2YUCA

Solution structure of the traf-type zinc finger domains (102-164) from human tnf receptor associated factor 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
76
structure length
76
Chain Sequence
GSSGSSGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords TNF receptor-associated factor 4
publication title Solution structure of the TRAF-type zinc finger domains (102-164) from human TNF receptor associated factor 4
rcsb
source organism Homo sapiens
total genus 6
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02176 zf-TRAF TRAF-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yucA01
5TRBA 3GL6A 1X4JA 2L80A 4I7CA 1T1HA 3N9LA 4LK9A 1WIMA 5TDRA 5C13A 4AVXA 2KGGA 4I7BA 5TDWA 1VD4A 4L7XA 2FUUA 1CHCA 3LQHA 2K17A 5B75A 4AUQB 1IYMA 1LDKC 3HTKC 2LGGA 1WEUA 4R7EA 4YABA 1Z2QA 2MA6A 5FEYA 5B79A 2KFTA 2C2VS 2MT5A 5KH3A 1VFYA 1BORA 2YSJA 3ZVYA 3RTRB 3ZPV1 4C9ZA 2F6NA 2JMDA 2VPBA 2LGKA 2YQMA 2KGIA 4LJNA 2MA5A 2HDPA 5J3XA 4PTBA 3O7AA 4AP4A 2LRIC 3C6WA 5C11A 3ZVZB 4N4FA 4QF2A 1JM7B 1WENA 3M99A 1WEWA 1VYXA 4ZUXU 1FP0A 2CSZA 5D1LB 3N9QA 4IC3A 2QIZA 2YUCA 4XI1A 5B77A 5LKZA 3U5PA 4N3WA 4S3OB 2L5UA 2L43A 5B8DA 1Z60A 3T6RA 4GB0A 4CA1A 1WEQA 2QJ0A 1WEOA 2YHOA 2LV9A 4S3OC 1WILA 4Q6FA 2VPGA 1K2FA 5LKUA 5AITA 2YU4A 4A49A 4WZ3B 2PNXA 3LRQA 4V3KC 2E6SA 3O35A 3DPLR 3FL2A 4A4CA 2ECNA 4YBTA 4ZDTA 2G43A 2ECJA 2KWOA 5G04B 4WZ0A 5TABA 3O33A 4YATA 4AYCA 2VJEB 4V3LC 5FB0A 3L1ZB 2VNFA 1ZBDB 3LQIA 2K16A 2G6QA 3SOUA 2CKLB 5B78A 1MM2A 1HYJA 4X3GA 2K4DA 4BHWA 4FK5A 5KH7A 2ECTA 2VJFA 1WEMA 4UI9B 2YSMA 3DQVR 2M6MA 3IHPA 2LN0A 2FUIA 2KWNA 5D1MB 3O34A 1JOCA 1WFKA 1FBVA 2PUYA 2Y1MA 2ECIA 3EB6A 1X4UA 2YT5A 2LGLA 3NG2A 3M63A 2Y1NA 4IC2A 2F42A 3PURA 4YC9A 1U6GB 3RPGB 5H1TA 2M85A 4LLBA 3U5OA 4F52B 2MUMA 2FSAA 2KU3A 5I3LA 1LDJB 2H0DB 3RPGC 5KH9A 2ECWA 3MHHA 2Y43A 1G25A 5LKTA 1MM3A 4B86C 2VPDA 1HYIA 2YREA 5G0FA 2VPEA 1X4IA 1F62A 1WEVA 1Z6UA 2G45A 2KYUA 2I50A 3KV5A 4ZQLA 5LKXA 5B76A 2MIQA 3KNVA 2M3HA 3ZTGA 1DVPA 4PPEA 3GV4A 4UP0A 2EA6A 2LGVA 5FB1A 5AIUA 2K1JA 2MNZA 2KWJA 4L58A 3EB5A 2YYRA 1WE9A 4YBMA 4GNEA 4R2YA 2LDRA 2KIZA 4LADB 4B7YC 4CCGX 2LXPC 3T7LA 4P5OB 5H1VA 5TBNA 2L75A 3L11A 2JMJA 1XWHA 5LCWB 2RI7A 2KWKA 2CKLA 2DX8A 3HCSA 4AYCB 2KREA 4FIPA 5FERA 4MSXA 2BAYA 5DINA 3HCUA 2IDAA 2XB1A 4FJCA 3KV6A 3I2DA 3KQIA 2VJFB 2NAAA 4FO9A 3HCTA 3ASLA 2D8SA 3O70A 4R8PK 3MHSA 4QF3A 1JM7A 2YW8A 2VP7A 3LQJA 2E6RA 2KE1A 2H0DA 3ZNIA 