPGC 5B76A 4Q6FA 1JOCA 2LRIC 3PURA 2MNYA 1FBVA 2ECJA 5I3LA 3U5PA 2AN6A 2ECGA 5D1LB 2MUMA 2YREA 1WEPA 3KV5A 2FD4A 4YBMA 4V3LC 3M63A 4BHWA 2LV9A 4AYCB 2K17A 3O33A 3EB6A 2CSVA 4L58A 5H9MA 4Z0OA 2CSYA 4A4BA 5FEYA 2YVRA 1WEWA 2ECWA 3N9PA 2KWNA 5J3XA 3GL6A 1V87A 2FUIA 2YHOA 3T7LA 3E2DA 1DVPA 4FIPA 3ZYQA 2DSMA 2MA6A 3HCTA 2LGGA 2HDPA 2RR4A 3M62A 5H1VA 3N9QA 5AITA 2XEUA 4MSXA 3RPGB 5H1UA 5SVIB 3O35A 2KR4A 3KDEC 4GB0A 2JMDA 1DCQA 3O37A 2Y43A 3LJUX 2DX8A 1HYJA 2KIZA 1N87A 2VPDA 2LN0A 4I7DA 3LQIA 5TRBA 1X4IA 2YQLA 2KYUA 3O36A 3C5KA 3ZNIA 1JM7A 5TBNA 2LDRA 4N4FA 3N9OA 2MKEA 2KFTA 2CKLB 4LJNA 2MD8C 5G0FA 4YBSA 4GNFA 5H1TA 2E6RA 2CRRA 1CHCA 3C6WA 3MHHA 4F1PA 2E61A 2KGIA 2YQMA 1JM7B 2VJFA 1U6GB 2DJAA 2VPEA 2ECTA 2YSMA 1X4JA 2ECNA 1Z60A 1WIMA 4AP4A 4PPEA 4BBQA 2JUNA 5TABA 3FL2A 2KGGA 2XP0A 1WEEA 1T1HA 5D1KB 2XOCA 5DKAA 5JG6A 1RMDA 4UP0A 4R2YA 2QIZA 2M1RA 2CONA 4W4UA 4CCGX 2KWOA 2F6NA 5B79A 1K2FA
chains in the Genus database with same CATH topology
2C2VS 4GNDA 4NN2A 4ZQLA 2CT2A 5DINA 1IYMA 2VPGA 4N3WA 2L5UA 2YHNA 2YURA 2M6MA 3ASLA 4R8PK 1BORA 1F62A 1WEVA 4IC2A 2G43A 5B78A 4IC3A 4R7EA 2RSDA 3LQHA 3ZVYA 1LDKC 2XB1A 3ZTGA 5LKZA 4XI1A 1WILA 2MIQA 4YABA 2LXPC 3GV4A 2QJ0A 3PHDA 5AIUA 2VJEA 5KH9A 2BAYA 4P5OB 2NAAA 5B75A 4A0CD 4WZ0A 3V43A 2YYRA 3VK6A 2I50A 2KREA 4YC9A 2JMIA 2LGVA 4LADB 2IDAA 4CA1A 2VNFA 4S3OB 4UI9B 5C13A 4FK5A 1VD4A 3L1XA 3O34A 2RI7A 2FSAA 1XWHA 3SOWA 4TKPB 4WZ2A 3HCUA 1Z2QA 4GNGA 3I2DA 1WGMA 4X3GA 2CSZA 5B8DA 4L7XA 4MVTA 3MHSA 4PTBA 5LKTA 2Y1MA 5G04B 4I7BA 2YUCA 2G45A 3HCSA 2VPBA 4A4CA 1FP0A 4B7YC 2G6QA 5FB0A 5B77A 4F52B 5TDRA 1WFKA 3NG2A 3SOXA 2KE1A 1G25A 2VP7A 3IHPA 2KWJA 2EGPA 4LKAA 1WENA 1MM3A 1WEUA 2PNXA 2QICA 3O7AA 2C2LA 4B86C 4QF3A 4AYCA 3ZPVE 1LDJB 2YU4A 2K16A 2M3HA 2KWKA 5LKUA 2LQ6A 2MA5A 2UZGA 5G05B 2F6JA 4QF2A 5FERA 3RTRB 2L0BA 2ZETC 5D1MB 4A49A 1VFYA 2MNZA 4FO9A 3U5NA 3N9NA 1HYIA 2EA6A 2LGKA 5KH3A 3L11A 3QZVA 1WEMA 1WEQA 3M99A 3N9MA 4O64A 4ZDTA 4LLBA 2D8SA 3KQIA 2ECVA 4WZ3B 1X4UA 4YBTA 5TDWA 1WE9A 2ECIA 4I7CA 2EODA 2F42A 4UP5A 3LRQA 1WEOA 4AVXA 1VYXA 4FJCA 2YW8A 