2YUCA

Solution structure of the traf-type zinc finger domains (102-164) from human tnf receptor associated factor 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
76
structure length
76
Chain Sequence
GSSGSSGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNF receptor-associated factor 4
publication title Solution structure of the TRAF-type zinc finger domains (102-164) from human TNF receptor associated factor 4
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02176 zf-TRAF TRAF-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yucA01
1WESA 2VPEA 3O34A 4LKAA 2JMIA 2KREA 2KWOA 1U6GB 2ECTA 2MT5A 3SOUA 4LADB 4A0CD 5G05B 2AN6A 1RMDA 5TABA 2YSMA 3GV4A 2JMDA 1X4IA 2YHOA 2KWJA 3ZPVE 5KH9A 4YBSA 2VJFB 2VPDA 4ZDTA 3ZNIA 4WZ3B 5C11A 4AUQB 4FK5A 1MM3A 2QIZA 2DX8A 5LKZA 1WEUA 3EB6A 2CSZA 4GB0A 3O70A 3V43A 4S3OC 5LCWB 2CKLA 5B76A 5H1TA 3SHBA 1DVPA 4WA6A 2M6MA 5TDRA 3O36A 3C6WA 3DPLR 3N9OA 2CSYA 5LKUA 2QJ0A 4MSXA 1LDJB 1VYXA 4N3WA 1WEWA 2LXPC 4CA1A 2L80A 2OXQC 4GNGA 2YUCA 1MM2A 2MA6A 5FB1A 2LV9A 5D1MB 4XI1A 1WENA 2LGKA 4R7EA 5H1VA 2H0DB 2MD8C 2Y1NA 2KWNA 3M99A 4BHWA 4PPEA 5D1LB 5FB0A 2XEUA 2ECIA 2L0BA 3ZVZB 5DINA 1WEMA 1WE9A 2MIQA 3M63A 4I7DA 5I3LA 2VJEB 3T7LA 4FIPA 5FERA 2EA6A 3T6RA 2E6SA 4L7XA 1WEPA 1JM7B 2XB1A 2KE1A 2L75A 5LKTA 2UZGA 2ECGA 3N9PA 5G04B 4L58A 2PNXA 5B75A 3U5NA 5FEYA 5KH3A 4V3KC 4AYCA 5D1KB 4A49A 4PTBA 1IYMA 5C13A 4C9ZA 2FSAA 5B79A 4UP0A 3LQHA 3ZYQA 2RSDA 2KGIA 5DKAA 4N4FA 3EB5A 2VPBA 1ZBDB 4WZ0A 2EGPA 2KGGA 4YADA 2YHNA 2F6JA 5H1UA 2L43A 3PURA 4GNFA 3KV5A 4I7BA 4F52B 4W4UA 1WEVA 3N9LA 2Y43A 2G43A 5J3XA 4AP4A 1WILA 1N87A 3U5OA 1FBVA 1CHCA 2KYUA 4IC2A 2K17A 2YURA 3MHSA 3MHHA 2E6RA 2YU4A 2D8SA 2CKLB 4YABA 3O33A 3ZPV1 1Z2QA 1LDKC 3KV6A 4Q6FA 4NN2A 2VPGA 2VP7A 2KFTA 1T1HA 1X4UA 3HCSA 2KWKA 3GL6A 2ECVA 2BAYA 3ASLA 4MVTA 5EYAF 5JG6A 4P5OB 2ZETC 5B77A 1V87A 5LKXA 1VFYA 4LLBA 4YATA 1F62A 2MNZA 1HYJA 2F6NA 2ECJA 3O35A 1E4UA 2YSJA 4GNEA 4LJNA 4X3GA 2LRIC 3N9MA 3L1ZB 2YQMA 1X4JA 3U5PA 3O37A 5H9MA 4O64A 5TDWA 2CT2A 3L11A 4BBQA 2K1JA 5G0FA 2M1RA 3O7AA 2KIZA 2MA5A 2FUUA 4R8PK 3L1XA 2C2LA 4S3OB 3LQJA 2ECWA 5B8DA 1WEEA 1WFKA 3RPGB 4V3LC 4UI9B 2RI7A 2LXHC 3IHPA 2LGLA 2YREA 2QICA 2VNFA 5TRBA 4ZUXU 2EODA 5AIUA 2KR4A 3C5KA 3ZTGA 1Z60A 3KQIA 2K16A 2FUIA 4FO9A 4B7YC 3NG2A 2VJFA 3I2DA 4TKPB 4YBMA 2G6QA 2KU3A 5AITA 2YQLA 4LK9A 1XWHA 3PHDA 2ECNA 2Y1MA 4UP5A 2M3HA 2K4DA 4R2YA 4FJCA 4AYCB 