5H1UA 4MVTA 5G05B 2MD8C 2L0BA 2MNYA 2KR4A 1WEEA 2CT2A 2JRJA 4A4BA 3QZVA 3N9PA 2F6JA 3C5KA 3N9MA 2UZGA 2ECGA 3ZPVE 1N87A 1RMDA 3U5MA 2OXQC 4UP5A 3U5NA 2CSYA 4GNDA 3SOWA 4W4UA 1V87A 2M1RA 2C2LA 2YURA 2EGPA 2QICA 2LQ6A 2ZETC 3SHBA 4YAXA 2LXHC 2EODA 2JMIA 4GNGA 4LKAA 4GNFA 5DKAA 4A0CD 5JG6A 3O36A 3N9NA 4I7DA 5H9MA 2YQLA 1E4UA 4NN2A 2ECVA 3L1XA 5D1KB 2RSDA 4BBQA 2YHNA 2MD7B 3SOXA 3N9OA 2HYED 4YBSA 4O64A 5EYAF 3VK6A 3PUQA 4TKPB 1WEPA 2XEUA 2VJEA 1WGMA 3V43A 1WESA 3M62A 2AN6A 3PHDA 4YADA 4WA6A 3ZYQA 3O37A 4WZ2A
chains in the Genus database with same CATH superfamily
3O47A 5TRBA 3GL6A 1X4JA 2L80A 4I7CA 2L7PA 1T1HA 3N9LA 4LK9A 1WIMA 5TDRA 3KDEC 2XOYA 5C13A 4AVXA 2B0OE 2CRWA 2KGGA 2P57A 3FM8C 4I7BA 2CONA 5TDWA 1VD4A 4L7XA 2FUUA 1CHCA 3LQHA 2K17A 5B75A 4AUQB 1IYMA 1LDKC 3HTKC 2LGGA 1WEUA 4R7EA 4YABA 2DSMA 2XOZA 1Z2QA 2MA6A 5FEYA 5B79A 2KFTA 2C2VS 2MT5A 5KH3A 1VFYA 1BORA 2YSJA 3ZVYA 3RTRB 3ZPV1 4C9ZA 2F6NA 2JMDA 2VPBA 2LGKA 2YQMA 2KGIA 4LJNA 5SVIB 2MA5A 2HDPA 5J3XA 4PTBA 3O7AA 4AP4A 2LRIC 3C6WA 5C11A 3DDTA 3ZVZB 2M13A 4Z0RA 4N4FA 4QF2A 1JM7B 1WENA 3H7HA 3M99A 1WEWA 3T9KA 1VYXA 4ZUXU 1FP0A 2CSZA 5D1LB 3N9QA 4IC3A 3PLWA 2QIZA 2YUCA 4XI1A 5B77A 5LKZA 3U5PA 4N3WA 4S3OB 2L5UA 2L43A 5B8DA 2DJAA 1Z60A 3T6RA 4GB0A 4CA1A 1WEQA 2QJ0A 1WEOA 2YHOA 2LV9A 3M7KA 4S3OC 1WILA 4Q6FA 2VPGA 1K2FA 4OGCA 5LKUA 5AITA 3JUEA 3E2DA 2YU4A 4A49A 4WZ3B 2PNXA 3LRQA 4V3KC 2E6SA 3O35A 3DPLR 3FL2A 2XP0A 4A4CA 2ECNA 4YBTA 4ZDTA 2G43A 3LJUX 2ECJA 3FJUB 4H9DA 2KWOA 5G04B 4WZ0A 5TABA 3O33A 4YATA 2XOCA 4AYCA 2VJEB 4V3LC 5FB0A 2IQJA 3L1ZB 2VNFA 1ZBDB 2JM3A 4F1PA 3LDYA 3LQIA 2K16A 2G6QA 3SOUA 2CKLB 5B78A 1MM2A 1HYJA 4X3GA 2K4DA 4OGEA 4BHWA 4FK5A 5KH7A 2ECTA 2VJFA 3MDBC 1WEMA 2YSMA 2JUNA 3DQVR 4UI9B 2M6MA 3FEHA 3IHPA 3LVRE 2LN0A 2FUIA 2KWNA 5D1MB 3O34A 1JOCA 1WFKA 1FBVA 2MKEA 2PUYA 2Y1MA 2ECIA 4O62A 2LAUA 3EB6A 1X4UA 2YT5A 2E61A 2CSVA 2LGLA 3NG2A 3M63A 2Y1NA 4IC2A 2F42A 3PURA 5SVIA 4YC9A 1U6GB 3RPGB 5H1TA 2M85A 4LLBA 5SVXA 3U5OA 2RR4A 4F52B 2MUMA 2FSAA 2KU3A 5I3LA 1LDJB 2H0DB 3RPGC 5KH9A 3LVQE 2ECWA 3MHHA 2Y43A 1G25A 3Q1DA 5LKTA 1MM3A 4B86C 2VPDA 1HYIA 2YREA 5G0FA 2VPEA 1X4IA 1F62A 1WEVA 1Z6UA 2G45A 2KYUA 2I50A 3KV5A 4ZQLA 5LKXA 5B76A 2MIQA 3KNVA 2M3HA 3ZTGA 1DVPA 4PPEA 3GV4A 4UP0A 2EA6A 2LGVA 5FB1A 5AIUA 2K1JA 2MNZA 2KWJA 4L58A 3EB5A 2YYRA 1WE9A 4YBMA 4GNEA 4R2YA 2LDRA 2KIZA 4LADB 4B7YC 4CCGX 2LXPC 3T7LA 4P5OB 1DCQA 5H1VA 5TBNA 2L75A 3L11A 