2YUCA

Solution structure of the traf-type zinc finger domains (102-164) from human tnf receptor associated factor 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
76
structure length
76
Chain Sequence
GSSGSSGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNF receptor-associated factor 4
publication title Solution structure of the TRAF-type zinc finger domains (102-164) from human TNF receptor associated factor 4
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02176 zf-TRAF TRAF-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yucA01
1WFKA 4Q6FA 5DKAA 2ECIA 4CCGX 4FIPA 3T6RA 2LV9A 2VNFA 2MNZA 1WILA 2ZETC 5H1VA 4R2YA 3ZTGA 4R7EA 2YSMA 2L75A 1FP0A 2K17A 4ZQLA 2E6RA 3HCSA 2MA6A 2L43A 1HYIA 2LN0A 2M1RA 3O7AA 1FBVA 3LQJA 5JG6A 5AIUA 2G45A 3N9PA 5D1LB 4L7XA 3ZNIA 1ZBDB 4V3KC 2PUYA 3PUQA 3GV4A 2M6MA 4I7BA 1WEWA 5G04B 2KYUA 2VPBA 5B78A 2KR4A 2VP7A 3C5KA 4IC3A 2M85A 4R8PK 2C2LA 3ZPV1 4YATA 2HYED 2VJFB 2ECWA 3LRQA 2LGKA 2YQLA 5TABA 2RI7A 4CA1A 2MT5A 4X3GA 3U5NA 5KH9A 2JMDA 2KFTA 2JMIA 3O33A 2OXQC 5TBNA 1MM2A 1X4IA 3DPLR 4LKAA 2CKLA 1V87A 3O36A 1VFYA 1N87A 4AYCA 5B77A 3KQIA 5J3XA 1XWHA 5DINA 1LDJB 2EA6A 2CKLB 4A0CD 4AYCB 2CSZA 1X4UA 1HYJA 3N9LA 5EYAF 2LRIC 5H9MA 2QJ0A 2L5UA 3HTKC 5D1KB 4W4UA 5LKUA 4B86C 2H0DA 4UI9B 4ZUXU 5TDRA 2Y1MA 2KE1A 4S3OC 2D8SA 2I50A 4A4CA 3FL2A 2C2VS 1G25A 2H0DB 2QICA 2MUMA 2L0BA 3ZVYA 4YADA 3HCUA 1Z60A 4O64A 4C9ZA 1U6GB 1BORA 1K2FA 2YURA 3U5PA 4LADB 5G05B 1WENA 5H1TA 2KGIA 5FB1A 1WEOA 5LCWB 3HCTA 2ECGA 5C13A 2ECJA 1VYXA 2YU4A 2MA5A 2YW8A 5KH3A 3MHHA 4WZ0A 2ECTA 1DVPA 2BAYA 2F6NA 3N9NA 5FERA 2VJFA 2F42A 4GB0A 3QZVA 4MVTA 1LDKC 1WE9A 1T1HA 3N9OA 2G43A 4YBSA 2L80A 4YBMA 3PHDA 4BBQA 3RPGC 2YHNA 3L11A 4PPEA 1JOCA 1WEPA 2YHOA 4FK5A 5LKTA 2LQ6A 2HDPA 2LGGA 1Z2QA 3KV6A 4BHWA 2M3HA 4FO9A 3NG2A 2LXPC 4AP4A 5FB0A 3M99A 4WZ3B 1WEEA 4AUQB 2K1JA 2KWOA 2LGVA 2VPEA 4L58A 3O35A 3SOWA 3T7LA 4I7CA 2QIZA 2KREA 2NAAA 4GNDA 3KV5A 1X4JA 3M63A 3LQHA 4XI1A 3SOXA 5B8DA 3RPGB 5KH7A 1WGMA 1WEMA 2YYRA 5I3LA 5AITA 1IYMA 2ECVA 3LQIA 4YBTA 1E4UA 3EB5A 4IC2A 4QF2A 1WIMA 3N9MA 2YREA 2JRJA 2LDRA 5H1UA 4AVXA 2F6JA 3ZVZB 4TKPB 1VD4A 2FSAA 5LKZA 4GNEA 2CT2A 2RSDA 4GNFA 4YAXA 2UZGA 2MIQA 4QF3A 5TRBA 2K4DA 3M62A 2JMJA 2AN6A 4UP5A 1Z6UA 2MNYA 2Y1NA 5FEYA 5G0FA 3ZPVE 4N3WA 3U5OA 4F52B 4LK9A 4YABA 1JM7A 3EB6A 4LLBA 4MSXA 2DX8A 2VPGA 3RTRB 1WEUA 1WEQA 2EGPA 5TDWA 4UP0A 2EODA 4A4BA 3SHBA 4WA6A 