4QF2A 4YC9A 3N9NA 5KH7A 2LN0A 3LQIA 4GNDA 1FP0A 4YAXA 3U5MA 4IC3A 3HCUA 4WZ2A 4QF3A 3HTKC 3RTRB 3KNVA 4A4BA 2YYRA 2NAAA 4I7CA 3RPGC 5B78A 3M62A 2G45A 1WEQA 3QZVA 4AVXA 2I50A 2IDAA 4YBTA 2LGVA 2JMJA 3SOWA 1WEOA 2F42A 1WIMA 3VK6A 2H0DA 4ZQLA 2MUMA 3ZVYA 2HDPA 2C2VS 2L5UA 1Z6UA 1WGMA 3SOXA 3DQVR 4A4CA 1BORA 3N9QA 2VJEA 2HYED 2LGGA 2LDRA 3PUQA 1JM7A 1K2FA 2M85A 1JOCA 1HYIA 5TBNA 2LQ6A 2JRJA 3HCTA 3FL2A 2MNYA 1VD4A 4CCGX 2YT5A 4B86C 2MD7B 2PUYA 1G25A 2YW8A 3LRQA
chains in the Genus database with same CATH superfamily
3FANA 1WESA 2VPEA 3O34A 4LKAA 2JMIA 2KREA 2KWOA 1U6GB 2IQJA 2ECTA 2MT5A 3SOUA 5SVXA 4LADB 4A0CD 2L7PA 5G05B 3LVQE 2AN6A 2EXUA 1RMDA 5TABA 2YSMA 3GV4A 2JMDA 1X4IA 2YHOA 2E61A 2KWJA 3ZPVE 5KH9A 4YBSA 2VJFB 2VPDA 2EGMA 4ZDTA 3ZNIA 4WZ3B 5C11A 4AUQB 3KDEC 4FK5A 1MM3A 2QIZA 2D8UA 2DX8A 5LKZA 1WEUA 3EB6A 2CSZA 4GB0A 3O70A 3V43A 4S3OC 5LCWB 2CKLA 2DJAA 5B76A 3O47A 5H1TA 3SHBA 1DVPA 4WA6A 2M6MA 5TDRA 3O36A 3C6WA 3DPLR 3N9OA 2CSYA 5LKUA 2QJ0A 4MSXA 4OGEA 1LDJB 1VYXA 4N3WA 1WEWA 2LXPC 4CA1A 2L80A 2OXQC 4GNGA 2YUCA 3FJUB 1MM2A 2MA6A 5FB1A 2LV9A 5D1MB 2JUNA 4XI1A 3H7HA 1WENA 2LGKA 4R7EA 5H1VA 2H0DB 2MD8C 2CRWA 2Y1NA 4H9DA 2KWNA 3M99A 4BHWA 4PPEA 5D1LB 5FB0A 2XEUA 2ECIA 2L0BA 3ZVZB 2FD4A 5DINA 1WEMA 1WE9A 2MIQA 3M63A 4I7DA 5I3LA 2VJEB 3T7LA 4FIPA 5FERA 2EA6A 3T6RA 4Z0OA 2E6SA 2XOYA 4L7XA 1WEPA 1JM7B 2XB1A 2KE1A 2L75A 5LKTA 2UZGA 2ECGA 3N9PA 5G04B 4L58A 3LVRE 2PNXA 5SVYA 5B75A 3U5NA 5FEYA 5KH3A 4O62A 4V3KC 4AYCA 5D1KB 4A49A 4PTBA 3DDTA 1IYMA 5C13A 2LAUA 4C9ZA 2FSAA 5B79A 4UP0A 3LQHA 3ZYQA 2RSDA 2KGIA 2XOCA 3LJUX 5DKAA 4N4FA 3EB5A 4OGCA 2VPBA 1ZBDB 2FFWA 4WZ0A 2EGPA 2KGGA 5K3QA 3E2DA 4YADA 2YHNA 2F6JA 5H1UA 2L43A 3PURA 4GNFA 3KV5A 4I7BA 4F52B 4W4UA 1WEVA 3N9LA 2Y43A 2G43A 5J3XA 4AP4A 1WILA 1N87A 3U5OA 1FBVA 1CHCA 2KYUA 4IC2A 2K17A 2YURA 3MHSA 3MHHA 2E6RA 2YU4A 3DWDA 2D8SA 2CKLB 4YABA 3O33A 3ZPV1 1Z2QA 1LDKC 2OWAA 3KV6A 4Q6FA 4NN2A 2VPGA 2VP7A 2KFTA 1T1HA 1X4UA 3HCSA 2KWKA 3GL6A 2ECVA 2BAYA 3ASLA 3FM8C 4MVTA 5EYAF 5JG6A 4P5OB 2ZETC 5B77A 1V87A 5LKXA 1VFYA 4LLBA 4YATA 1F62A 2MNZA 1HYJA 2F6NA 2ECJA 2B0OE 3O35A 1E4UA 2YSJA 4GNEA 4LJNA 3FEHA 4X3GA 2DSMA 2LRIC 2CONA 3N9MA 3L1ZB 2YQMA 1X4JA 3U5PA 2KKXA 2MKEA 3O37A 5H9MA 4O64A 5TDWA 5SVIA 2CT2A 3L11A 4BBQA 2K1JA 5G0FA 2M1RA 3O7AA 2KIZA 2MA5A 2FUUA 4R8PK 3JUEA 3L1XA 2C2LA 4S3OB 3LQJA 2ECWA 1DCQA 3T9KA 5B8DA 1WEEA 1WFKA 3RPGB 4V3LC 4UI9B 2RI7A 2LXHC 