2P57A

Gap domain of znf289, an id1-regulated zinc finger protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
124
structure length
124
Chain Sequence
EPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase-activating protein ZNF289
publication title GAP domain of ZNF289, an ID1-regulated zinc finger protein
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 43
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2p57A00
3LVRE 2CRWA 1DCQA 3SUBA 3FEHA 3T9KA 2IQJA 3LJUX 2OWAA 2P57A 4F1PA 2CRRA 2B0OE 3FM8C 3DWDA 3O47A 3LVQE 3JUEA 3MDBC
chains in the Genus database with same CATH superfamily
2E6RA 2LXPC 1WEWA 3HCTA 2C2LA 2HDPA 1DVPA 1U6GB 2D8UA 3M99A 3HCSA 2YREA 3I2DA 2L0BA 2LGVA 2F42A 5DKAA 4IC2A 2YVRA 2MT5A 1G25A 5LCWB 2YHNA 3KQIA 4GNFA 2KGIA 2FUIA 4AVXA 2FUUA 2L80A 3PUQA 3MHSA 2EGMA 5JG6A 2OWAA 2LQ6A 4Z0OA 5G0FA 3SOUA 4UP0A 4WZ3B 5TABA 2L7PA 2XP0A 3H7HA 5B79A 1WFKA 1MM2A 3DQVR 2PNXA 5D1LB 5SVIA 1WENA 2XEUA 2DX8A 1WEUA 4A4CA 2BAYA 2KWKA 4QQ4A 3ZNIA 2XOZA 2ECNA 1HYIA 2RR4A 3T6RA 2B0OE 2ECWA 4ZQLA 4ZUXU 1Z2QA 3NG2A 3C6WA 3O34A 4C9ZA 1WE9A 1E4UA 2JMDA 2E6SA 2JMIA 2OXQC 2XB1A 5SVIB 5I3LA 3ZPV1 4QF2A 1WGMA 2QIZA 3PHDA 2AN6A 4MSXA 3EB6A 4R7EA 2F6JA 3T7LA 3ZVZB 5B76A 1ZBDB 2YU4A 3FM8C 2RSDA 5J3XA 2KR4A 4A0CD 2VJEA 3QZVA 3LQIA 1WEQA 4YBTA 5K3QA 3FEHA 5H1TA 2KREA 3O33A 2K4DA 4MVTA 4V3LC 1FBVA 2NAAA 3DWDA 4QF3A 5KH3A 2G6QA 4CCGX 3U5PA 5FERA 2C2VS 2JMJA 4PTBA 2CSZA 5D1KB 2KWOA 2M6MA 3Q1DA 5H9MA 3DPLR 2YUCA 2LRIC 2VPEA 2ZETC 2CSVA 2G45A 5KH9A 1Z6UA 4O62A 2FFWA 4LADB 1IYMA 1VD4A 1X4UA 5C13A 3LQJA 5C11A 2Y43A 5D1MB 2MUMA 2QJ0A 2MIQA 2CKLA 5B75A 2YQMA 1VYXA 3L1XA 3FJUB 2LAUA 3RPGC 1XWHA 2VPGA 1WEVA 2VNFA 5EYAF 4XI1A 4P5OB 5LKTA 4PPEA 3GL6A 5B77A 2CKLB 1F62A 4A49A 3GV4A 4LJNA 1BORA 4GNDA 1FP0A 4LKAA 3LQHA 2IQJA 3LJUX 4S3OC 3KV5A 4YATA 4V3KC 4X3GA 4F1PA 4Z0RA 2M13A 5AIUA 5LKUA 3M62A 2MA6A 3L1ZB 1WILA 2RI7A 2L75A 2KGGA 3ASLA 5TDRA 2KU3A 3U5MA 1WIMA 5SVYA 4FO9A 2ECIA 3LRQA 2L43A 1CHCA 2FD4A 2I50A 1RMDA 4YBMA 1JM7A 5G05B 1T1HA 1LDJB 3N9LA 3U5NA 2EODA 2EGPA 2MA5A 2Y1NA 3L11A 2ECJA 2EXUA 4AP4A 3EB5A 2H0DA 5B8DA 2QICA 3M63A 3SUBA 