2H0DB 4AUQB 3N9LA 2LXHC 5FB1A 1WESA 3EB5A 4YAXA 1MM2A 4GNEA 3DQVR 3T6RA 2MD7B 5LCWB 2CKLA 3SHBA 2LGLA 2YT5A 3O70A 1ZBDB 2YSJA 3SOUA 5LKXA 4V3KC 2VJEB 4LK9A 5KH7A 4S3OC 2PUYA 4C9ZA 2L43A 2L80A 1Z6UA 4WA6A 2FUUA 3U5OA 2K4DA 2E6SA 3L1ZB 2L75A 2M85A 3HTKC 2HYED 4YATA 3U5MA 2JMJA 2KU3A 3DPLR 3ZVZB 2VJFB 3ZPV1 2OXQC 3KV6A 2JRJA 3LQJA 4YADA 2K1JA 3KNVA 5C11A 1E4UA 2Y1NA 4ZUXU 3PUQA 2MT5A 5EYAF 2H0DA 3RPGC 5B76A 4Q6FA 1JOCA 2LRIC 3PURA 2MNYA 1FBVA 2ECJA 5I3LA 3U5PA 2AN6A 2ECGA 5D1LB 2MUMA 2YREA 1WEPA 3KV5A 4YBMA 4V3LC 3M63A 4BHWA 2LV9A 4AYCB 2K17A 3O33A 3EB6A 4L58A 5H9MA 2CSYA 4A4BA 5FEYA 1WEWA 2ECWA 3N9PA 2KWNA 5J3XA 3GL6A 1V87A 2FUIA 2YHOA 3T7LA 1DVPA 4FIPA 3ZYQA 2MA6A 3HCTA 2LGGA 2HDPA 3M62A 5H1VA 3N9QA 5AITA 2XEUA 4MSXA 3RPGB 5H1UA 3O35A 2KR4A 4GB0A 2JMDA 3O37A 2Y43A 2DX8A 1HYJA 2KIZA 1N87A 2VPDA 2LN0A 4I7DA 3LQIA 5TRBA 1X4IA 2YQLA 2KYUA 3O36A 3C5KA 3ZNIA 1JM7A 5TBNA 2LDRA 4N4FA 3N9OA 2KFTA 2CKLB 4LJNA 2MD8C 5G0FA 4YBSA 4GNFA 5H1TA 2E6RA 1CHCA 3C6WA 3MHHA 2KGIA 2YQMA 1JM7B 2VJFA 1U6GB 2VPEA 2ECTA 2YSMA 1X4JA 2ECNA 1Z60A 1WIMA 4AP4A 4PPEA 4BBQA 5TABA 3FL2A 2KGGA 1WEEA 1T1HA 5D1KB 5DKAA 5JG6A 1RMDA 4UP0A 4R2YA 2QIZA 2M1RA 4W4UA 4CCGX 2KWOA 2F6NA 5B79A 1K2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2V S;  4GND A;  4NN2 A;  4ZQL A;  2CT2 A;  5DIN A;  1IYM A;  2VPG A;  4N3W A;  2L5U A;  2YHN A;  2YUR A;  2M6M A;  3ASL A;  4R8P K;  1BOR A;  1F62 A;  1WEV A;  4IC2 A;  2G43 A;  5B78 A;  4IC3 A;  4R7E A;  2RSD A;  3LQH A;  3ZVY A;  1LDK C;  2XB1 A;  3ZTG A;  5LKZ A;  4XI1 A;  1WIL A;  2MIQ A;  4YAB A;  2LXP C;  3GV4 A;  2QJ0 A;  3PHD A;  5AIU A;  2VJE A;  5KH9 A;  2BAY A;  4P5O B;  2NAA A;  5B75 A;  4A0C D;  4WZ0 A;  3V43 A;  2YYR A;  3VK6 A;  2I50 A;  2KRE A;  4YC9 A;  2JMI A;  2LGV A;  4LAD B;  2IDA A;  4CA1 A;  2VNF A;  4S3O B;  4UI9 B;  5C13 A;  4FK5 A;  1VD4 A;  3L1X A;  3O34 A;  2RI7 A;  2FSA A;  1XWH A;  3SOW A;  4TKP B;  4WZ2 A;  3HCU A;  1Z2Q A;  4GNG A;  3I2D A;  1WGM A;  4X3G A;  2CSZ A;  5B8D A;  4L7X A;  4MVT A;  3MHS A;  4PTB A;  5LKT A;  2Y1M A;  5G04 