2KWKA 2MD8C 4WZ2A 2K16A 4S3OB 4A49A 1JM7B 3V43A 3GL6A 2KGGA 1RMDA 1WEVA 1WESA 2YQMA 3ASLA 3MHSA 4YC9A 5B75A 4V3LC 5D1MB 4ZDTA 3O34A 2FUIA 3N9QA 2KWJA 1F62A 3KNVA 2FUUA 4NN2A 2KU3A 3IHPA 2ECNA 2G6QA 2CSYA 4FJCA 3VK6A 2VPDA 4GNGA 4PTBA 2YUCA 5C11A 3I2DA 2E6SA 2LXHC 2VJEA 4I7DA 4P5OB 3U5MA 3ZYQA 1CHCA 2XEUA 2KIZA 2MD7B 2XB1A 4B7YC 2YSJA 2YT5A 2Y43A 2VJEB 3DQVR 2LGLA 5LKXA 4N4FA 5B76A 3L1ZB 3PURA 2PNXA 3O70A 3O37A 3C6WA 2IDAA 5B79A 4LJNA 1MM3A 2KWNA 3L1XA 3SOUA
chains in the Genus database with same CATH superfamily
1WFKA 4Q6FA 5DKAA 5SVIA 2ECIA 4CCGX 4FIPA 3T6RA 2LV9A 2VNFA 2MNZA 1WILA 2ZETC 5H1VA 4R2YA 3PLWA 3ZTGA 2RR4A 4R7EA 2XOZA 2CSVA 2YSMA 2L75A 1FP0A 2K17A 2XP0A 4ZQLA 2E6RA 3HCSA 2MA6A 2L43A 1HYIA 2LN0A 2M1RA 3O7AA 3MDBC 1FBVA 3LQJA 5JG6A 5AIUA 2G45A 3N9PA 5D1LB 4L7XA 3ZNIA 1ZBDB 2DJAA 4V3KC 2PUYA 3PUQA 3GV4A 2M6MA 4I7BA 1WEWA 5G04B 2KYUA 2VPBA 5B78A 2KKXA 2CRRA 2KR4A 2VP7A 3C5KA 4IC3A 2L7PA 3E2DA 3SUBA 3FANA 2M85A 4R8PK 2C2LA 1DCQA 3ZPV1 4YATA 2HYED 2VJFB 2ECWA 3LRQA 2LGKA 2YQLA 5TABA 2RI7A 4CA1A 2P57A 2MT5A 4X3GA 3U5NA 5KH9A 2FD4A 2JMDA 2KFTA 2JMIA 2XOCA 3O33A 2OXQC 5TBNA 1MM2A 1X4IA 3DPLR 4LKAA 2CKLA 1V87A 3O36A 1VFYA 1N87A 4AYCA 5B77A 3KQIA 2DSMA 5J3XA 4Z0RA 1XWHA 5DINA 1LDJB 2EA6A 2CKLB 4A0CD 4AYCB 4O62A 2CSZA 1X4UA 1HYJA 3N9LA 5EYAF 4F1PA 3KDEC 2LRIC 5H9MA 3FAOA 2QJ0A 2L5UA 3HTKC 5D1KB 2IQJA 4W4UA 5LKUA 4B86C 3Q1DA 2H0DA 4UI9B 4ZUXU 5TDRA 2Y1MA 2KE1A 4S3OC 2D8SA 2I50A 4A4CA 3FL2A 3T9KA 2C2VS 1G25A 2H0DB 2FFWA 2QICA 2MUMA 2L0BA 3ZVYA 4YADA 3HCUA 1Z60A 4O64A 5SVYA 4C9ZA 1U6GB 1BORA 1K2FA 2YURA 4H9DA 3U5PA 4LADB 5G05B 2KKYA 1WENA 5H1TA 2KGIA 5FB1A 1WEOA 5LCWB 3HCTA 2ECGA 3O47A 2D8UA 3JUEA 2ECJA 5C13A 2E61A 1VYXA 2YU4A 2MA5A 2YW8A 5KH3A 3MHHA 4WZ0A 2ECTA 1DVPA 2BAYA 2F6NA 3N9NA 5FERA 2VJFA 2F42A 3LJUX 3QZVA 4GB0A 4MVTA 1LDKC 1WE9A 1T1HA 3N9OA 3FEHA 2G43A 4YBSA 2L80A 4YBMA 3PHDA 4BBQA 3RPGC 2YHNA 3LVRE 3L11A 4PPEA 1JOCA 1WEPA 2YHOA 4FK5A 5LKTA 2LQ6A 2HDPA 2LGGA 1Z2QA 3KV6A 4BHWA 2M3HA 4FO9A 3NG2A 2LXPC 4AP4A 5FB0A 2LAUA 3M99A 4WZ3B 1WEEA 4AUQB 2K1JA 2KWOA 2LGVA 2VPEA 3LDYA 4L58A 3O35A 3SOWA 3T7LA 4I7CA 2JUNA 2QIZA 2KREA 2M13A 2NAAA 3FM8C 4GNDA 3KV5A 1X4JA 3M63A 3M7KA 3LQHA 4QQ4A 4XI1A 3SOXA 5B8DA 3RPGB 5KH7A 1WGMA 1WEMA 2YYRA 5I3LA 2EGMA 5AITA 1IYMA 2ECVA 3LQIA 4YBTA 1E4UA 3EB5A 4IC2A 4QF2A 1WIMA 3N9MA 2MKEA 2YREA 2JRJA 2LDRA 5H1UA 4AVXA 2F6JA 2OWAA 3ZVZB 4TKPB 1VD4A 2FSAA 