3IHPA 2LGLA 2YREA 2QICA 2VNFA 5TRBA 4ZUXU 2EODA 3C5KA 2KR4A 5AIUA 3ZTGA 1Z60A 3KQIA 2K16A 2FUIA 4FO9A 4B7YC 3NG2A 2VJFA 3I2DA 4TKPB 4YBMA 2G6QA 2XP0A 2KU3A 5AITA 2YVRA 2YQLA 4LK9A 1XWHA 3PHDA 2ECNA 2Y1MA 4UP5A 2M3HA 2K4DA 4R2YA 4FJCA 4AYCB 4QF2A 4YC9A 3N9NA 5KH7A 2LN0A 3LQIA 4GNDA 1FP0A 3Q1DA 3LDYA 3M7KA 4YAXA 3U5MA 4IC3A 3HCUA 4WZ2A 4QF3A 2KKYA 3HTKC 3RTRB 4QQ4A 2M13A 3KNVA 4Z0RA 4A4BA 2YYRA 2NAAA 4I7CA 2JM3A 3RPGC 3M62A 2G45A 5B78A 2P57A 1WEQA 3QZVA 4AVXA 2I50A 2IDAA 4YBTA 2LGVA 2JMJA 3SOWA 1WEOA 2F42A 1WIMA 3VK6A 2H0DA 4ZQLA 2MUMA 3ZVYA 2HDPA 2C2VS 3MDBC 2L5UA 1Z6UA 2XOZA 1WGMA 3PLWA 3SOXA 3DQVR 4A4CA 1BORA 3N9QA 2VJEA 2HYED 2LGGA 1MBMA 2LDRA 3PUQA 3FAOA 4F1PA 1JM7A 1K2FA 2M85A 1JOCA 1HYIA 5TBNA 2LQ6A 2JRJA 3HCTA 3FL2A 2MNYA 1VD4A 4CCGX 2YT5A 4B86C 2CRRA 2RR4A 2CSVA 2MD7B 2PUYA 5SVIB 1G25A 2YW8A 3SUBA 3LRQA
chains in the Genus database with same CATH topology
1WESA 2VPEA 3O34A 4LKAA 2JMIA 2KREA 2KWOA 1U6GB 2ECTA 2MT5A 3SOUA 4LADB 4A0CD 5G05B 2AN6A 1RMDA 5TABA 2YSMA 3GV4A 2JMDA 1X4IA 2YHOA 2KWJA 3ZPVE 5KH9A 4YBSA 2VJFB 2VPDA 4ZDTA 3ZNIA 4WZ3B 5C11A 4AUQB 4FK5A 1MM3A 2QIZA 2DX8A 5LKZA 1WEUA 3EB6A 2CSZA 4GB0A 3O70A 3V43A 4S3OC 5LCWB 2CKLA 5B76A 5H1TA 3SHBA 1DVPA 4WA6A 2M6MA 5TDRA 3O36A 3C6WA 3DPLR 3N9OA 2CSYA 5LKUA 2QJ0A 4MSXA 1LDJB 1VYXA 4N3WA 1WEWA 2LXPC 4CA1A 2L80A 2OXQC 4GNGA 2YUCA 1MM2A 2MA6A 5FB1A 2LV9A 5D1MB 4XI1A 1WENA 2LGKA 4R7EA 5H1VA 2H0DB 2MD8C 2Y1NA 2KWNA 3M99A 4BHWA 4PPEA 5D1LB 5FB0A 2XEUA 2ECIA 2L0BA 3ZVZB 5DINA 1WEMA 1WE9A 2MIQA 3M63A 4I7DA 5I3LA 2VJEB 3T7LA 4FIPA 5FERA 2EA6A 3T6RA 2E6SA 4L7XA 1WEPA 1JM7B 2XB1A 2KE1A 2L75A 5LKTA 2UZGA 2ECGA 3N9PA 5G04B 4L58A 2PNXA 5B75A 3U5NA 5FEYA 5KH3A 4V3KC 4AYCA 5D1KB 4A49A 4PTBA 1IYMA 5C13A 4C9ZA 2FSAA 5B79A 4UP0A 3LQHA 3ZYQA 2RSDA 2KGIA 5DKAA 4N4FA 3EB5A 2VPBA 1ZBDB 4WZ0A 2EGPA 2KGGA 4YADA 2YHNA 2F6JA 5H1UA 2L43A 3PURA 4GNFA 3KV5A 4I7BA 4F52B 4W4UA 1WEVA 3N9LA 2Y43A 2G43A 5J3XA 4AP4A 1WILA 1N87A 3U5OA 1FBVA 1CHCA 2KYUA 4IC2A 2K17A 2YURA 3MHSA 3MHHA 2E6RA 2YU4A 2D8SA 2CKLB 4YABA 3O33A 3ZPV1 1Z2QA 1LDKC 3KV6A 4Q6FA 4NN2A 2VPGA 2VP7A 2KFTA 1T1HA 1X4UA 3HCSA 2KWKA 3GL6A 2ECVA 2BAYA 3ASLA 4MVTA 5EYAF 5JG6A 4P5OB 2ZETC 5B77A 1V87A 5LKXA 1VFYA 4LLBA 4YATA 1F62A 2MNZA 1HYJA 2F6NA 2ECJA 3O35A 1E4UA 2YSJA 4GNEA 4LJNA 4X3GA 2LRIC 3N9MA 3L1ZB 2YQMA 1X4JA 3U5PA 3O37A 5H9MA 4O64A 5TDWA 2CT2A 3L11A 4BBQA 2K1JA 5G0FA 2M1RA 3O7AA 2KIZA 2MA5A 