2JMJA 1XWHA 5LCWB 2RI7A 2KWKA 2CKLA 2DX8A 3HCSA 4AYCB 5SVYA 2EXUA 2KREA 4FIPA 5FERA 3FANA 4MSXA 2BAYA 5DINA 3HCUA 2IDAA 2XB1A 2CRRA 4FJCA 3KV6A 3I2DA 3KQIA 2VJFB 2NAAA 4QQ4A 4FO9A 3HCTA 3ASLA 3SUBA 2D8SA 3O70A 4R8PK 3MHSA 4QF3A 1JM7A 2YW8A 2VP7A 5K3QA 3LQJA 2E6RA 2KE1A 2H0DA 3ZNIA 5H1UA 4MVTA 5G05B 2MD8C 2L0BA 2MNYA 2YVRA 2KR4A 1WEEA 2CT2A 2JRJA 4A4BA 3QZVA 3N9PA 2F6JA 3C5KA 3N9MA 2UZGA 2ECGA 3ZPVE 1N87A 1RMDA 3U5MA 2OXQC 2EGMA 4UP5A 3U5NA 2CSYA 4GNDA 3SOWA 4W4UA 2FFWA 1V87A 2M1RA 2C2LA 2YURA 2EGPA 2QICA 2LQ6A 2ZETC 3SHBA 4YAXA 2FD4A 2LXHC 2EODA 2JMIA 4GNGA 4LKAA 4GNFA 5DKAA 4A0CD 5JG6A 3DWDA 3O36A 3N9NA 4I7DA 5H9MA 2YQLA 1E4UA 4NN2A 2ECVA 3L1XA 5D1KB 2RSDA 4BBQA 2YHNA 2MD7B 3SOXA 3N9OA 2HYED 2D8UA 4YBSA 4O64A 5EYAF 3VK6A 3PUQA 4TKPB 1WEPA 2OWAA 2XEUA 1MBMA 3FAOA 2VJEA 2KKYA 1WGMA 4Z0OA 3V43A 1WESA 3M62A 2AN6A 3PHDA 2KKXA 4YADA 4WA6A 3ZYQA 3O37A 4WZ2A
chains in the Genus database with same CATH topology
5TRBA 3GL6A 1X4JA 2L80A 4I7CA 1T1HA 3N9LA 4LK9A 1WIMA 5TDRA 5C13A 4AVXA 2KGGA 4I7BA 5TDWA 1VD4A 4L7XA 2FUUA 1CHCA 3LQHA 2K17A 5B75A 4AUQB 1IYMA 1LDKC 3HTKC 2LGGA 1WEUA 4R7EA 4YABA 1Z2QA 2MA6A 5FEYA 5B79A 2KFTA 2C2VS 2MT5A 5KH3A 1VFYA 1BORA 2YSJA 3ZVYA 3RTRB 3ZPV1 4C9ZA 2F6NA 2JMDA 2VPBA 2LGKA 2YQMA 2KGIA 4LJNA 2MA5A 2HDPA 5J3XA 4PTBA 3O7AA 4AP4A 2LRIC 3C6WA 5C11A 3ZVZB 4N4FA 4QF2A 1JM7B 1WENA 3M99A 1WEWA 1VYXA 4ZUXU 1FP0A 2CSZA 5D1LB 3N9QA 4IC3A 2QIZA 2YUCA 4XI1A 5B77A 5LKZA 3U5PA 4N3WA 4S3OB 2L5UA 2L43A 5B8DA 1Z60A 3T6RA 4GB0A 4CA1A 1WEQA 2QJ0A 1WEOA 2YHOA 2LV9A 4S3OC 1WILA 4Q6FA 2VPGA 1K2FA 5LKUA 5AITA 2YU4A 4A49A 4WZ3B 2PNXA 3LRQA 4V3KC 2E6SA 3O35A 3DPLR 3FL2A 4A4CA 2ECNA 4YBTA 4ZDTA 2G43A 2ECJA 2KWOA 5G04B 4WZ0A 5TABA 3O33A 4YATA 4AYCA 2VJEB 4V3LC 5FB0A 3L1ZB 2VNFA 1ZBDB 3LQIA 2K16A 2G6QA 3SOUA 2CKLB 5B78A 1MM2A 1HYJA 4X3GA 2K4DA 4BHWA 4FK5A 5KH7A 2ECTA 2VJFA 1WEMA 4UI9B 2YSMA 3DQVR 2M6MA 3IHPA 2LN0A 2FUIA 2KWNA 5D1MB 3O34A 1JOCA 1WFKA 1FBVA 2PUYA 2Y1MA 2ECIA 3EB6A 1X4UA 2YT5A 2LGLA 3NG2A 3M63A 2Y1NA 4IC2A 2F42A 3PURA 4YC9A 1U6GB 3RPGB 5H1TA 2M85A 4LLBA 3U5OA 4F52B 2MUMA 2FSAA 2KU3A 5I3LA 1LDJB 2H0DB 3RPGC 5KH9A 2ECWA 3MHHA 2Y43A 1G25A 5LKTA 1MM3A 4B86C 2VPDA 1HYIA 2YREA 5G0FA 2VPEA 1X4IA 1F62A 1WEVA 1Z6UA 2G45A 2KYUA 2I50A 3KV5A 4ZQLA 5LKXA 5B76A 2MIQA 3KNVA 2M3HA 3ZTGA 1DVPA 4PPEA 3GV4A 4UP0A 2EA6A 2LGVA 5FB1A 5AIUA 2K1JA 2MNZA 2KWJA 4L58A 3EB5A 2YYRA 1WE9A 4YBMA 4GNEA 4R2YA 2LDRA 