2XOYA 5LKZA 4GNEA 2CT2A 2RSDA 4GNFA 4YAXA 2UZGA 2MIQA 4QF3A 5TRBA 2K4DA 5SVIB 2EXUA 3M62A 2JMJA 2AN6A 4UP5A 1Z6UA 2MNYA 2Y1NA 5FEYA 5G0FA 3ZPVE 3H7HA 2JM3A 4N3WA 3U5OA 1MBMA 4F52B 4LK9A 4YABA 1JM7A 3EB6A 2B0OE 4LLBA 4MSXA 2DX8A 2VPGA 3RTRB 1WEUA 1WEQA 5K3QA 2YVRA 2EGPA 5TDWA 4UP0A 2EODA 4A4BA 3SHBA 2CONA 4WA6A 2KWKA 2MD8C 4WZ2A 2K16A 4S3OB 4A49A 1JM7B 3V43A 3GL6A 2KGGA 1RMDA 1WEVA 1WESA 2YQMA 3ASLA 3MHSA 4YC9A 4OGCA 5B75A 4V3LC 3DWDA 5D1MB 4ZDTA 3O34A 2FUIA 3N9QA 2KWJA 1F62A 3FJUB 3KNVA 2FUUA 4NN2A 4OGEA 2KU3A 4Z0OA 3IHPA 2ECNA 2G6QA 3DDTA 2CSYA 4FJCA 3VK6A 2VPDA 4GNGA 4PTBA 2YUCA 3LVQE 5C11A 3I2DA 2E6SA 2LXHC 2VJEA 4I7DA 4P5OB 3U5MA 3ZYQA 1CHCA 2XEUA 2KIZA 2MD7B 2XB1A 4B7YC 2YSJA 2YT5A 2Y43A 2VJEB 3DQVR 2LGLA 5SVXA 5LKXA 4N4FA 5B76A 3L1ZB 3PURA 2PNXA 3O70A 2CRWA 3O37A 3C6WA 2IDAA 5B79A 4LJNA 1MM3A 2KWNA 3L1XA 3SOUA
chains in the Genus database with same CATH topology
1WFKA 4Q6FA 5DKAA 2ECIA 4CCGX 4FIPA 3T6RA 2LV9A 2VNFA 2MNZA 1WILA 2ZETC 5H1VA 4R2YA 3ZTGA 4R7EA 2YSMA 2L75A 1FP0A 2K17A 4ZQLA 2E6RA 3HCSA 2MA6A 2L43A 1HYIA 2LN0A 2M1RA 3O7AA 1FBVA 3LQJA 5JG6A 5AIUA 2G45A 3N9PA 5D1LB 4L7XA 3ZNIA 1ZBDB 4V3KC 2PUYA 3PUQA 3GV4A 2M6MA 4I7BA 1WEWA 5G04B 2KYUA 2VPBA 5B78A 2KR4A 2VP7A 3C5KA 4IC3A 2M85A 4R8PK 2C2LA 3ZPV1 4YATA 2HYED 2VJFB 2ECWA 3LRQA 2LGKA 2YQLA 5TABA 2RI7A 4CA1A 2MT5A 4X3GA 3U5NA 5KH9A 2JMDA 2KFTA 2JMIA 3O33A 2OXQC 5TBNA 1MM2A 1X4IA 3DPLR 4LKAA 2CKLA 1V87A 3O36A 1VFYA 1N87A 4AYCA 5B77A 3KQIA 5J3XA 1XWHA 5DINA 1LDJB 2EA6A 2CKLB 4A0CD 4AYCB 2CSZA 1X4UA 1HYJA 3N9LA 5EYAF 2LRIC 5H9MA 2QJ0A 2L5UA 3HTKC 5D1KB 4W4UA 5LKUA 4B86C 2H0DA 4UI9B 4ZUXU 5TDRA 2Y1MA 2KE1A 4S3OC 2D8SA 2I50A 4A4CA 3FL2A 2C2VS 1G25A 2H0DB 2QICA 2MUMA 2L0BA 3ZVYA 4YADA 3HCUA 1Z60A 4O64A 4C9ZA 1U6GB 1BORA 1K2FA 2YURA 3U5PA 4LADB 5G05B 1WENA 5H1TA 2KGIA 5FB1A 1WEOA 5LCWB 3HCTA 2ECGA 5C13A 2ECJA 1VYXA 2YU4A 2MA5A 2YW8A 5KH3A 3MHHA 4WZ0A 2ECTA 1DVPA 2BAYA 2F6NA 3N9NA 5FERA 2VJFA 2F42A 4GB0A 3QZVA 4MVTA 1LDKC 1WE9A 1T1HA 3N9OA 2G43A 4YBSA 2L80A 4YBMA 3PHDA 4BBQA 3RPGC 2YHNA 3L11A 4PPEA 1JOCA 1WEPA 2YHOA 4FK5A 5LKTA 2LQ6A 2HDPA 2LGGA 1Z2QA 3KV6A 4BHWA 2M3HA 4FO9A 3NG2A 2LXPC 4AP4A 5FB0A 3M99A 4WZ3B 1WEEA 4AUQB 2K1JA 2KWOA 2LGVA 2VPEA 4L58A 3O35A 3SOWA 3T7LA 4I7CA 2QIZA 2KREA 2NAAA 4GNDA 3KV5A 1X4JA 3M63A 3LQHA 4XI1A 3SOXA 5B8DA 3RPGB 5KH7A 1WGMA 1WEMA 2YYRA 5I3LA 5AITA 1IYMA 2ECVA 3LQIA 4YBTA 1E4UA 3EB5A 4IC2A 4QF2A 1WIMA 