2FUUA 4R8PK 3L1XA 2C2LA 4S3OB 3LQJA 2ECWA 5B8DA 1WEEA 1WFKA 3RPGB 4V3LC 4UI9B 2RI7A 2LXHC 3IHPA 2LGLA 2YREA 2QICA 2VNFA 5TRBA 4ZUXU 2EODA 5AIUA 2KR4A 3C5KA 3ZTGA 1Z60A 3KQIA 2K16A 2FUIA 4FO9A 4B7YC 3NG2A 2VJFA 3I2DA 4TKPB 4YBMA 2G6QA 2KU3A 5AITA 2YQLA 4LK9A 1XWHA 3PHDA 2ECNA 2Y1MA 4UP5A 2M3HA 2K4DA 4R2YA 4FJCA 4AYCB 4QF2A 4YC9A 3N9NA 5KH7A 2LN0A 3LQIA 4GNDA 1FP0A 4YAXA 3U5MA 4IC3A 3HCUA 4WZ2A 4QF3A 3HTKC 3RTRB 3KNVA 4A4BA 2YYRA 2NAAA 4I7CA 3RPGC 5B78A 3M62A 2G45A 1WEQA 3QZVA 4AVXA 2I50A 2IDAA 4YBTA 2LGVA 2JMJA 3SOWA 1WEOA 2F42A 1WIMA 3VK6A 2H0DA 4ZQLA 2MUMA 3ZVYA 2HDPA 2C2VS 2L5UA 1Z6UA 1WGMA 3SOXA 3DQVR 4A4CA 1BORA 3N9QA 2VJEA 2HYED 2LGGA 2LDRA 3PUQA 1JM7A 1K2FA 2M85A 1JOCA 1HYIA 5TBNA 2LQ6A 2JRJA 3HCTA 3FL2A 2MNYA 1VD4A 4CCGX 2YT5A 4B86C 2MD7B 2PUYA 1G25A 2YW8A 3LRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WES A;  2VPE A;  3O34 A;  4LKA A;  2JMI A;  2KRE A;  2KWO A;  1U6G B;  2ECT A;  2MT5 A;  3SOU A;  4LAD B;  4A0C D;  5G05 B;  2AN6 A;  1RMD A;  5TAB A;  2YSM A;  3GV4 A;  2JMD A;  1X4I A;  2YHO A;  2KWJ A;  3ZPV E;  5KH9 A;  4YBS A;  2VJF B;  2VPD A;  4ZDT A;  3ZNI A;  4WZ3 B;  5C11 A;  4AUQ B;  4FK5 A;  1MM3 A;  2QIZ A;  2DX8 A;  5LKZ A;  1WEU A;  3EB6 A;  2CSZ A;  4GB0 A;  3O70 A;  3V43 A;  4S3O C;  5LCW B;  2CKL A;  5B76 A;  5H1T A;  3SHB A;  1DVP A;  4WA6 A;  2M6M A;  5TDR A;  3O36 A;  3C6W A;  3DPL R;  3N9O A;  2CSY A;  5LKU A;  2QJ0 A;  4MSX A;  1LDJ B;  1VYX A;  4N3W A;  1WEW A;  2LXP C;  4CA1 A;  2L80 A;  2OXQ C;  4GNG A;  2YUC A;  1MM2 A;  2MA6 A;  5FB1 A;  2LV9 A;  5D1M B;  4XI1 A;  1WEN A;  2LGK A;  4R7E A;  5H1V A;  2H0D B;  2MD8 C;  2Y1N A;  2KWN A;  3M99 A;  4BHW A;  4PPE A;  5D1L B;  5FB0 A;  2XEU A;  2ECI A;  2L0B A;  3ZVZ B;  5DIN A;  1WEM A;  1WE9 A;  2MIQ A;  3M63 A;  4I7D A;  5I3L A;  2VJE B;  3T7L A;  4FIP A;  5FER A;  2EA6 A;  3T6R A;  2E6S A;  4L7X A;  1WEP A;  1JM7 B;  2XB1 A;  2KE1 A;  2L75 A;  5LKT A;  2UZG A;  2ECG A;  3N9P A;  5G04 B;  4L58 A;  2PNX A;  5B75 A;  3U5N A;  5FEY A;  5KH3 A;  4V3K C;  4AYC A;  5D1K B;  4A49 A;  4PTB A;  1IYM A;  5C13 A;  4C9Z A;  2FSA A;  5B79 A;  4UP0 A;  3LQH A;  3ZYQ A;  2RSD A;  2KGI A;  5DKA A;  4N4F A;  3EB5 A;  2VPB A;  1ZBD B;  4WZ0 A;  2EGP A;  2KGG A;  4YAD A;  2YHN A;  2F6J A;  5H1U A;  2L43 A;  3PUR A;  4GNF A;  3KV5 A;  4I7B A;  4F52 B;  4W4U A;  1WEV A;  3N9L A;  2Y43 A;  2G43 A;  5J3X A;  4AP4 