B;  4I7B A;  2YUC A;  2G45 A;  3HCS A;  2VPB A;  4A4C A;  1FP0 A;  4B7Y C;  2G6Q A;  5FB0 A;  5B77 A;  4F52 B;  5TDR A;  1WFK A;  3NG2 A;  3SOX A;  2KE1 A;  1G25 A;  2VP7 A;  3IHP A;  2KWJ A;  2EGP A;  4LKA A;  1WEN A;  1MM3 A;  1WEU A;  2PNX A;  2QIC A;  3O7A A;  2C2L A;  4B86 C;  4QF3 A;  4AYC A;  3ZPV E;  1LDJ B;  2YU4 A;  2K16 A;  2M3H A;  2KWK A;  5LKU A;  2LQ6 A;  2MA5 A;  2UZG A;  5G05 B;  2F6J A;  4QF2 A;  5FER A;  3RTR B;  2L0B A;  2ZET C;  5D1M B;  4A49 A;  1VFY A;  2MNZ A;  4FO9 A;  3U5N A;  3N9N A;  1HYI A;  2EA6 A;  2LGK A;  5KH3 A;  3L11 A;  3QZV A;  1WEM A;  1WEQ A;  3M99 A;  3N9M A;  4O64 A;  4ZDT A;  4LLB A;  2D8S A;  3KQI A;  2ECV A;  4WZ3 B;  1X4U A;  4YBT A;  5TDW A;  1WE9 A;  2ECI A;  4I7C A;  2EOD A;  2F42 A;  4UP5 A;  3LRQ A;  1WEO A;  4AVX A;  1VYX A;  4FJC A;  2YW8 A;  2H0D B;  4AUQ B;  3N9L A;  2LXH C;  5FB1 A;  1WES A;  3EB5 A;  4YAX A;  1MM2 A;  4GNE A;  3DQV R;  3T6R A;  2MD7 B;  5LCW B;  2CKL A;  3SHB A;  2LGL A;  2YT5 A;  3O70 A;  1ZBD B;  2YSJ A;  3SOU A;  5LKX A;  4V3K C;  2VJE B;  4LK9 A;  5KH7 A;  4S3O C;  2PUY A;  4C9Z A;  2L43 A;  2L80 A;  1Z6U A;  4WA6 A;  2FUU A;  3U5O A;  2K4D A;  2E6S A;  3L1Z B;  2L75 A;  2M85 A;  3HTK C;  2HYE D;  4YAT A;  3U5M A;  2JMJ A;  2KU3 A;  3DPL R;  3ZVZ B;  2VJF B;  3ZPV 1;  2OXQ C;  3KV6 A;  2JRJ A;  3LQJ A;  4YAD A;  2K1J A;  3KNV A;  5C11 A;  1E4U A;  2Y1N A;  4ZUX U;  3PUQ A;  2MT5 A;  5EYA F;  2H0D A;  3RPG C;  5B76 A;  4Q6F A;  1JOC A;  2LRI C;  3PUR A;  2MNY A;  1FBV A;  2ECJ A;  5I3L A;  3U5P A;  2AN6 A;  2ECG A;  5D1L B;  2MUM A;  2YRE A;  1WEP A;  3KV5 A;  4YBM A;  4V3L C;  3M63 A;  4BHW A;  2LV9 A;  4AYC B;  2K17 A;  3O33 A;  3EB6 A;  4L58 A;  5H9M A;  2CSY A;  4A4B A;  5FEY A;  1WEW A;  2ECW A;  3N9P A;  2KWN A;  5J3X A;  3GL6 A;  1V87 A;  2FUI A;  2YHO A;  3T7L A;  1DVP A;  4FIP A;  3ZYQ A;  2MA6 A;  3HCT A;  2LGG A;  2HDP A;  3M62 A;  5H1V A;  3N9Q A;  5AIT A;  2XEU A;  4MSX A;  3RPG B;  5H1U A;  3O35 A;  2KR4 A;  4GB0 A;  2JMD A;  3O37 A;  2Y43 A;  2DX8 A;  1HYJ A;  2KIZ A;  1N87 A;  