2KIZA 4LADB 4B7YC 4CCGX 2LXPC 3T7LA 4P5OB 5H1VA 5TBNA 2L75A 3L11A 2JMJA 1XWHA 5LCWB 2RI7A 2KWKA 2CKLA 2DX8A 3HCSA 4AYCB 2KREA 4FIPA 5FERA 4MSXA 2BAYA 5DINA 3HCUA 2IDAA 2XB1A 4FJCA 3KV6A 3I2DA 3KQIA 2VJFB 2NAAA 4FO9A 3HCTA 3ASLA 2D8SA 3O70A 4R8PK 3MHSA 4QF3A 1JM7A 2YW8A 2VP7A 3LQJA 2E6RA 2KE1A 2H0DA 3ZNIA 5H1UA 4MVTA 5G05B 2MD8C 2L0BA 2MNYA 2KR4A 1WEEA 2CT2A 2JRJA 4A4BA 3QZVA 3N9PA 2F6JA 3C5KA 3N9MA 2UZGA 2ECGA 3ZPVE 1N87A 1RMDA 3U5MA 2OXQC 4UP5A 3U5NA 2CSYA 4GNDA 3SOWA 4W4UA 1V87A 2M1RA 2C2LA 2YURA 2EGPA 2QICA 2LQ6A 2ZETC 3SHBA 4YAXA 2LXHC 2EODA 2JMIA 4GNGA 4LKAA 4GNFA 5DKAA 4A0CD 5JG6A 3O36A 3N9NA 4I7DA 5H9MA 2YQLA 1E4UA 4NN2A 2ECVA 3L1XA 5D1KB 2RSDA 4BBQA 2YHNA 2MD7B 3SOXA 3N9OA 2HYED 4YBSA 4O64A 5EYAF 3VK6A 3PUQA 4TKPB 1WEPA 2XEUA 2VJEA 1WGMA 3V43A 1WESA 3M62A 2AN6A 3PHDA 4YADA 4WA6A 3ZYQA 3O37A 4WZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TRB A;  3GL6 A;  1X4J A;  2L80 A;  4I7C A;  1T1H A;  3N9L A;  4LK9 A;  1WIM A;  5TDR A;  5C13 A;  4AVX A;  2KGG A;  4I7B A;  5TDW A;  1VD4 A;  4L7X A;  2FUU A;  1CHC A;  3LQH A;  2K17 A;  5B75 A;  4AUQ B;  1IYM A;  1LDK C;  3HTK C;  2LGG A;  1WEU A;  4R7E A;  4YAB A;  1Z2Q A;  2MA6 A;  5FEY A;  5B79 A;  2KFT A;  2C2V S;  2MT5 A;  5KH3 A;  1VFY A;  1BOR A;  2YSJ A;  3ZVY A;  3RTR B;  3ZPV 1;  4C9Z A;  2F6N A;  2JMD A;  2VPB A;  2LGK A;  2YQM A;  2KGI A;  4LJN A;  2MA5 A;  2HDP A;  5J3X A;  4PTB A;  3O7A A;  4AP4 A;  2LRI C;  3C6W A;  5C11 A;  3ZVZ B;  4N4F A;  4QF2 A;  1JM7 B;  1WEN A;  3M99 A;  1WEW A;  1VYX A;  4ZUX U;  1FP0 A;  2CSZ A;  5D1L B;  3N9Q A;  4IC3 A;  2QIZ A;  2YUC A;  4XI1 A;  5B77 A;  5LKZ A;  3U5P A;  4N3W A;  4S3O B;  2L5U A;  2L43 A;  5B8D A;  1Z60 A;  3T6R A;  4GB0 A;  4CA1 A;  1WEQ A;  2QJ0 A;  1WEO A;  2YHO A;  2LV9 A;  4S3O C;  1WIL A;  4Q6F A;  2VPG A;  1K2F A;  5LKU A;  5AIT A;  2YU4 A;  4A49 A;  4WZ3 B;  2PNX A;  3LRQ A;  4V3K C;  2E6S A;  3O35 A;  3DPL R;  3FL2 A;  4A4C A;  2ECN A;  4YBT A;  4ZDT A;  2G43 A;  2ECJ A;  2KWO A;  5G04 B;  4WZ0 A;  5TAB A;  3O33 A;  4YAT A;  4AYC A;  2VJE B;  4V3L C;  5FB0 A;  3L1Z B;  2VNF A;  1ZBD B;  3LQI A;  2K16 A;  2G6Q A;  3SOU A;  2CKL B;  5B78 A;  1MM2 A;  1HYJ A;  4X3G A;  2K4D A;  4BHW A;  4FK5 A;  5KH7 A;  2ECT A;  2VJF A;  1WEM A;  4UI9 B;  2YSM A;  3DQV R;  2M6M A;  3IHP A;  2LN0 A;  2FUI A;  2KWN A;  5D1M B;  3O34 A;  1JOC A;  1WFK A;  1FBV A;  2PUY A;  2Y1M A;  2ECI