2P57A

Gap domain of znf289, an id1-regulated zinc finger protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
124
structure length
124
Chain Sequence
EPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GAP domain of ZNF289, an ID1-regulated zinc finger protein
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords GTPase-activating protein ZNF289
total genus 43
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2p57A00
3SUBA 3MDBC 1DCQA 3LVQE 3FEHA 3JUEA 4F1PA 3T9KA 3LVRE 3DWDA 3FM8C 2CRRA 2B0OE 3LJUX 2CRWA 2OWAA 3O47A 2IQJA 2P57A
chains in the Genus database with same CATH superfamily
1V87A 3PHDA 2MA5A 2HYED 4A49A 2MIQA 5I3LA 3FANA 4Q6FA 2VPDA 5B75A 4B86C 2AN6A 1WE9A 5DKAA 4MSXA 1ZBDB 5H9MA 3SOXA 1BORA 4GNFA 4PTBA 5EYAF 2MNZA 3C5KA 1WEUA 2KWJA 4L7XA 2XB1A 5LKXA 1DCQA 5D1KB 4AUQB 3U5PA 5D1LB 2OWAA 2C2VS 4PPEA 2MUMA 4X3GA 2ECGA 1X4IA 1E4UA 4GNDA 2P57A 4V3LC 2YHNA 2MD8C 4YATA 3HTKC 4L58A 2L75A 4IC2A 2K16A 3T7LA 5JG6A 2E61A 3DDTA 2OXQC 2YYRA 3GL6A 5G05B 3M63A 4F52B 3LJUX 5B8DA 2EA6A 5SVIA 4CCGX 3N9NA 4R8PK 3O70A 1FBVA 1MBMA 4WZ3B 3DWDA 3ZPV1 5TRBA 2G6QA 1U6GB 2MA6A 2JUNA 3JUEA 5FERA 1Z2QA 4YAXA 2EGMA 1WIMA 3KNVA 1JM7B 4I7DA 3O37A 2LXPC 2YW8A 3U5MA 2FD4A 2DX8A 2M85A 2YQMA 2CSVA 5LKTA 3MHHA 1WENA 3U5NA 2K1JA 4WA6A 3SHBA 3ASLA 2LQ6A 2PNXA 2YSJA 2LV9A 3N9QA 5FB0A 5KH9A 4YABA 5B76A 5H1TA 2KIZA 4UP0A 4R7EA 5TABA 2KR4A 4O64A 4CA1A 5FB1A 1WILA 5TBNA 2YREA 4N4FA 2KWKA 2LN0A 3U5OA 3ZVYA 2FUIA 4P5OB 5C11A 1JOCA 4FK5A 2LRIC 3M99A 2YUCA 3N9MA 2ECIA 3MHSA 4ZQLA 4YC9A 1F62A 4Z0OA 2LGKA 3O33A 2L0BA 2F6JA 3KV5A 2EODA 3L1XA 3O36A 4OGCA 4TKPB 2KGGA 2K4DA 5TDWA 2MNYA 1JM7A 1X4JA 2RR4A 4A0CD 3LQHA 4F1PA 2UZGA 2G43A 2RSDA 1LDJB 1WEEA 2D8SA 5C13A 2LGLA 3GV4A 4YBTA 1VYXA 5G04B 4UP5A 5KH7A 3E2DA 4WZ0A 2K17A 4LKAA 5DINA 5SVIB 5SVYA 3SOUA 3LVRE 4GNGA 4YADA 2YSMA 1WGMA 2Y43A 3ZNIA 3RPGB 2XOYA 2VJFB 3O34A 5B79A 2KKYA 5B78A 2KWOA 3HCSA 1T1HA 2KU3A 2PUYA 2H0DA 4LLBA 2VJEB 1VD4A 5B77A 1WESA 2C2LA 3ZYQA 5KH3A 4FIPA 3ZPVE 4OGEA 2XOCA 3KV6A 5AITA 4YBSA 2YT5A 3FM8C 2EGPA 4ZDTA 3Q1DA 2KKXA 3V43A 4XI1A 3ZTGA 3M62A 2XOZA 2YURA 2KWNA 1WEPA 2ECNA 2MT5A 3FL2A 4ZUXU 1MM3A 1WEMA 2CT2A 3FJUB 3IHPA 4AVXA 5G0FA 3LDYA 2KFTA 5AIUA 2RI7A 4A4CA 