A;  1WIL A;  1N87 A;  3U5O A;  1FBV A;  1CHC A;  2KYU A;  4IC2 A;  2K17 A;  2YUR A;  3MHS A;  3MHH A;  2E6R A;  2YU4 A;  2D8S A;  2CKL B;  4YAB A;  3O33 A;  3ZPV 1;  1Z2Q A;  1LDK C;  3KV6 A;  4Q6F A;  4NN2 A;  2VPG A;  2VP7 A;  2KFT A;  1T1H A;  1X4U A;  3HCS A;  2KWK A;  3GL6 A;  2ECV A;  2BAY A;  3ASL A;  4MVT A;  5EYA F;  5JG6 A;  4P5O B;  2ZET C;  5B77 A;  1V87 A;  5LKX A;  1VFY A;  4LLB A;  4YAT A;  1F62 A;  2MNZ A;  1HYJ A;  2F6N A;  2ECJ A;  3O35 A;  1E4U A;  2YSJ A;  4GNE A;  4LJN A;  4X3G A;  2LRI C;  3N9M A;  3L1Z B;  2YQM A;  1X4J A;  3U5P A;  3O37 A;  5H9M A;  4O64 A;  5TDW A;  2CT2 A;  3L11 A;  4BBQ A;  2K1J A;  5G0F A;  2M1R A;  3O7A A;  2KIZ A;  2MA5 A;  2FUU A;  4R8P K;  3L1X A;  2C2L A;  4S3O B;  3LQJ A;  2ECW A;  5B8D A;  1WEE A;  1WFK A;  3RPG B;  4V3L C;  4UI9 B;  2RI7 A;  2LXH C;  3IHP A;  2LGL A;  2YRE A;  2QIC A;  2VNF A;  5TRB A;  4ZUX U;  2EOD A;  5AIU A;  2KR4 A;  3C5K A;  3ZTG A;  1Z60 A;  3KQI A;  2K16 A;  2FUI A;  4FO9 A;  4B7Y C;  3NG2 A;  2VJF A;  3I2D A;  4TKP B;  4YBM A;  2G6Q A;  2KU3 A;  5AIT A;  2YQL A;  4LK9 A;  1XWH A;  3PHD A;  2ECN A;  2Y1M A;  4UP5 A;  2M3H A;  2K4D A;  4R2Y A;  4FJC A;  4AYC B;  4QF2 A;  4YC9 A;  3N9N A;  5KH7 A;  2LN0 A;  3LQI A;  4GND A;  1FP0 A;  4YAX A;  3U5M A;  4IC3 A;  3HCU A;  4WZ2 A;  4QF3 A;  3HTK C;  3RTR B;  3KNV A;  4A4B A;  2YYR A;  2NAA A;  4I7C A;  3RPG C;  5B78 A;  3M62 A;  2G45 A;  1WEQ A;  3QZV A;  4AVX A;  2I50 A;  2IDA A;  4YBT A;  2LGV A;  2JMJ A;  3SOW A;  1WEO A;  2F42 A;  1WIM A;  3VK6 A;  2H0D A;  4ZQL A;  2MUM A;  3ZVY A;  2HDP A;  2C2V S;  2L5U A;  1Z6U A;  1WGM A;  3SOX A;  3DQV R;  4A4C A;  1BOR A;  3N9Q A;  2VJE A;  2HYE D;  2LGG A;  2LDR A;  3PUQ A;  1JM7 A;  1K2F A;  2M85 A;  1JOC A;  1HYI A;  5TBN A;  2LQ6 A;  2JRJ A;  3HCT A;  3FL2 A;  2MNY A;  1VD4 A;  4CCG X;  2YT5 A;  4B86 C;  2MD7 B;  2PUY A;  1G25 A;  2YW8 A;  3LRQ A; 
#chains in the Genus database with same CATH topology
 3FAN A;  1WES A;  2VPE A;  3O34 A;  4LKA A;  2JMI A;  2KRE A;  2KWO A;  1U6G B;  2IQJ A;  2ECT A;  2MT5 A;  3SOU A;  5SVX A;  4LAD B;  4A0C D;  2L7P A;  5G05 B;  3LVQ E;  2AN6 A;  2EXU A;  1RMD A;  5TAB A;  2YSM A;  3GV4 A;  2JMD A;  1X4I A;  2YHO A;  2E61 A;  2KWJ A;  3ZPV E;  5KH9 A;  4YBS A;  2VJF B;  2VPD A;  2EGM A;  4ZDT A;  3ZNI A;  4WZ3 B;  5C11 A;  4AUQ B;  3KDE C;  4FK5 A;  1MM3 A;  2QIZ A;  2D8U A;  2DX8 