5FB1A 3SOXA 3PURA 2VJFA 2G43A 1JM7B 2D8SA 4R2YA 1X4IA 2IDAA 2P57A 5FB0A 2ECTA 2F6NA 3N9MA 1K2FA 2YSJA 2K16A 3LVQE 4AYCB 2LGKA 4B86C 3V43A 2H0DB 2XOYA 2M85A 2CRWA 5TRBA 2VPBA 2KFTA 3MHHA 2VJFB 2CONA 4TKPB 2MKEA 2YHOA 4A4BA 4FIPA 3KV6A 4FK5A 4R8PK 1WEPA 2JRJA 3VK6A 3U5OA 1WEOA 4Q6FA 4N3WA 4ZDTA 5SVXA 2LXHC 2YW8A 3LDYA 4BBQA 3ZPVE 5FEYA 1V87A 3JUEA 2ECVA 2K1JA 2CT2A 3N9QA 4YC9A 4YABA 3FAOA 2PUYA 3DDTA 4LLBA 2KKXA 4FJCA 3O47A 2FSAA 2VPDA 2L5UA 4L7XA 4L58A 2HYED 5H1UA 3LVRE 4AUQB 2MNYA 5G04B 2DJAA 1Z60A 2LGLA 2JM3A 2YYRA 5DINA 3KDEC 2YURA 4YBSA 1WESA 2MNZA 1WEEA 2LN0A 3SHBA 2LV9A 3SOWA 2KE1A 3HTKC 4WZ2A 2MD8C 4WA6A 3IHPA 4O64A 4I7BA 1WEMA 4OGEA 1MBMA 1VFYA 4NN2A 1HYJA 3T9KA 4GB0A 2E61A 2XOCA 2YT5A 3ZTGA 2M3HA 2KWNA 1X4JA 5TDWA 3ZVYA 3RTRB 3M7KA 3RPGB 1MM3A 2ECGA 4N4FA 4YAXA 4AYCA 2MD7B 3KNVA 4BHWA 3FANA 1DCQA 3N9NA 2K17A 4GNEA 3O7AA 5TBNA 4IC3A 5KH7A 2KWJA 5B78A 3N9OA 4H9DA 3ZYQA 2UZGA 2M1RA 5AITA 2KYUA 3O70A 3PLWA 4S3OB 4WZ0A 1LDKC 3MDBC 3N9PA 5LKZA 4GNGA 3FL2A 3O36A 2CSYA 1JOCA 3O37A 3HCUA 3O35A 2VP7A 4F52B 4CA1A 4I7DA 2Y1MA 2JUNA 2LGGA 2EA6A 4UP5A 4OGCA 4I7CA 2KKYA 2CRRA 2DSMA 2YSMA 3E2DA 4LK9A 3C5KA 2YQLA 4UI9B 5H1VA 1N87A 2LDRA 2KIZA 5LKXA 4W4UA 4B7YC 2VJEB 4YADA
chains in the Genus database with same CATH topology
3LVRE 5SVIB 2CRWA 1DCQA 5SVIA 3Q1DA 3SUBA 2CONA 2MKEA 4OGEA 5K3QA 2DJAA 2D8UA 3FEHA 3FJUB 2EGMA 2YREA 3T9KA 2JM3A 2FD4A 2CSVA 2IQJA 3LJUX 4H9DA 2JUNA 2OWAA 4QQ4A 3KDEC 2E61A 2XOCA 2LAUA 2P57A 2XOZA 3DDTA 2KKYA 4OGCA 4Z0OA 2M13A 2RR4A 4Z0RA 2CRRA 2B0OE 3E2DA 2KKXA 3FM8C 2FFWA 4O62A 5SVXA 3LDYA 3DWDA 3O47A 2L7PA 2XP0A 2YVRA 3PLWA 3LVQE 4F1PA 3H7HA 3M7KA 2EXUA 3JUEA 2XOYA 3MDBC 5SVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LVR E;  2CRW A;  1DCQ A;  3SUB A;  3FEH A;  3T9K A;  2IQJ A;  3LJU X;  2OWA A;  2P57 A;  4F1P A;  2CRR A;  2B0O E;  3FM8 C;  3DWD A;  3O47 A;  3LVQ E;  3JUE A;  3MDB C; 
#chains in the Genus database with same CATH topology