2VPD A;  2LN0 A;  4I7D A;  3LQI A;  5TRB A;  1X4I A;  2YQL A;  2KYU A;  3O36 A;  3C5K A;  3ZNI A;  1JM7 A;  5TBN A;  2LDR A;  4N4F A;  3N9O A;  2KFT A;  2CKL B;  4LJN A;  2MD8 C;  5G0F A;  4YBS A;  4GNF A;  5H1T A;  2E6R A;  1CHC A;  3C6W A;  3MHH A;  2KGI A;  2YQM A;  1JM7 B;  2VJF A;  1U6G B;  2VPE A;  2ECT A;  2YSM A;  1X4J A;  2ECN A;  1Z60 A;  1WIM A;  4AP4 A;  4PPE A;  4BBQ A;  5TAB A;  3FL2 A;  2KGG A;  1WEE A;  1T1H A;  5D1K B;  5DKA A;  5JG6 A;  1RMD A;  4UP0 A;  4R2Y A;  2QIZ A;  2M1R A;  4W4U A;  4CCG X;  2KWO A;  2F6N A;  5B79 A;  1K2F A; 
#chains in the Genus database with same CATH topology
 2C2V S;  4GND A;  4NN2 A;  2M13 A;  2CT2 A;  4ZQL A;  2KKY A;  5DIN A;  3O47 A;  4O62 A;  1IYM A;  2VPG A;  3FJU B;  4N3W A;  2L5U A;  2YHN A;  3PLW A;  2YUR A;  2KKX A;  2M6M A;  3ASL A;  4R8P K;  1BOR A;  1F62 A;  3FAN A;  1WEV A;  4IC2 A;  2G43 A;  5B78 A;  4IC3 A;  4R7E A;  2RSD A;  3LQH A;  3ZVY A;  1LDK C;  2JM3 A;  2XB1 A;  3ZTG A;  5LKZ A;  5K3Q A;  4XI1 A;  1WIL A;  3H7H A;  3DWD A;  2MIQ A;  4YAB A;  5SVY A;  2LXP C;  3GV4 A;  2EXU A;  2QJ0 A;  3PHD A;  5AIU A;  2VJE A;  5KH9 A;  2BAY A;  4P5O B;  2NAA A;  5B75 A;  4A0C D;  4WZ0 A;  3V43 A;  2YYR A;  3VK6 A;  2I50 A;  2KRE A;  4YC9 A;  2JMI A;  2LGV A;  4LAD B;  2IDA A;  4CA1 A;  2VNF A;  4S3O B;  4UI9 B;  5C13 A;  4FK5 A;  1VD4 A;  3L1X A;  3O34 A;  2RI7 A;  2FSA A;  1XWH A;  3SOW A;  2L7P A;  4TKP B;  4WZ2 A;  3HCU A;  1Z2Q A;  4GNG A;  3I2D A;  1WGM A;  4X3G A;  2CSZ A;  5B8D A;  4L7X A;  4MVT A;  3MHS A;  4PTB A;  5LKT A;  2P57 A;  2Y1M A;  5G04 B;  4I7B A;  2YUC A;  2G45 A;  3HCS A;  2VPB A;  4A4C A;  1FP0 A;  4B7Y C;  2G6Q A;  5FB0 A;  5B77 A;  4QQ4 A;  4F52 B;  5TDR A;  2CRW A;  1WFK A;  3NG2 A;  5SVX A;  3SOX A;  2KE1 A;  2XOY A;  1G25 A;  2VP7 A;  3IHP A;  3Q1D A;  2KWJ A;  2EGP A;  4LKA A;  1WEN A;  1MM3 A;  1WEU A;  2PNX A;  2QIC A;  3O7A A;  2C2L A;  4B86 C;  4QF3 A;  4AYC A;  3ZPV E;  1LDJ B;  5SVI A;  2YU4 A;  2K16 A;  2M3H A;  2KWK A;  1MBM A;  5LKU A;  2LQ6 A;  2MA5 A;  2UZG A;  5G05 B;  