A;  3EB6 A;  1X4U A;  2YT5 A;  2LGL A;  3NG2 A;  3M63 A;  2Y1N A;  4IC2 A;  2F42 A;  3PUR A;  4YC9 A;  1U6G B;  3RPG B;  5H1T A;  2M85 A;  4LLB A;  3U5O A;  4F52 B;  2MUM A;  2FSA A;  2KU3 A;  5I3L A;  1LDJ B;  2H0D B;  3RPG C;  5KH9 A;  2ECW A;  3MHH A;  2Y43 A;  1G25 A;  5LKT A;  1MM3 A;  4B86 C;  2VPD A;  1HYI A;  2YRE A;  5G0F A;  2VPE A;  1X4I A;  1F62 A;  1WEV A;  1Z6U A;  2G45 A;  2KYU A;  2I50 A;  3KV5 A;  4ZQL A;  5LKX A;  5B76 A;  2MIQ A;  3KNV A;  2M3H A;  3ZTG A;  1DVP A;  4PPE A;  3GV4 A;  4UP0 A;  2EA6 A;  2LGV A;  5FB1 A;  5AIU A;  2K1J A;  2MNZ A;  2KWJ A;  4L58 A;  3EB5 A;  2YYR A;  1WE9 A;  4YBM A;  4GNE A;  4R2Y A;  2LDR A;  2KIZ A;  4LAD B;  4B7Y C;  4CCG X;  2LXP C;  3T7L A;  4P5O B;  5H1V A;  5TBN A;  2L75 A;  3L11 A;  2JMJ A;  1XWH A;  5LCW B;  2RI7 A;  2KWK A;  2CKL A;  2DX8 A;  3HCS A;  4AYC B;  2KRE A;  4FIP A;  5FER A;  4MSX A;  2BAY A;  5DIN A;  3HCU A;  2IDA A;  2XB1 A;  4FJC A;  3KV6 A;  3I2D A;  3KQI A;  2VJF B;  2NAA A;  4FO9 A;  3HCT A;  3ASL A;  2D8S A;  3O70 A;  4R8P K;  3MHS A;  4QF3 A;  1JM7 A;  2YW8 A;  2VP7 A;  3LQJ A;  2E6R A;  2KE1 A;  2H0D A;  3ZNI A;  5H1U A;  4MVT A;  5G05 B;  2MD8 C;  2L0B A;  2MNY A;  2KR4 A;  1WEE A;  2CT2 A;  2JRJ A;  4A4B A;  3QZV A;  3N9P A;  2F6J A;  3C5K A;  3N9M A;  2UZG A;  2ECG A;  3ZPV E;  1N87 A;  1RMD A;  3U5M A;  2OXQ C;  4UP5 A;  3U5N A;  2CSY A;  4GND A;  3SOW A;  4W4U A;  1V87 A;  2M1R A;  2C2L A;  2YUR A;  2EGP A;  2QIC A;  2LQ6 A;  2ZET C;  3SHB A;  4YAX A;  2LXH C;  2EOD A;  2JMI A;  4GNG A;  4LKA A;  4GNF A;  5DKA A;  4A0C D;  5JG6 A;  3O36 A;  3N9N A;  4I7D A;  5H9M A;  2YQL A;  1E4U A;  4NN2 A;  2ECV A;  3L1X A;  5D1K B;  2RSD A;  4BBQ A;  2YHN A;  2MD7 B;  3SOX A;  3N9O A;  2HYE D;  4YBS A;  4O64 A;  5EYA F;  3VK6 A;  3PUQ A;  4TKP B;  1WEP A;  2XEU A;  2VJE A;  1WGM A;  3V43 A;  1WES A;  3M62 A;  2AN6 A;  3PHD A;  4YAD A;  4WA6 A;  3ZYQ A;  3O37 A;  4WZ2 A; 
#chains in the Genus database with same CATH topology
 3O47 A;  5TRB A;  3GL6 A;  1X4J A;  2L80 A;  4I7C A;  2L7P A;  1T1H A;  3N9L A;  4LK9 A;  1WIM A;  5TDR A;  3KDE C;  2XOY A;  5C13 A;  4AVX A;  2B0O E;  2CRW A;  2KGG A;  2P57 A;  3FM8 C;  4I7B A;  2CON A;  5TDW A;  1VD4 A;  4L7X A;  2FUU A;  1CHC A;  3LQH A;  2K17 A;  5B75 A;  4AUQ B;  1IYM A;  1LDK C;  3HTK C;  2LGG A;  1WEU A;  4R7E A;  4YAB A;  2DSM A;  2XOZ A;  1Z2Q A;  2MA6 A;  5FEY A;  5B79 