3N9MA 2YREA 2JRJA 2LDRA 5H1UA 4AVXA 2F6JA 3ZVZB 4TKPB 1VD4A 2FSAA 5LKZA 4GNEA 2CT2A 2RSDA 4GNFA 4YAXA 2UZGA 2MIQA 4QF3A 5TRBA 2K4DA 3M62A 2JMJA 2AN6A 4UP5A 1Z6UA 2MNYA 2Y1NA 5FEYA 5G0FA 3ZPVE 4N3WA 3U5OA 4F52B 4LK9A 4YABA 1JM7A 3EB6A 4LLBA 4MSXA 2DX8A 2VPGA 3RTRB 1WEUA 1WEQA 2EGPA 5TDWA 4UP0A 2EODA 4A4BA 3SHBA 4WA6A 2KWKA 2MD8C 4WZ2A 2K16A 4S3OB 4A49A 1JM7B 3V43A 3GL6A 2KGGA 1RMDA 1WEVA 1WESA 2YQMA 3ASLA 3MHSA 4YC9A 5B75A 4V3LC 5D1MB 4ZDTA 3O34A 2FUIA 3N9QA 2KWJA 1F62A 3KNVA 2FUUA 4NN2A 2KU3A 3IHPA 2ECNA 2G6QA 2CSYA 4FJCA 3VK6A 2VPDA 4GNGA 4PTBA 2YUCA 5C11A 3I2DA 2E6SA 2LXHC 2VJEA 4I7DA 4P5OB 3U5MA 3ZYQA 1CHCA 2XEUA 2KIZA 2MD7B 2XB1A 4B7YC 2YSJA 2YT5A 2Y43A 2VJEB 3DQVR 2LGLA 5LKXA 4N4FA 5B76A 3L1ZB 3PURA 2PNXA 3O70A 3O37A 3C6WA 2IDAA 5B79A 4LJNA 1MM3A 2KWNA 3L1XA 3SOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFK A;  4Q6F A;  5DKA A;  2ECI A;  4CCG X;  4FIP A;  3T6R A;  2LV9 A;  2VNF A;  2MNZ A;  1WIL A;  2ZET C;  5H1V A;  4R2Y A;  3ZTG A;  4R7E A;  2YSM A;  2L75 A;  1FP0 A;  2K17 A;  4ZQL A;  2E6R A;  3HCS A;  2MA6 A;  2L43 A;  1HYI A;  2LN0 A;  2M1R A;  3O7A A;  1FBV A;  3LQJ A;  5JG6 A;  5AIU A;  2G45 A;  3N9P A;  5D1L B;  4L7X A;  3ZNI A;  1ZBD B;  4V3K C;  2PUY A;  3PUQ A;  3GV4 A;  2M6M A;  4I7B A;  1WEW A;  5G04 B;  2KYU A;  2VPB A;  5B78 A;  2KR4 A;  2VP7 A;  3C5K A;  4IC3 A;  2M85 A;  4R8P K;  2C2L A;  3ZPV 1;  4YAT A;  2HYE D;  2VJF B;  2ECW A;  3LRQ A;  2LGK A;  2YQL A;  5TAB A;  2RI7 A;  4CA1 A;  2MT5 A;  4X3G A;  3U5N A;  5KH9 A;  2JMD A;  2KFT A;  2JMI A;  3O33 A;  2OXQ C;  5TBN A;  1MM2 A;  1X4I A;  3DPL R;  4LKA A;  2CKL A;  1V87 A;  3O36 A;  1VFY A;  1N87 A;  4AYC A;  5B77 A;  3KQI A;  5J3X A;  1XWH A;  5DIN A;  1LDJ B;  2EA6 A;  2CKL B;  4A0C D;  4AYC B;  2CSZ A;  1X4U A;  1HYJ A;  3N9L A;  5EYA F;  2LRI C;  5H9M A;  2QJ0 A;  2L5U A;  3HTK C;  5D1K B;  4W4U A;  5LKU A;  4B86 C;  2H0D A;  4UI9 B;  4ZUX U;  5TDR A;  2Y1M A;  2KE1 A;  4S3O C;  2D8S A;  2I50 A;  4A4C A;  3FL2 A;  2C2V S;  1G25 A;  2H0D B;  2QIC A;  2MUM A;  2L0B A;  3ZVY A;  4YAD A;  3HCU A;  1Z60 A;  4O64 A;  4C9Z A;  1U6G B;  1BOR A;  1K2F A;  2YUR A;  3U5P A;  4LAD B;  5G05 B;  1WEN A;  5H1T A;  2KGI A;  5FB1 A;  1WEO A;  5LCW B;  3HCT A;  2ECG A;  5C13 A;  2ECJ A;  1VYX A;  2YU4 A;  2MA5 A;  2YW8 A;  5KH3 A;  3MHH A;  4WZ0 A;  2ECT A;  1DVP A;  2BAY A;  2F6N A;  3N9N A;  5FER A;  2VJF