2F6J A;  4QF2 A;  5FER A;  3RTR B;  2L0B A;  2D8U A;  2ZET C;  5D1M B;  3DDT A;  4A49 A;  1VFY A;  2MNZ A;  4FO9 A;  3U5N A;  3LDY A;  3N9N A;  3JUE A;  1HYI A;  2EA6 A;  2LGK A;  5KH3 A;  3L11 A;  3QZV A;  3M7K A;  1WEM A;  1WEQ A;  3M99 A;  2LAU A;  3N9M A;  4O64 A;  4ZDT A;  4LLB A;  2D8S A;  3KQI A;  4Z0R A;  2ECV A;  4WZ3 B;  1X4U A;  4YBT A;  5TDW A;  3T9K A;  1WE9 A;  2ECI A;  4I7C A;  2EOD A;  2F42 A;  2XOZ A;  4UP5 A;  3LRQ A;  1WEO A;  4AVX A;  1VYX A;  4FJC A;  2YW8 A;  2H0D B;  4AUQ B;  2B0O E;  3N9L A;  2LXH C;  5FB1 A;  1WES A;  4OGC A;  3LVR E;  2OWA A;  2IQJ A;  3EB5 A;  4YAX A;  1MM2 A;  4GNE A;  3FEH A;  3FAO A;  3DQV R;  3T6R A;  2MD7 B;  5LCW B;  2CKL A;  3SHB A;  2LGL A;  2YT5 A;  3O70 A;  1ZBD B;  2YSJ A;  3SOU A;  5LKX A;  4V3K C;  2VJE B;  4H9D A;  4LK9 A;  5KH7 A;  4S3O C;  2PUY A;  4C9Z A;  2L43 A;  2L80 A;  1Z6U A;  4WA6 A;  2FUU A;  3U5O A;  2K4D A;  2E6S A;  3L1Z B;  2L75 A;  2M85 A;  3HTK C;  2HYE D;  4YAT A;  3U5M A;  2JMJ A;  2KU3 A;  3MDB C;  3DPL R;  3ZVZ B;  2VJF B;  3ZPV 1;  2OXQ C;  2EGM A;  3KV6 A;  2JRJ A;  3LQJ A;  3LVQ E;  4YAD A;  2K1J A;  3KNV A;  5C11 A;  1E4U A;  2Y1N A;  3FM8 C;  4OGE A;  4ZUX U;  3PUQ A;  2MT5 A;  5EYA F;  2H0D A;  3SUB A;  2FFW A;  3RPG C;  5B76 A;  4Q6F A;  1JOC A;  2LRI C;  3PUR A;  2MNY A;  1FBV A;  2ECJ A;  5I3L A;  3U5P A;  2AN6 A;  2ECG A;  5D1L B;  2MUM A;  2YRE A;  1WEP A;  3KV5 A;  2FD4 A;  4YBM A;  4V3L C;  3M63 A;  4BHW A;  2LV9 A;  4AYC B;  2K17 A;  3O33 A;  3EB6 A;  2CSV A;  4L58 A;  5H9M A;  4Z0O A;  2CSY A;  4A4B A;  5FEY A;  2YVR A;  1WEW A;  2ECW A;  3N9P A;  2KWN A;  5J3X A;  3GL6 A;  1V87 A;  2FUI A;  2YHO A;  3T7L A;  3E2D A;  1DVP A;  4FIP A;  3ZYQ A;  2DSM A;  2MA6 A;  3HCT A;  2LGG A;  2HDP A;  2RR4 A;  3M62 A;  5H1V A;  3N9Q A;  5AIT A;  2XEU A;  4MSX A;  3RPG B;  5H1U A;  5SVI B;  3O35 A;  2KR4 A;  3KDE C;  4GB0 A;  2JMD A;  1DCQ A;  3O37 A;  2Y43 A;  3LJU X;  2DX8 A;  1HYJ A;  2KIZ A;  1N87 A;  2VPD A;  2LN0 A;  4I7D A;  3LQI A;  5TRB A;  1X4I A;  2YQL A;  2KYU A;  3O36 A;  