A;  2KFT A;  2C2V S;  2MT5 A;  5KH3 A;  1VFY A;  1BOR A;  2YSJ A;  3ZVY A;  3RTR B;  3ZPV 1;  4C9Z A;  2F6N A;  2JMD A;  2VPB A;  2LGK A;  2YQM A;  2KGI A;  4LJN A;  5SVI B;  2MA5 A;  2HDP A;  5J3X A;  4PTB A;  3O7A A;  4AP4 A;  2LRI C;  3C6W A;  5C11 A;  3DDT A;  3ZVZ B;  2M13 A;  4Z0R A;  4N4F A;  4QF2 A;  1JM7 B;  1WEN A;  3H7H A;  3M99 A;  1WEW A;  3T9K A;  1VYX A;  4ZUX U;  1FP0 A;  2CSZ A;  5D1L B;  3N9Q A;  4IC3 A;  3PLW A;  2QIZ A;  2YUC A;  4XI1 A;  5B77 A;  5LKZ A;  3U5P A;  4N3W A;  4S3O B;  2L5U A;  2L43 A;  5B8D A;  2DJA A;  1Z60 A;  3T6R A;  4GB0 A;  4CA1 A;  1WEQ A;  2QJ0 A;  1WEO A;  2YHO A;  2LV9 A;  3M7K A;  4S3O C;  1WIL A;  4Q6F A;  2VPG A;  1K2F A;  4OGC A;  5LKU A;  5AIT A;  3JUE A;  3E2D A;  2YU4 A;  4A49 A;  4WZ3 B;  2PNX A;  3LRQ A;  4V3K C;  2E6S A;  3O35 A;  3DPL R;  3FL2 A;  2XP0 A;  4A4C A;  2ECN A;  4YBT A;  4ZDT A;  2G43 A;  3LJU X;  2ECJ A;  3FJU B;  4H9D A;  2KWO A;  5G04 B;  4WZ0 A;  5TAB A;  3O33 A;  4YAT A;  2XOC A;  4AYC A;  2VJE B;  4V3L C;  5FB0 A;  2IQJ A;  3L1Z B;  2VNF A;  1ZBD B;  2JM3 A;  4F1P A;  3LDY A;  3LQI A;  2K16 A;  2G6Q A;  3SOU A;  2CKL B;  5B78 A;  1MM2 A;  1HYJ A;  4X3G A;  2K4D A;  4OGE A;  4BHW A;  4FK5 A;  5KH7 A;  2ECT A;  2VJF A;  3MDB C;  1WEM A;  2YSM A;  2JUN A;  3DQV R;  4UI9 B;  2M6M A;  3FEH A;  3IHP A;  3LVR E;  2LN0 A;  2FUI A;  2KWN A;  5D1M B;  3O34 A;  1JOC A;  1WFK A;  1FBV A;  2MKE A;  2PUY A;  2Y1M A;  2ECI A;  4O62 A;  2LAU A;  3EB6 A;  1X4U A;  2YT5 A;  2E61 A;  2CSV A;  2LGL A;  3NG2 A;  3M63 A;  2Y1N A;  4IC2 A;  2F42 A;  3PUR A;  5SVI A;  4YC9 A;  1U6G B;  3RPG B;  5H1T A;  2M85 A;  4LLB A;  5SVX A;  3U5O A;  2RR4 A;  4F52 B;  2MUM A;  2FSA A;  2KU3 A;  5I3L A;  1LDJ B;  2H0D B;  3RPG C;  5KH9 A;  3LVQ E;  2ECW A;  3MHH A;  2Y43 A;  1G25 A;  3Q1D A;  5LKT A;  1MM3 A;  4B86 C;  2VPD A;  1HYI A;  2YRE A;  5G0F A;  2VPE A;  1X4I A;  1F62 A;  1WEV A;  1Z6U A;  2G45 A;  2KYU A;  2I50 A;  3KV5 A;  4ZQL A;  5LKX A;  5B76 A;  2MIQ A;  3KNV A;  2M3H A;  3ZTG A;  1DVP A;  4PPE A;  3GV4 A;  4UP0 A;  2EA6 A;  2LGV A;  5FB1 A;  5AIU A;  2K1J A;  2MNZ A;  2KWJ A;  4L58 A;  3EB5 A;  2YYR A;  1WE9 A;  4YBM A;  4GNE A;  4R2Y A;  2LDR A;  2KIZ A;  4LAD B;  4B7Y C;  4CCG X;  2LXP C;  3T7L A;  4P5O B;  1DCQ A;  5H1V A;  5TBN A;  2L75 A;  3L11 A;  2JMJ A;  1XWH A;  5LCW B;  2RI7 A;  2KWK A;  2CKL A;  2DX8 A;  3HCS A;  4AYC B;  