A;  2F42 A;  4GB0 A;  3QZV A;  4MVT A;  1LDK C;  1WE9 A;  1T1H A;  3N9O A;  2G43 A;  4YBS A;  2L80 A;  4YBM A;  3PHD A;  4BBQ A;  3RPG C;  2YHN A;  3L11 A;  4PPE A;  1JOC A;  1WEP A;  2YHO A;  4FK5 A;  5LKT A;  2LQ6 A;  2HDP A;  2LGG A;  1Z2Q A;  3KV6 A;  4BHW A;  2M3H A;  4FO9 A;  3NG2 A;  2LXP C;  4AP4 A;  5FB0 A;  3M99 A;  4WZ3 B;  1WEE A;  4AUQ B;  2K1J A;  2KWO A;  2LGV A;  2VPE A;  4L58 A;  3O35 A;  3SOW A;  3T7L A;  4I7C A;  2QIZ A;  2KRE A;  2NAA A;  4GND A;  3KV5 A;  1X4J A;  3M63 A;  3LQH A;  4XI1 A;  3SOX A;  5B8D A;  3RPG B;  5KH7 A;  1WGM A;  1WEM A;  2YYR A;  5I3L A;  5AIT A;  1IYM A;  2ECV A;  3LQI A;  4YBT A;  1E4U A;  3EB5 A;  4IC2 A;  4QF2 A;  1WIM A;  3N9M A;  2YRE A;  2JRJ A;  2LDR A;  5H1U A;  4AVX A;  2F6J A;  3ZVZ B;  4TKP B;  1VD4 A;  2FSA A;  5LKZ A;  4GNE A;  2CT2 A;  2RSD A;  4GNF A;  4YAX A;  2UZG A;  2MIQ A;  4QF3 A;  5TRB A;  2K4D A;  3M62 A;  2JMJ A;  2AN6 A;  4UP5 A;  1Z6U A;  2MNY A;  2Y1N A;  5FEY A;  5G0F A;  3ZPV E;  4N3W A;  3U5O A;  4F52 B;  4LK9 A;  4YAB A;  1JM7 A;  3EB6 A;  4LLB A;  4MSX A;  2DX8 A;  2VPG A;  3RTR B;  1WEU A;  1WEQ A;  2EGP A;  5TDW A;  4UP0 A;  2EOD A;  4A4B A;  3SHB A;  4WA6 A;  2KWK A;  2MD8 C;  4WZ2 A;  2K16 A;  4S3O B;  4A49 A;  1JM7 B;  3V43 A;  3GL6 A;  2KGG A;  1RMD A;  1WEV A;  1WES A;  2YQM A;  3ASL A;  3MHS A;  4YC9 A;  5B75 A;  4V3L C;  5D1M B;  4ZDT A;  3O34 A;  2FUI A;  3N9Q A;  2KWJ A;  1F62 A;  3KNV A;  2FUU A;  4NN2 A;  2KU3 A;  3IHP A;  2ECN A;  2G6Q A;  2CSY A;  4FJC A;  3VK6 A;  2VPD A;  4GNG A;  4PTB A;  2YUC A;  5C11 A;  3I2D A;  2E6S A;  2LXH C;  2VJE A;  4I7D A;  4P5O B;  3U5M A;  3ZYQ A;  1CHC A;  2XEU A;  2KIZ A;  2MD7 B;  2XB1 A;  4B7Y C;  2YSJ A;  2YT5 A;  2Y43 A;  2VJE B;  3DQV R;  2LGL A;  5LKX A;  4N4F A;  5B76 A;  3L1Z B;  3PUR A;  2PNX A;  3O70 A;  3O37 A;  3C6W A;  2IDA A;  5B79 A;  4LJN A;  1MM3 A;  2KWN A;  3L1X A;  3SOU A; 
#chains in the Genus database with same CATH topology
 1WFK A;  4Q6F A;  5DKA A;  5SVI A;  2ECI A;  4CCG X;  4FIP A;  3T6R A;  2LV9 A;  2VNF A;  2MNZ A;  1WIL A;  2ZET C;  5H1V A;  4R2Y A;  3PLW A;  3ZTG A;  2RR4 A;  4R7E A;  2XOZ A;  2CSV A;  2YSM A;  2L75 A;  1FP0 A;  2K17 A;  2XP0 A;  4ZQL A;  2E6R A;  3HCS A;  2MA6 A;  2L43 A;  1HYI A;  2LN0 A;  2M1R A;  3O7A A;  3MDB C;  1FBV A;  3LQJ A;  5JG6 A;  5AIU A;  2G45 A;  3N9P A;  5D1L B;  4L7X A;  3ZNI A;  1ZBD B;  2DJA