3C5K A;  3ZNI A;  1JM7 A;  5TBN A;  2LDR A;  4N4F A;  3N9O A;  2MKE A;  2KFT A;  2CKL B;  4LJN A;  2MD8 C;  5G0F A;  4YBS A;  4GNF A;  5H1T A;  2E6R A;  2CRR A;  1CHC A;  3C6W A;  3MHH A;  4F1P A;  2E61 A;  2KGI A;  2YQM A;  1JM7 B;  2VJF A;  1U6G B;  2DJA A;  2VPE A;  2ECT A;  2YSM A;  1X4J A;  2ECN A;  1Z60 A;  1WIM A;  4AP4 A;  4PPE A;  4BBQ A;  2JUN A;  5TAB A;  3FL2 A;  2KGG A;  2XP0 A;  1WEE A;  1T1H A;  5D1K B;  2XOC A;  5DKA A;  5JG6 A;  1RMD A;  4UP0 A;  4R2Y A;  2QIZ A;  2M1R A;  2CON A;  4W4U A;  4CCG X;  2KWO A;  2F6N A;  5B79 A;  1K2F A; 
#chains in the Genus database with same CATH homology
 2C2V S;  4GND A;  4NN2 A;  4ZQL A;  2CT2 A;  5DIN A;  1IYM A;  2VPG A;  4N3W A;  2L5U A;  2YHN A;  2YUR A;  2M6M A;  3ASL A;  4R8P K;  1BOR A;  1F62 A;  1WEV A;  4IC2 A;  2G43 A;  5B78 A;  4IC3 A;  4R7E A;  2RSD A;  3LQH A;  3ZVY A;  1LDK C;  2XB1 A;  3ZTG A;  5LKZ A;  4XI1 A;  1WIL A;  2MIQ A;  4YAB A;  2LXP C;  3GV4 A;  2QJ0 A;  3PHD A;  5AIU A;  2VJE A;  5KH9 A;  2BAY A;  4P5O B;  2NAA A;  5B75 A;  4A0C D;  4WZ0 A;  3V43 A;  2YYR A;  3VK6 A;  2I50 A;  2KRE A;  4YC9 A;  2JMI A;  2LGV A;  4LAD B;  2IDA A;  4CA1 A;  2VNF A;  4S3O B;  4UI9 B;  5C13 A;  4FK5 A;  1VD4 A;  3L1X A;  3O34 A;  2RI7 A;  2FSA A;  1XWH A;  3SOW A;  4TKP B;  4WZ2 A;  3HCU A;  1Z2Q A;  4GNG A;  3I2D A;  1WGM A;  4X3G A;  2CSZ A;  5B8D A;  4L7X A;  4MVT A;  3MHS A;  4PTB A;  5LKT A;  2Y1M A;  5G04 B;  4I7B A;  2YUC A;  2G45 A;  3HCS A;  2VPB A;  4A4C A;  1FP0 A;  4B7Y C;  2G6Q A;  5FB0 A;  5B77 A;  4F52 B;  5TDR A;  1WFK A;  3NG2 A;  3SOX A;  2KE1 A;  1G25 A;  2VP7 A;  3IHP A;  2KWJ A;  2EGP A;  4LKA A;  1WEN A;  1MM3 A;  1WEU A;  2PNX A;  2QIC A;  3O7A A;  2C2L A;  4B86 C;  4QF3 A;  4AYC A;  3ZPV E;  1LDJ B;  2YU4 A;  2K16 A;  2M3H A;  2KWK A;  5LKU A;  2LQ6 A;  2MA5 A;  2UZG A;  5G05 B;  2F6J A;  4QF2 A;  5FER A;  3RTR B;  2L0B A;  2ZET C;  5D1M B;  4A49 A;  1VFY A;  2MNZ A;  4FO9 A;  3U5N A;  3N9N A;  1HYI A;  2EA6 A;  2LGK A;  5KH3 A;  3L11 A;  3QZV A;  1WEM A;  1WEQ A;  3M99 A;  3N9M A;  4O64 