5SVY A;  2EXU A;  2KRE A;  4FIP A;  5FER A;  3FAN A;  4MSX A;  2BAY A;  5DIN A;  3HCU A;  2IDA A;  2XB1 A;  2CRR A;  4FJC A;  3KV6 A;  3I2D A;  3KQI A;  2VJF B;  2NAA A;  4QQ4 A;  4FO9 A;  3HCT A;  3ASL A;  3SUB A;  2D8S A;  3O70 A;  4R8P K;  3MHS A;  4QF3 A;  1JM7 A;  2YW8 A;  2VP7 A;  5K3Q A;  3LQJ A;  2E6R A;  2KE1 A;  2H0D A;  3ZNI A;  5H1U A;  4MVT A;  5G05 B;  2MD8 C;  2L0B A;  2MNY A;  2YVR A;  2KR4 A;  1WEE A;  2CT2 A;  2JRJ A;  4A4B A;  3QZV A;  3N9P A;  2F6J A;  3C5K A;  3N9M A;  2UZG A;  2ECG A;  3ZPV E;  1N87 A;  1RMD A;  3U5M A;  2OXQ C;  2EGM A;  4UP5 A;  3U5N A;  2CSY A;  4GND A;  3SOW A;  4W4U A;  2FFW A;  1V87 A;  2M1R A;  2C2L A;  2YUR A;  2EGP A;  2QIC A;  2LQ6 A;  2ZET C;  3SHB A;  4YAX A;  2FD4 A;  2LXH C;  2EOD A;  2JMI A;  4GNG A;  4LKA A;  4GNF A;  5DKA A;  4A0C D;  5JG6 A;  3DWD A;  3O36 A;  3N9N A;  4I7D A;  5H9M A;  2YQL A;  1E4U A;  4NN2 A;  2ECV A;  3L1X A;  5D1K B;  2RSD A;  4BBQ A;  2YHN A;  2MD7 B;  3SOX A;  3N9O A;  2HYE D;  2D8U A;  4YBS A;  4O64 A;  5EYA F;  3VK6 A;  3PUQ A;  4TKP B;  1WEP A;  2OWA A;  2XEU A;  1MBM A;  3FAO A;  2VJE A;  2KKY A;  1WGM A;  4Z0O A;  3V43 A;  1WES A;  3M62 A;  2AN6 A;  3PHD A;  2KKX A;  4YAD A;  4WA6 A;  3ZYQ A;  3O37 A;  4WZ2 A; 
#chains in the Genus database with same CATH homology
 5TRB A;  3GL6 A;  1X4J A;  2L80 A;  4I7C A;  1T1H A;  3N9L A;  4LK9 A;  1WIM A;  5TDR A;  5C13 A;  4AVX A;  2KGG A;  4I7B A;  5TDW A;  1VD4 A;  4L7X A;  2FUU A;  1CHC A;  3LQH A;  2K17 A;  5B75 A;  4AUQ B;  1IYM A;  1LDK C;  3HTK C;  2LGG A;  1WEU A;  4R7E A;  4YAB A;  1Z2Q A;  2MA6 A;  5FEY A;  5B79 A;  2KFT A;  2C2V S;  2MT5 A;  5KH3 A;  1VFY A;  1BOR A;  2YSJ A;  3ZVY A;  3RTR B;  3ZPV 1;  4C9Z A;  2F6N A;  2JMD A;  2VPB A;  2LGK A;  2YQM A;  2KGI A;  4LJN A;  2MA5 A;  2HDP A;  5J3X A;  4PTB A;  3O7A A;  4AP4 A;  2LRI C;  3C6W A;  5C11 A;  3ZVZ B;  4N4F A;  4QF2 A;  1JM7 B;  1WEN A;  3M99 A;  1WEW A;  1VYX A;  4ZUX U;  1FP0 A;  2CSZ A;  5D1L B;  3N9Q A;  4IC3 A;  2QIZ A;  2YUC A;  4XI1 A;  5B77 A;  5LKZ A;  3U5P A;  4N3W A;  4S3O B;  2L5U A;  2L43 A;  5B8D A;  1Z60 A;  3T6R A;  4GB0 A;  4CA1 A;  1WEQ A;  2QJ0 A;  1WEO A;  2YHO A;  2LV9 A;  4S3O C;  1WIL A;  4Q6F A;  2VPG A;  1K2F A;  5LKU A;  5AIT A;  2YU4 A;  4A49 A;  4WZ3 B;  2PNX A;  3LRQ A;  4V3K C;  2E6S A;  3O35 A;  3DPL R;  3FL2 A;  4A4C A;  2ECN A;  4YBT A;  4ZDT A;  2G43 A;  2ECJ A;  