A;  4V3K C;  2PUY A;  3PUQ A;  3GV4 A;  2M6M A;  4I7B A;  1WEW A;  5G04 B;  2KYU A;  2VPB A;  5B78 A;  2KKX A;  2CRR A;  2KR4 A;  2VP7 A;  3C5K A;  4IC3 A;  2L7P A;  3E2D A;  3SUB A;  3FAN A;  2M85 A;  4R8P K;  2C2L A;  1DCQ A;  3ZPV 1;  4YAT A;  2HYE D;  2VJF B;  2ECW A;  3LRQ A;  2LGK A;  2YQL A;  5TAB A;  2RI7 A;  4CA1 A;  2P57 A;  2MT5 A;  4X3G A;  3U5N A;  5KH9 A;  2FD4 A;  2JMD A;  2KFT A;  2JMI A;  2XOC A;  3O33 A;  2OXQ C;  5TBN A;  1MM2 A;  1X4I A;  3DPL R;  4LKA A;  2CKL A;  1V87 A;  3O36 A;  1VFY A;  1N87 A;  4AYC A;  5B77 A;  3KQI A;  2DSM A;  5J3X A;  4Z0R A;  1XWH A;  5DIN A;  1LDJ B;  2EA6 A;  2CKL B;  4A0C D;  4AYC B;  4O62 A;  2CSZ A;  1X4U A;  1HYJ A;  3N9L A;  5EYA F;  4F1P A;  3KDE C;  2LRI C;  5H9M A;  3FAO A;  2QJ0 A;  2L5U A;  3HTK C;  5D1K B;  2IQJ A;  4W4U A;  5LKU A;  4B86 C;  3Q1D A;  2H0D A;  4UI9 B;  4ZUX U;  5TDR A;  2Y1M A;  2KE1 A;  4S3O C;  2D8S A;  2I50 A;  4A4C A;  3FL2 A;  3T9K A;  2C2V S;  1G25 A;  2H0D B;  2FFW A;  2QIC A;  2MUM A;  2L0B A;  3ZVY A;  4YAD A;  3HCU A;  1Z60 A;  4O64 A;  5SVY A;  4C9Z A;  1U6G B;  1BOR A;  1K2F A;  2YUR A;  4H9D A;  3U5P A;  4LAD B;  5G05 B;  2KKY A;  1WEN A;  5H1T A;  2KGI A;  5FB1 A;  1WEO A;  5LCW B;  3HCT A;  2ECG A;  3O47 A;  2D8U A;  3JUE A;  2ECJ A;  5C13 A;  2E61 A;  1VYX A;  2YU4 A;  2MA5 A;  2YW8 A;  5KH3 A;  3MHH A;  4WZ0 A;  2ECT A;  1DVP A;  2BAY A;  2F6N A;  3N9N A;  5FER A;  2VJF A;  2F42 A;  3LJU X;  3QZV A;  4GB0 A;  4MVT A;  1LDK C;  1WE9 A;  1T1H A;  3N9O A;  3FEH A;  2G43 A;  4YBS A;  2L80 A;  4YBM A;  3PHD A;  4BBQ A;  3RPG C;  2YHN A;  3LVR E;  3L11 A;  4PPE A;  1JOC A;  1WEP A;  2YHO A;  4FK5 A;  5LKT A;  2LQ6 A;  2HDP A;  2LGG A;  1Z2Q A;  3KV6 A;  4BHW A;  2M3H A;  4FO9 A;  3NG2 A;  2LXP C;  4AP4 A;  5FB0 A;  2LAU A;  3M99 A;  4WZ3 B;  1WEE A;  4AUQ B;  2K1J A;  2KWO A;  2LGV A;  2VPE A;  3LDY A;  4L58 A;  3O35 A;  3SOW A;  3T7L A;  4I7C A;  2JUN A;  2QIZ A;  2KRE A;  2M13 A;  2NAA A;  3FM8 C;  4GND A;  3KV5 A;  1X4J A;  3M63 A;  3M7K A;  3LQH A;  4QQ4 A;  4XI1 A;  3SOX A;  5B8D A;  3RPG B;  5KH7 A;  1WGM A;  1WEM A;  2YYR A;  5I3L A;  2EGM A;  5AIT A;  1IYM A;  2ECV A;  3LQI A;  4YBT A;  1E4U A;  3EB5 A;  4IC2 A;  4QF2 A;  1WIM A;  3N9M A;  2MKE A;  2YRE A;  2JRJ A;  2LDR A;  5H1U A;  4AVX A;  2F6J A;  2OWA A;  3ZVZ B;  4TKP B;  1VD4 A;  2FSA A;  2XOY A;  5LKZ A;  4GNE A;  2CT2 A;  2RSD