A;  4ZDT A;  4LLB A;  2D8S A;  3KQI A;  2ECV A;  4WZ3 B;  1X4U A;  4YBT A;  5TDW A;  1WE9 A;  2ECI A;  4I7C A;  2EOD A;  2F42 A;  4UP5 A;  3LRQ A;  1WEO A;  4AVX A;  1VYX A;  4FJC A;  2YW8 A;  2H0D B;  4AUQ B;  3N9L A;  2LXH C;  5FB1 A;  1WES A;  3EB5 A;  4YAX A;  1MM2 A;  4GNE A;  3DQV R;  3T6R A;  2MD7 B;  5LCW B;  2CKL A;  3SHB A;  2LGL A;  2YT5 A;  3O70 A;  1ZBD B;  2YSJ A;  3SOU A;  5LKX A;  4V3K C;  2VJE B;  4LK9 A;  5KH7 A;  4S3O C;  2PUY A;  4C9Z A;  2L43 A;  2L80 A;  1Z6U A;  4WA6 A;  2FUU A;  3U5O A;  2K4D A;  2E6S A;  3L1Z B;  2L75 A;  2M85 A;  3HTK C;  2HYE D;  4YAT A;  3U5M A;  2JMJ A;  2KU3 A;  3DPL R;  3ZVZ B;  2VJF B;  3ZPV 1;  2OXQ C;  3KV6 A;  2JRJ A;  3LQJ A;  4YAD A;  2K1J A;  3KNV A;  5C11 A;  1E4U A;  2Y1N A;  4ZUX U;  3PUQ A;  2MT5 A;  5EYA F;  2H0D A;  3RPG C;  5B76 A;  4Q6F A;  1JOC A;  2LRI C;  3PUR A;  2MNY A;  1FBV A;  2ECJ A;  5I3L A;  3U5P A;  2AN6 A;  2ECG A;  5D1L B;  2MUM A;  2YRE A;  1WEP A;  3KV5 A;  4YBM A;  4V3L C;  3M63 A;  4BHW A;  2LV9 A;  4AYC B;  2K17 A;  3O33 A;  3EB6 A;  4L58 A;  5H9M A;  2CSY A;  4A4B A;  5FEY A;  1WEW A;  2ECW A;  3N9P A;  2KWN A;  5J3X A;  3GL6 A;  1V87 A;  2FUI A;  2YHO A;  3T7L A;  1DVP A;  4FIP A;  3ZYQ A;  2MA6 A;  3HCT A;  2LGG A;  2HDP A;  3M62 A;  5H1V A;  3N9Q A;  5AIT A;  2XEU A;  4MSX A;  3RPG B;  5H1U A;  3O35 A;  2KR4 A;  4GB0 A;  2JMD A;  3O37 A;  2Y43 A;  2DX8 A;  1HYJ A;  2KIZ A;  1N87 A;  2VPD A;  2LN0 A;  4I7D A;  3LQI A;  5TRB A;  1X4I A;  2YQL A;  2KYU A;  3O36 A;  3C5K A;  3ZNI A;  1JM7 A;  5TBN A;  2LDR A;  4N4F A;  3N9O A;  2KFT A;  2CKL B;  4LJN A;  2MD8 C;  5G0F A;  4YBS A;  4GNF A;  5H1T A;  2E6R A;  1CHC A;  3C6W A;  3MHH A;  2KGI A;  2YQM A;  1JM7 B;  2VJF A;  1U6G B;  2VPE A;  2ECT A;  2YSM A;  1X4J A;  2ECN A;  1Z60 A;  1WIM A;  4AP4 A;  4PPE A;  4BBQ A;  5TAB A;  3FL2 A;  2KGG A;  1WEE A;  1T1H A;  5D1K B;  5DKA A;  5JG6 A;  1RMD A;  4UP0 A;  4R2Y A;  2QIZ A;  2M1R A;  4W4U A;  4CCG X;  2KWO A;  2F6N A;  5B79 A;  1K2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...