4LADB 3O47A 2JRJA 2LGVA 3M7KA 3DPLR 2F6NA 1K2FA 1MM2A 4QF3A 2H0DB 1LDKC 2KE1A 2D8UA 2VJEA 1IYMA 2ECTA 2Y1NA 4AYCB 1G25A 3SOWA 4H9DA 5LCWB 2CRRA 3ZVZB 3LRQA 1WFKA 3O35A 4YBMA 3EB5A 1DVPA 2VJFA 4I7BA 3C6WA 2ECWA 1VFYA 1WEOA 2BAYA 2YQLA 3N9LA 2NAAA 4BHWA 2ECJA 2ECVA 3PLWA 2CONA 3RTRB 2E6SA 3FEHA 2VPGA 3QZVA 4FJCA 4C9ZA 1Z6UA 2DSMA 3EB6A 3FAOA 3I2DA 2MD7B 2I50A 3KQIA 2G45A 2CKLB 2F42A 4GNEA 2QJ0A 2LXHC 1CHCA 3PURA 1WEWA 2KYUA 3L1ZB 3L11A 3NG2A 2IQJA 4B7YC 1RMDA 4WZ2A 5LKZA 1XWHA 2FSAA 1WEQA 2L80A 3T9KA 4A4BA 4AP4A 2VPBA 5H1UA 2EXUA 3MDBC 2VPEA 3VK6A 2L5UA 4LJNA 3LQIA 5K3QA 1Z60A 2VNFA 5D1MB 2B0OE 2LGGA 2CRWA 4W4UA 3T6RA 2M1RA 2CSZA 4QF2A 2XP0A 2XEUA 2L7PA 1FP0A 2LDRA 3N9OA 2M6MA 2JMJA 2DJAA 2M3HA 1HYJA 4I7CA 1N87A 2QIZA 2FFWA 2VP7A 2FUUA 2Y1MA 3H7HA 2IDAA 2LAUA 5H1VA 2E6RA 3RPGC 2JMIA 3HCTA 2CSYA 2YU4A 4N3WA 5TDRA 4Z0RA 5FEYA 4AYCA 2M13A 2HDPA 5J3XA 4NN2A 3DQVR 4S3OB 2JM3A 4GB0A 3PUQA 3LQJA 4IC3A 4O62A 2QICA 4S3OC 3SUBA 4MVTA 2CKLA 2MKEA 3N9PA 4QQ4A 4BBQA 4V3KC 4FO9A 2ZETC 4R2YA 3LVQE 1HYIA 2YHOA 4UI9B 5SVXA 1X4UA 1WEVA 2L43A 2KREA 3O7AA 2JMDA 4LK9A 3HCUA 3KDEC 2KGIA 2YVRA 5LKUA
chains in the Genus database with same CATH topology
2CONA 3E2DA 4QQ4A 4OGCA 3FEHA 3FJUB 2XP0A 2FD4A 5SVIB 5SVYA 3LJUX 4Z0RA 2L7PA 3LVRE 2YREA 2M13A 5SVIA 4OGEA 2D8UA 2XOCA 2DJAA 2CSVA 3LVQE 3LDYA 2RR4A 2XOYA 4H9DA 3T9KA 3DWDA 3FM8C 2CRRA 2JM3A 4F1PA 5SVXA 2FFWA 2P57A 4O62A 2EXUA 3MDBC 3Q1DA 1DCQA 2KKYA 2JUNA 2KKXA 3JUEA 3H7HA 2OWAA 2EGMA 2LAUA 3O47A 4Z0OA 2XOZA 3SUBA 5K3QA 3M7KA 3KDEC 2YVRA 2B0OE 2E61A 2CRWA 3DDTA 2IQJA 2MKEA 3PLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SUB A;  3MDB C;  1DCQ A;  3LVQ E;  3FEH A;  3JUE A;  4F1P A;  3T9K A;  3LVR E;  3DWD A;  3FM8 C;  2CRR A;  2B0O E;  3LJU X;  2CRW A;  2OWA A;  3O47 A;  2IQJ A;  2P57 A; 
#chains in the Genus database with same CATH topology
 1V87 A;  3PHD A;  2MA5 A;  2HYE D;  4A49 A;  2MIQ A;  5I3L A;  3FAN A;  4Q6F A;  2VPD A;  5B75 A;  4B86 C;  2AN6 A;  1WE9 A;  5DKA A;  4MSX A;  1ZBD B;  5H9M A;  3SOX A;  1BOR A;  4GNF A;  4PTB A;  5EYA F;  2MNZ A;  3C5K A;  1WEU A;  2KWJ A;  4L7X A;  2XB1 A;  5LKX A;  1DCQ A;  5D1K B;  4AUQ B;  3U5P A;  5D1L B;  2OWA A;  2C2V S;  4PPE