A;  4GNF A;  4YAX A;  2UZG A;  2MIQ A;  4QF3 A;  5TRB A;  2K4D A;  5SVI B;  2EXU A;  3M62 A;  2JMJ A;  2AN6 A;  4UP5 A;  1Z6U A;  2MNY A;  2Y1N A;  5FEY A;  5G0F A;  3ZPV E;  3H7H A;  2JM3 A;  4N3W A;  3U5O A;  1MBM A;  4F52 B;  4LK9 A;  4YAB A;  1JM7 A;  3EB6 A;  2B0O E;  4LLB A;  4MSX A;  2DX8 A;  2VPG A;  3RTR B;  1WEU A;  1WEQ A;  5K3Q A;  2YVR A;  2EGP A;  5TDW A;  4UP0 A;  2EOD A;  4A4B A;  3SHB A;  2CON A;  4WA6 A;  2KWK A;  2MD8 C;  4WZ2 A;  2K16 A;  4S3O B;  4A49 A;  1JM7 B;  3V43 A;  3GL6 A;  2KGG A;  1RMD A;  1WEV A;  1WES A;  2YQM A;  3ASL A;  3MHS A;  4YC9 A;  4OGC A;  5B75 A;  4V3L C;  3DWD A;  5D1M B;  4ZDT A;  3O34 A;  2FUI A;  3N9Q A;  2KWJ A;  1F62 A;  3FJU B;  3KNV A;  2FUU A;  4NN2 A;  4OGE A;  2KU3 A;  4Z0O A;  3IHP A;  2ECN A;  2G6Q A;  3DDT A;  2CSY A;  4FJC A;  3VK6 A;  2VPD A;  4GNG A;  4PTB A;  2YUC A;  3LVQ E;  5C11 A;  3I2D A;  2E6S A;  2LXH C;  2VJE A;  4I7D A;  4P5O B;  3U5M A;  3ZYQ A;  1CHC A;  2XEU A;  2KIZ A;  2MD7 B;  2XB1 A;  4B7Y C;  2YSJ A;  2YT5 A;  2Y43 A;  2VJE B;  3DQV R;  2LGL A;  5SVX A;  5LKX A;  4N4F A;  5B76 A;  3L1Z B;  3PUR A;  2PNX A;  3O70 A;  2CRW A;  3O37 A;  3C6W A;  2IDA A;  5B79 A;  4LJN A;  1MM3 A;  2KWN A;  3L1X A;  3SOU A; 
#chains in the Genus database with same CATH homology
 1WFK A;  4Q6F A;  5DKA A;  2ECI A;  4CCG X;  4FIP A;  3T6R A;  2LV9 A;  2VNF A;  2MNZ A;  1WIL A;  2ZET C;  5H1V A;  4R2Y A;  3ZTG A;  4R7E A;  2YSM A;  2L75 A;  1FP0 A;  2K17 A;  4ZQL A;  2E6R A;  3HCS A;  2MA6 A;  2L43 A;  1HYI A;  2LN0 A;  2M1R A;  3O7A A;  1FBV A;  3LQJ A;  5JG6 A;  5AIU A;  2G45 A;  3N9P A;  5D1L B;  4L7X A;  3ZNI A;  1ZBD B;  4V3K C;  2PUY A;  3PUQ A;  3GV4 A;  2M6M A;  4I7B A;  1WEW A;  5G04 B;  2KYU A;  2VPB A;  5B78 A;  2KR4 A;  2VP7 A;  3C5K A;  4IC3 A;  2M85 A;  4R8P K;  2C2L A;  3ZPV 1;  4YAT A;  2HYE D;  2VJF B;  2ECW A;  3LRQ A;  2LGK A;  2YQL A;  5TAB A;  2RI7 A;  4CA1 A;  2MT5 A;  4X3G A;  3U5N A;  5KH9 A;  2JMD A;  2KFT A;  2JMI A;  3O33 A;  2OXQ C;  5TBN A;  1MM2 A;  1X4I A;  3DPL R;  4LKA A;  2CKL A;  1V87 A;  3O36 A;  1VFY A;  1N87 A;  4AYC A;  5B77 A;  3KQI A;  5J3X A;  1XWH A;  5DIN A;  1LDJ B;  2EA6 A;  2CKL B;  4A0C D;  4AYC B;  2CSZ A;  1X4U A;  1HYJ A;  3N9L A;  5EYA F;  2LRI C;  5H9M A;  2QJ0 A;  2L5U A;  3HTK C;  5D1K B;  4W4U A;  5LKU A;  4B86 C;  2H0D A;  4UI9 B;  4ZUX U;  5TDR A;  2Y1M A;  2KE1 A;  4S3O