A;  5LKZ A;  1WEU A;  3EB6 A;  2CSZ A;  4GB0 A;  3O70 A;  3V43 A;  4S3O C;  5LCW B;  2CKL A;  2DJA A;  5B76 A;  3O47 A;  5H1T A;  3SHB A;  1DVP A;  4WA6 A;  2M6M A;  5TDR A;  3O36 A;  3C6W A;  3DPL R;  3N9O A;  2CSY A;  5LKU A;  2QJ0 A;  4MSX A;  4OGE A;  1LDJ B;  1VYX A;  4N3W A;  1WEW A;  2LXP C;  4CA1 A;  2L80 A;  2OXQ C;  4GNG A;  2YUC A;  3FJU B;  1MM2 A;  2MA6 A;  5FB1 A;  2LV9 A;  5D1M B;  2JUN A;  4XI1 A;  3H7H A;  1WEN A;  2LGK A;  4R7E A;  5H1V A;  2H0D B;  2MD8 C;  2CRW A;  2Y1N A;  4H9D A;  2KWN A;  3M99 A;  4BHW A;  4PPE A;  5D1L B;  5FB0 A;  2XEU A;  2ECI A;  2L0B A;  3ZVZ B;  2FD4 A;  5DIN A;  1WEM A;  1WE9 A;  2MIQ A;  3M63 A;  4I7D A;  5I3L A;  2VJE B;  3T7L A;  4FIP A;  5FER A;  2EA6 A;  3T6R A;  4Z0O A;  2E6S A;  2XOY A;  4L7X A;  1WEP A;  1JM7 B;  2XB1 A;  2KE1 A;  2L75 A;  5LKT A;  2UZG A;  2ECG A;  3N9P A;  5G04 B;  4L58 A;  3LVR E;  2PNX A;  5SVY A;  5B75 A;  3U5N A;  5FEY A;  5KH3 A;  4O62 A;  4V3K C;  4AYC A;  5D1K B;  4A49 A;  4PTB A;  3DDT A;  1IYM A;  5C13 A;  2LAU A;  4C9Z A;  2FSA A;  5B79 A;  4UP0 A;  3LQH A;  3ZYQ A;  2RSD A;  2KGI A;  2XOC A;  3LJU X;  5DKA A;  4N4F A;  3EB5 A;  4OGC A;  2VPB A;  1ZBD B;  2FFW A;  4WZ0 A;  2EGP A;  2KGG A;  5K3Q A;  3E2D A;  4YAD A;  2YHN A;  2F6J A;  5H1U A;  2L43 A;  3PUR A;  4GNF A;  3KV5 A;  4I7B A;  4F52 B;  4W4U A;  1WEV A;  3N9L A;  2Y43 A;  2G43 A;  5J3X A;  4AP4 A;  1WIL A;  1N87 A;  3U5O A;  1FBV A;  1CHC A;  2KYU A;  4IC2 A;  2K17 A;  2YUR A;  3MHS A;  3MHH A;  2E6R A;  2YU4 A;  3DWD A;  2D8S A;  2CKL B;  4YAB A;  3O33 A;  3ZPV 1;  1Z2Q A;  1LDK C;  2OWA A;  3KV6 A;  4Q6F A;  4NN2 A;  2VPG A;  2VP7 A;  2KFT A;  1T1H A;  1X4U A;  3HCS A;  2KWK A;  3GL6 A;  2ECV A;  2BAY A;  3ASL A;  3FM8 C;  4MVT A;  5EYA F;  5JG6 A;  4P5O B;  2ZET C;  5B77 A;  1V87 A;  5LKX A;  1VFY A;  4LLB A;  4YAT A;  1F62 A;  2MNZ A;  1HYJ A;  2F6N A;  2ECJ A;  2B0O E;  3O35 A;  1E4U A;  2YSJ A;  4GNE A;  4LJN A;  3FEH A;  4X3G A;  2DSM A;  2LRI C;  2CON A;  3N9M A;  3L1Z B;  2YQM A;  1X4J A;  3U5P A;  2KKX A;  2MKE A;  3O37 A;  5H9M A;  4O64 A;  5TDW A;  5SVI A;  2CT2 A;  3L11 A;  4BBQ A;  2K1J A;  5G0F A;  2M1R A;  3O7A A;  2KIZ A;  2MA5 A;  2FUU A;  4R8P K;  3JUE A;  3L1X A;  2C2L A;  4S3O B;  3LQJ A;  2ECW A;  1DCQ A;  3T9K A;  5B8D A;  1WEE A;  1WFK A;  3RPG B;  4V3L C;  4UI9 B;  2RI7 A;  2LXH C;  3IHP A;  2LGL A;  2YRE A;  2QIC