A;  2MUM A;  4X3G A;  2ECG A;  1X4I A;  1E4U A;  4GND A;  2P57 A;  4V3L C;  2YHN A;  2MD8 C;  4YAT A;  3HTK C;  4L58 A;  2L75 A;  4IC2 A;  2K16 A;  3T7L A;  5JG6 A;  2E61 A;  3DDT A;  2OXQ C;  2YYR A;  3GL6 A;  5G05 B;  3M63 A;  4F52 B;  3LJU X;  5B8D A;  2EA6 A;  5SVI A;  4CCG X;  3N9N A;  4R8P K;  3O70 A;  1FBV A;  1MBM A;  4WZ3 B;  3DWD A;  3ZPV 1;  5TRB A;  2G6Q A;  1U6G B;  2MA6 A;  2JUN A;  3JUE A;  5FER A;  1Z2Q A;  4YAX A;  2EGM A;  1WIM A;  3KNV A;  1JM7 B;  4I7D A;  3O37 A;  2LXP C;  2YW8 A;  3U5M A;  2FD4 A;  2DX8 A;  2M85 A;  2YQM A;  2CSV A;  5LKT A;  3MHH A;  1WEN A;  3U5N A;  2K1J A;  4WA6 A;  3SHB A;  3ASL A;  2LQ6 A;  2PNX A;  2YSJ A;  2LV9 A;  3N9Q A;  5FB0 A;  5KH9 A;  4YAB A;  5B76 A;  5H1T A;  2KIZ A;  4UP0 A;  4R7E A;  5TAB A;  2KR4 A;  4O64 A;  4CA1 A;  5FB1 A;  1WIL A;  5TBN A;  2YRE A;  4N4F A;  2KWK A;  2LN0 A;  3U5O A;  3ZVY A;  2FUI A;  4P5O B;  5C11 A;  1JOC A;  4FK5 A;  2LRI C;  3M99 A;  2YUC A;  3N9M A;  2ECI A;  3MHS A;  4ZQL A;  4YC9 A;  1F62 A;  4Z0O A;  2LGK A;  3O33 A;  2L0B A;  2F6J A;  3KV5 A;  2EOD A;  3L1X A;  3O36 A;  4OGC A;  4TKP B;  2KGG A;  2K4D A;  5TDW A;  2MNY A;  1JM7 A;  1X4J A;  2RR4 A;  4A0C D;  3LQH A;  4F1P A;  2UZG A;  2G43 A;  2RSD A;  1LDJ B;  1WEE A;  2D8S A;  5C13 A;  2LGL A;  3GV4 A;  4YBT A;  1VYX A;  5G04 B;  4UP5 A;  5KH7 A;  3E2D A;  4WZ0 A;  2K17 A;  4LKA A;  5DIN A;  5SVI B;  5SVY A;  3SOU A;  3LVR E;  4GNG A;  4YAD A;  2YSM A;  1WGM A;  2Y43 A;  3ZNI A;  3RPG B;  2XOY A;  2VJF B;  3O34 A;  5B79 A;  2KKY A;  5B78 A;  2KWO A;  3HCS A;  1T1H A;  2KU3 A;  2PUY A;  2H0D A;  4LLB A;  2VJE B;  1VD4 A;  5B77 A;  1WES A;  2C2L A;  3ZYQ A;  5KH3 A;  4FIP A;  3ZPV E;  4OGE A;  2XOC A;  3KV6 A;  5AIT A;  4YBS A;  2YT5 A;  3FM8 C;  2EGP A;  4ZDT A;  3Q1D A;  2KKX A;  3V43 A;  4XI1 A;  3ZTG A;  3M62 A;  2XOZ A;  2YUR A;  2KWN A;  1WEP A;  2ECN A;  2MT5 A;  3FL2 A;  4ZUX U;  1MM3 A;  1WEM A;  2CT2 A;  3FJU B;  3IHP A;  4AVX A;  5G0F A;  3LDY A;  2KFT A;  5AIU A;  2RI7 A;  4A4C A;  4LAD B;  3O47 A;  2JRJ A;  2LGV A;  3M7K A;  3DPL R;  2F6N A;  1K2F A;  1MM2 A;  4QF3 A;  2H0D B;  1LDK C;  2KE1 A;  2D8U A;  2VJE A;  1IYM A;  2ECT A;  2Y1N A;  4AYC B;  1G25 