2KWO A;  5G04 B;  4WZ0 A;  5TAB A;  3O33 A;  4YAT A;  4AYC A;  2VJE B;  4V3L C;  5FB0 A;  3L1Z B;  2VNF A;  1ZBD B;  3LQI A;  2K16 A;  2G6Q A;  3SOU A;  2CKL B;  5B78 A;  1MM2 A;  1HYJ A;  4X3G A;  2K4D A;  4BHW A;  4FK5 A;  5KH7 A;  2ECT A;  2VJF A;  1WEM A;  4UI9 B;  2YSM A;  3DQV R;  2M6M A;  3IHP A;  2LN0 A;  2FUI A;  2KWN A;  5D1M B;  3O34 A;  1JOC A;  1WFK A;  1FBV A;  2PUY A;  2Y1M A;  2ECI A;  3EB6 A;  1X4U A;  2YT5 A;  2LGL A;  3NG2 A;  3M63 A;  2Y1N A;  4IC2 A;  2F42 A;  3PUR A;  4YC9 A;  1U6G B;  3RPG B;  5H1T A;  2M85 A;  4LLB A;  3U5O A;  4F52 B;  2MUM A;  2FSA A;  2KU3 A;  5I3L A;  1LDJ B;  2H0D B;  3RPG C;  5KH9 A;  2ECW A;  3MHH A;  2Y43 A;  1G25 A;  5LKT A;  1MM3 A;  4B86 C;  2VPD A;  1HYI A;  2YRE A;  5G0F A;  2VPE A;  1X4I A;  1F62 A;  1WEV A;  1Z6U A;  2G45 A;  2KYU A;  2I50 A;  3KV5 A;  4ZQL A;  5LKX A;  5B76 A;  2MIQ A;  3KNV A;  2M3H A;  3ZTG A;  1DVP A;  4PPE A;  3GV4 A;  4UP0 A;  2EA6 A;  2LGV A;  5FB1 A;  5AIU A;  2K1J A;  2MNZ A;  2KWJ A;  4L58 A;  3EB5 A;  2YYR A;  1WE9 A;  4YBM A;  4GNE A;  4R2Y A;  2LDR A;  2KIZ A;  4LAD B;  4B7Y C;  4CCG X;  2LXP C;  3T7L A;  4P5O B;  5H1V A;  5TBN A;  2L75 A;  3L11 A;  2JMJ A;  1XWH A;  5LCW B;  2RI7 A;  2KWK A;  2CKL A;  2DX8 A;  3HCS A;  4AYC B;  2KRE A;  4FIP A;  5FER A;  4MSX A;  2BAY A;  5DIN A;  3HCU A;  2IDA A;  2XB1 A;  4FJC A;  3KV6 A;  3I2D A;  3KQI A;  2VJF B;  2NAA A;  4FO9 A;  3HCT A;  3ASL A;  2D8S A;  3O70 A;  4R8P K;  3MHS A;  4QF3 A;  1JM7 A;  2YW8 A;  2VP7 A;  3LQJ A;  2E6R A;  2KE1 A;  2H0D A;  3ZNI A;  5H1U A;  4MVT A;  5G05 B;  2MD8 C;  2L0B A;  2MNY A;  2KR4 A;  1WEE A;  2CT2 A;  2JRJ A;  4A4B A;  3QZV A;  3N9P A;  2F6J A;  3C5K A;  3N9M A;  2UZG A;  2ECG A;  3ZPV E;  1N87 A;  1RMD A;  3U5M A;  2OXQ C;  4UP5 A;  3U5N A;  2CSY A;  4GND A;  3SOW A;  4W4U A;  1V87 A;  2M1R A;  2C2L A;  2YUR A;  2EGP A;  2QIC A;  2LQ6 A;  2ZET C;  3SHB A;  4YAX A;  2LXH C;  2EOD A;  2JMI A;  4GNG A;  4LKA A;  4GNF A;  5DKA A;  4A0C D;  5JG6 A;  3O36 A;  3N9N A;  4I7D A;  5H9M A;  2YQL A;  1E4U A;  4NN2 A;  2ECV A;  3L1X A;  5D1K B;  2RSD A;  4BBQ A;  2YHN A;  2MD7 B;  3SOX A;  3N9O A;  2HYE D;  4YBS A;  4O64 A;  5EYA F;  3VK6 A;  3PUQ A;  4TKP B;  1WEP A;  2XEU A;  2VJE A;  1WGM A;  3V43 A;  1WES A;  3M62 A;  2AN6 A;  3PHD A;  4YAD A;  4WA6 A;  3ZYQ A;  3O37 A;  4WZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...