A;  2VNF A;  5TRB A;  4ZUX U;  2EOD A;  3C5K A;  2KR4 A;  5AIU A;  3ZTG A;  1Z60 A;  3KQI A;  2K16 A;  2FUI A;  4FO9 A;  4B7Y C;  3NG2 A;  2VJF A;  3I2D A;  4TKP B;  4YBM A;  2G6Q A;  2XP0 A;  2KU3 A;  5AIT A;  2YVR A;  2YQL A;  4LK9 A;  1XWH A;  3PHD A;  2ECN A;  2Y1M A;  4UP5 A;  2M3H A;  2K4D A;  4R2Y A;  4FJC A;  4AYC B;  4QF2 A;  4YC9 A;  3N9N A;  5KH7 A;  2LN0 A;  3LQI A;  4GND A;  1FP0 A;  3Q1D A;  3LDY A;  3M7K A;  4YAX A;  3U5M A;  4IC3 A;  3HCU A;  4WZ2 A;  4QF3 A;  2KKY A;  3HTK C;  3RTR B;  4QQ4 A;  2M13 A;  3KNV A;  4Z0R A;  4A4B A;  2YYR A;  2NAA A;  4I7C A;  2JM3 A;  3RPG C;  3M62 A;  2G45 A;  5B78 A;  2P57 A;  1WEQ A;  3QZV A;  4AVX A;  2I50 A;  2IDA A;  4YBT A;  2LGV A;  2JMJ A;  3SOW A;  1WEO A;  2F42 A;  1WIM A;  3VK6 A;  2H0D A;  4ZQL A;  2MUM A;  3ZVY A;  2HDP A;  2C2V S;  3MDB C;  2L5U A;  1Z6U A;  2XOZ A;  1WGM A;  3PLW A;  3SOX A;  3DQV R;  4A4C A;  1BOR A;  3N9Q A;  2VJE A;  2HYE D;  2LGG A;  1MBM A;  2LDR A;  3PUQ A;  3FAO A;  4F1P A;  1JM7 A;  1K2F A;  2M85 A;  1JOC A;  1HYI A;  5TBN A;  2LQ6 A;  2JRJ A;  3HCT A;  3FL2 A;  2MNY A;  1VD4 A;  4CCG X;  2YT5 A;  4B86 C;  2CRR A;  2RR4 A;  2CSV A;  2MD7 B;  2PUY A;  5SVI B;  1G25 A;  2YW8 A;  3SUB A;  3LRQ A; 
#chains in the Genus database with same CATH homology
 1WES A;  2VPE A;  3O34 A;  4LKA A;  2JMI A;  2KRE A;  2KWO A;  1U6G B;  2ECT A;  2MT5 A;  3SOU A;  4LAD B;  4A0C D;  5G05 B;  2AN6 A;  1RMD A;  5TAB A;  2YSM A;  3GV4 A;  2JMD A;  1X4I A;  2YHO A;  2KWJ A;  3ZPV E;  5KH9 A;  4YBS A;  2VJF B;  2VPD A;  4ZDT A;  3ZNI A;  4WZ3 B;  5C11 A;  4AUQ B;  4FK5 A;  1MM3 A;  2QIZ A;  2DX8 A;  5LKZ A;  1WEU A;  3EB6 A;  2CSZ A;  4GB0 A;  3O70 A;  3V43 A;  4S3O C;  5LCW B;  2CKL A;  5B76 A;  5H1T A;  3SHB A;  1DVP A;  4WA6 A;  2M6M A;  5TDR A;  3O36 A;  3C6W A;  3DPL R;  3N9O A;  2CSY A;  5LKU A;  2QJ0 A;  4MSX A;  1LDJ B;  1VYX A;  4N3W A;  1WEW A;  2LXP C;  4CA1 A;  2L80 A;  2OXQ C;  4GNG A;  2YUC A;  1MM2 A;  2MA6 A;  5FB1 A;  2LV9 A;  5D1M B;  4XI1 A;  1WEN A;  2LGK A;  4R7E A;  5H1V A;  2H0D B;  2MD8 C;  2Y1N A;  2KWN A;  3M99 A;  4BHW A;  4PPE A;  5D1L B;  5FB0 A;  2XEU A;  2ECI A;  2L0B A;  3ZVZ B;  5DIN A;  1WEM A;  1WE9 A;  2MIQ A;  3M63 A;  4I7D A;  5I3L A;  2VJE B;  3T7L A;  4FIP A;  5FER A;  2EA6 A;  3T6R A;  2E6S A;  4L7X A;  1WEP A;  1JM7 B;  2XB1 A;  2KE1 A;  2L75 A;  5LKT A;  2UZG A;  2ECG A;  3N9P