A;  3SOW A;  4H9D A;  5LCW B;  2CRR A;  3ZVZ B;  3LRQ A;  1WFK A;  3O35 A;  4YBM A;  3EB5 A;  1DVP A;  2VJF A;  4I7B A;  3C6W A;  2ECW A;  1VFY A;  1WEO A;  2BAY A;  2YQL A;  3N9L A;  2NAA A;  4BHW A;  2ECJ A;  2ECV A;  3PLW A;  2CON A;  3RTR B;  2E6S A;  3FEH A;  2VPG A;  3QZV A;  4FJC A;  4C9Z A;  1Z6U A;  2DSM A;  3EB6 A;  3FAO A;  3I2D A;  2MD7 B;  2I50 A;  3KQI A;  2G45 A;  2CKL B;  2F42 A;  4GNE A;  2QJ0 A;  2LXH C;  1CHC A;  3PUR A;  1WEW A;  2KYU A;  3L1Z B;  3L11 A;  3NG2 A;  2IQJ A;  4B7Y C;  1RMD A;  4WZ2 A;  5LKZ A;  1XWH A;  2FSA A;  1WEQ A;  2L80 A;  3T9K A;  4A4B A;  4AP4 A;  2VPB A;  5H1U A;  2EXU A;  3MDB C;  2VPE A;  3VK6 A;  2L5U A;  4LJN A;  3LQI A;  5K3Q A;  1Z60 A;  2VNF A;  5D1M B;  2B0O E;  2LGG A;  2CRW A;  4W4U A;  3T6R A;  2M1R A;  2CSZ A;  4QF2 A;  2XP0 A;  2XEU A;  2L7P A;  1FP0 A;  2LDR A;  3N9O A;  2M6M A;  2JMJ A;  2DJA A;  2M3H A;  1HYJ A;  4I7C A;  1N87 A;  2QIZ A;  2FFW A;  2VP7 A;  2FUU A;  2Y1M A;  3H7H A;  2IDA A;  2LAU A;  5H1V A;  2E6R A;  3RPG C;  2JMI A;  3HCT A;  2CSY A;  2YU4 A;  4N3W A;  5TDR A;  4Z0R A;  5FEY A;  4AYC A;  2M13 A;  2HDP A;  5J3X A;  4NN2 A;  3DQV R;  4S3O B;  2JM3 A;  4GB0 A;  3PUQ A;  3LQJ A;  4IC3 A;  4O62 A;  2QIC A;  4S3O C;  3SUB A;  4MVT A;  2CKL A;  2MKE A;  3N9P A;  4QQ4 A;  4BBQ A;  4V3K C;  4FO9 A;  2ZET C;  4R2Y A;  3LVQ E;  1HYI A;  2YHO A;  4UI9 B;  5SVX A;  1X4U A;  1WEV A;  2L43 A;  2KRE A;  3O7A A;  2JMD A;  4LK9 A;  3HCU A;  3KDE C;  2KGI A;  2YVR A;  5LKU A; 
#chains in the Genus database with same CATH homology
 2CON A;  3E2D A;  4QQ4 A;  4OGC A;  3FEH A;  3FJU B;  2XP0 A;  2FD4 A;  5SVI B;  5SVY A;  3LJU X;  4Z0R A;  2L7P A;  3LVR E;  2YRE A;  2M13 A;  5SVI A;  4OGE A;  2D8U A;  2XOC A;  2DJA A;  2CSV A;  3LVQ E;  3LDY A;  2RR4 A;  2XOY A;  4H9D A;  3T9K A;  3DWD A;  3FM8 C;  2CRR A;  2JM3 A;  4F1P A;  5SVX A;  2FFW A;  2P57 A;  4O62 A;  2EXU A;  3MDB C;  3Q1D A;  1DCQ A;  2KKY A;  2JUN A;  2KKX A;  3JUE A;  3H7H A;  2OWA A;  2EGM A;  2LAU A;  3O47 A;  4Z0O A;  2XOZ A;  3SUB A;  5K3Q A;  3M7K A;  3KDE C;  2YVR A;  2B0O E;  2E61 A;  2CRW A;  3DDT A;  2IQJ A;  2MKE A;  3PLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...