C;  2D8S A;  2I50 A;  4A4C A;  3FL2 A;  2C2V S;  1G25 A;  2H0D B;  2QIC A;  2MUM A;  2L0B A;  3ZVY A;  4YAD A;  3HCU A;  1Z60 A;  4O64 A;  4C9Z A;  1U6G B;  1BOR A;  1K2F A;  2YUR A;  3U5P A;  4LAD B;  5G05 B;  1WEN A;  5H1T A;  2KGI A;  5FB1 A;  1WEO A;  5LCW B;  3HCT A;  2ECG A;  5C13 A;  2ECJ A;  1VYX A;  2YU4 A;  2MA5 A;  2YW8 A;  5KH3 A;  3MHH A;  4WZ0 A;  2ECT A;  1DVP A;  2BAY A;  2F6N A;  3N9N A;  5FER A;  2VJF A;  2F42 A;  4GB0 A;  3QZV A;  4MVT A;  1LDK C;  1WE9 A;  1T1H A;  3N9O A;  2G43 A;  4YBS A;  2L80 A;  4YBM A;  3PHD A;  4BBQ A;  3RPG C;  2YHN A;  3L11 A;  4PPE A;  1JOC A;  1WEP A;  2YHO A;  4FK5 A;  5LKT A;  2LQ6 A;  2HDP A;  2LGG A;  1Z2Q A;  3KV6 A;  4BHW A;  2M3H A;  4FO9 A;  3NG2 A;  2LXP C;  4AP4 A;  5FB0 A;  3M99 A;  4WZ3 B;  1WEE A;  4AUQ B;  2K1J A;  2KWO A;  2LGV A;  2VPE A;  4L58 A;  3O35 A;  3SOW A;  3T7L A;  4I7C A;  2QIZ A;  2KRE A;  2NAA A;  4GND A;  3KV5 A;  1X4J A;  3M63 A;  3LQH A;  4XI1 A;  3SOX A;  5B8D A;  3RPG B;  5KH7 A;  1WGM A;  1WEM A;  2YYR A;  5I3L A;  5AIT A;  1IYM A;  2ECV A;  3LQI A;  4YBT A;  1E4U A;  3EB5 A;  4IC2 A;  4QF2 A;  1WIM A;  3N9M A;  2YRE A;  2JRJ A;  2LDR A;  5H1U A;  4AVX A;  2F6J A;  3ZVZ B;  4TKP B;  1VD4 A;  2FSA A;  5LKZ A;  4GNE A;  2CT2 A;  2RSD A;  4GNF A;  4YAX A;  2UZG A;  2MIQ A;  4QF3 A;  5TRB A;  2K4D A;  3M62 A;  2JMJ A;  2AN6 A;  4UP5 A;  1Z6U A;  2MNY A;  2Y1N A;  5FEY A;  5G0F A;  3ZPV E;  4N3W A;  3U5O A;  4F52 B;  4LK9 A;  4YAB A;  1JM7 A;  3EB6 A;  4LLB A;  4MSX A;  2DX8 A;  2VPG A;  3RTR B;  1WEU A;  1WEQ A;  2EGP A;  5TDW A;  4UP0 A;  2EOD A;  4A4B A;  3SHB A;  4WA6 A;  2KWK A;  2MD8 C;  4WZ2 A;  2K16 A;  4S3O B;  4A49 A;  1JM7 B;  3V43 A;  3GL6 A;  2KGG A;  1RMD A;  1WEV A;  1WES A;  2YQM A;  3ASL A;  3MHS A;  4YC9 A;  5B75 A;  4V3L C;  5D1M B;  4ZDT A;  3O34 A;  2FUI A;  3N9Q A;  2KWJ A;  1F62 A;  3KNV A;  2FUU A;  4NN2 A;  2KU3 A;  3IHP A;  2ECN A;  2G6Q A;  2CSY A;  4FJC A;  3VK6 A;  2VPD A;  4GNG A;  4PTB A;  2YUC A;  5C11 A;  3I2D A;  2E6S A;  2LXH C;  2VJE A;  4I7D A;  4P5O B;  3U5M A;  3ZYQ A;  1CHC A;  2XEU A;  2KIZ A;  2MD7 B;  2XB1 A;  4B7Y C;  2YSJ A;  2YT5 A;  2Y43 A;  2VJE B;  3DQV R;  2LGL A;  5LKX A;  4N4F A;  5B76 A;  3L1Z B;  3PUR A;  2PNX A;  3O70 A;  3O37 A;  3C6W A;  2IDA A;  5B79 A;  4LJN A;  1MM3 A;  2KWN A;  3L1X A;  3SOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...