A;  5G04 B;  4L58 A;  2PNX A;  5B75 A;  3U5N A;  5FEY A;  5KH3 A;  4V3K C;  4AYC A;  5D1K B;  4A49 A;  4PTB A;  1IYM A;  5C13 A;  4C9Z A;  2FSA A;  5B79 A;  4UP0 A;  3LQH A;  3ZYQ A;  2RSD A;  2KGI A;  5DKA A;  4N4F A;  3EB5 A;  2VPB A;  1ZBD B;  4WZ0 A;  2EGP A;  2KGG A;  4YAD A;  2YHN A;  2F6J A;  5H1U A;  2L43 A;  3PUR A;  4GNF A;  3KV5 A;  4I7B A;  4F52 B;  4W4U A;  1WEV A;  3N9L A;  2Y43 A;  2G43 A;  5J3X A;  4AP4 A;  1WIL A;  1N87 A;  3U5O A;  1FBV A;  1CHC A;  2KYU A;  4IC2 A;  2K17 A;  2YUR A;  3MHS A;  3MHH A;  2E6R A;  2YU4 A;  2D8S A;  2CKL B;  4YAB A;  3O33 A;  3ZPV 1;  1Z2Q A;  1LDK C;  3KV6 A;  4Q6F A;  4NN2 A;  2VPG A;  2VP7 A;  2KFT A;  1T1H A;  1X4U A;  3HCS A;  2KWK A;  3GL6 A;  2ECV A;  2BAY A;  3ASL A;  4MVT A;  5EYA F;  5JG6 A;  4P5O B;  2ZET C;  5B77 A;  1V87 A;  5LKX A;  1VFY A;  4LLB A;  4YAT A;  1F62 A;  2MNZ A;  1HYJ A;  2F6N A;  2ECJ A;  3O35 A;  1E4U A;  2YSJ A;  4GNE A;  4LJN A;  4X3G A;  2LRI C;  3N9M A;  3L1Z B;  2YQM A;  1X4J A;  3U5P A;  3O37 A;  5H9M A;  4O64 A;  5TDW A;  2CT2 A;  3L11 A;  4BBQ A;  2K1J A;  5G0F A;  2M1R A;  3O7A A;  2KIZ A;  2MA5 A;  2FUU A;  4R8P K;  3L1X A;  2C2L A;  4S3O B;  3LQJ A;  2ECW A;  5B8D A;  1WEE A;  1WFK A;  3RPG B;  4V3L C;  4UI9 B;  2RI7 A;  2LXH C;  3IHP A;  2LGL A;  2YRE A;  2QIC A;  2VNF A;  5TRB A;  4ZUX U;  2EOD A;  5AIU A;  2KR4 A;  3C5K A;  3ZTG A;  1Z60 A;  3KQI A;  2K16 A;  2FUI A;  4FO9 A;  4B7Y C;  3NG2 A;  2VJF A;  3I2D A;  4TKP B;  4YBM A;  2G6Q A;  2KU3 A;  5AIT A;  2YQL A;  4LK9 A;  1XWH A;  3PHD A;  2ECN A;  2Y1M A;  4UP5 A;  2M3H A;  2K4D A;  4R2Y A;  4FJC A;  4AYC B;  4QF2 A;  4YC9 A;  3N9N A;  5KH7 A;  2LN0 A;  3LQI A;  4GND A;  1FP0 A;  4YAX A;  3U5M A;  4IC3 A;  3HCU A;  4WZ2 A;  4QF3 A;  3HTK C;  3RTR B;  3KNV A;  4A4B A;  2YYR A;  2NAA A;  4I7C A;  3RPG C;  5B78 A;  3M62 A;  2G45 A;  1WEQ A;  3QZV A;  4AVX A;  2I50 A;  2IDA A;  4YBT A;  2LGV A;  2JMJ A;  3SOW A;  1WEO A;  2F42 A;  1WIM A;  3VK6 A;  2H0D A;  4ZQL A;  2MUM A;  3ZVY A;  2HDP A;  2C2V S;  2L5U A;  1Z6U A;  1WGM A;  3SOX A;  3DQV R;  4A4C A;  1BOR A;  3N9Q A;  2VJE A;  2HYE D;  2LGG A;  2LDR A;  3PUQ A;  1JM7 A;  1K2F A;  2M85 A;  1JOC A;  1HYI A;  5TBN A;  2LQ6 A;  2JRJ A;  3HCT A;  3FL2 A;  2MNY A;  1VD4 A;  4CCG X;  2YT5 A;  4B86 C;  2MD7 B;  2PUY A;  1G25 A;  2YW8 A;  3LRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...