 2E6R A;  2LXP C;  1WEW A;  3HCT A;  2C2L A;  2HDP A;  1DVP A;  1U6G B;  2D8U A;  3M99 A;  3HCS A;  2YRE A;  3I2D A;  2L0B A;  2LGV A;  2F42 A;  5DKA A;  4IC2 A;  2YVR A;  2MT5 A;  1G25 A;  5LCW B;  2YHN A;  3KQI A;  4GNF A;  2KGI A;  2FUI A;  4AVX A;  2FUU A;  2L80 A;  3PUQ A;  3MHS A;  2EGM A;  5JG6 A;  2OWA A;  2LQ6 A;  4Z0O A;  5G0F A;  3SOU A;  4UP0 A;  4WZ3 B;  5TAB A;  2L7P A;  2XP0 A;  3H7H A;  5B79 A;  1WFK A;  1MM2 A;  3DQV R;  2PNX A;  5D1L B;  5SVI A;  1WEN A;  2XEU A;  2DX8 A;  1WEU A;  4A4C A;  2BAY A;  2KWK A;  4QQ4 A;  3ZNI A;  2XOZ A;  2ECN A;  1HYI A;  2RR4 A;  3T6R A;  2B0O E;  2ECW A;  4ZQL A;  4ZUX U;  1Z2Q A;  3NG2 A;  3C6W A;  3O34 A;  4C9Z A;  1WE9 A;  1E4U A;  2JMD A;  2E6S A;  2JMI A;  2OXQ C;  2XB1 A;  5SVI B;  5I3L A;  3ZPV 1;  4QF2 A;  1WGM A;  2QIZ A;  3PHD A;  2AN6 A;  4MSX A;  3EB6 A;  4R7E A;  2F6J A;  3T7L A;  3ZVZ B;  5B76 A;  1ZBD B;  2YU4 A;  3FM8 C;  2RSD A;  5J3X A;  2KR4 A;  4A0C D;  2VJE A;  3QZV A;  3LQI A;  1WEQ A;  4YBT A;  5K3Q A;  3FEH A;  5H1T A;  2KRE A;  3O33 A;  2K4D A;  4MVT A;  4V3L C;  1FBV A;  2NAA A;  3DWD A;  4QF3 A;  5KH3 A;  2G6Q A;  4CCG X;  3U5P A;  5FER A;  2C2V S;  2JMJ A;  4PTB A;  2CSZ A;  5D1K B;  2KWO A;  2M6M A;  3Q1D A;  5H9M A;  3DPL R;  2YUC A;  2LRI C;  2VPE A;  2ZET C;  2CSV A;  2G45 A;  5KH9 A;  1Z6U A;  4O62 A;  2FFW A;  4LAD B;  1IYM A;  1VD4 A;  1X4U A;  5C13 A;  3LQJ A;  5C11 A;  2Y43 A;  5D1M B;  2MUM A;  2QJ0 A;  2MIQ A;  2CKL A;  5B75 A;  2YQM A;  1VYX A;  3L1X A;  3FJU B;  2LAU A;  3RPG C;  1XWH A;  2VPG A;  1WEV A;  2VNF A;  5EYA F;  4XI1 A;  4P5O B;  5LKT A;  4PPE A;  3GL6 A;  5B77 A;  2CKL B;  1F62 A;  4A49 A;  3GV4 A;  4LJN A;  1BOR A;  4GND A;  1FP0 A;  4LKA A;  3LQH A;  2IQJ A;  3LJU X;  4S3O C;  3KV5 A;  4YAT A;  4V3K C;  4X3G A;  4F1P A;  4Z0R A;  2M13 A;  5AIU A;  5LKU A;  3M62 A;  2MA6 A;  3L1Z B;  1WIL A;  2RI7 A;  2L75 A;  2KGG A;  3ASL A;  5TDR A;  2KU3 A;  3U5M A;  1WIM A;  5SVY A;  4FO9 A;  2ECI A;  3LRQ A;  2L43 A;  1CHC A;  2FD4 A;  2I50 A;  1RMD A;  4YBM A;  1JM7 A;  5G05 B;  1T1H A;  1LDJ B;  3N9L A;  3U5N A;  2EOD A;  2EGP A;  2MA5 A;  2Y1N A;  3L11 A;  2ECJ A;  2EXU A;  4AP4 A;  3EB5 A;  2H0D A;  5B8D A;  2QIC A;  3M63 A;  3SUB A;  5FB1 A;  3SOX A;  3PUR A;  2VJF A;  2G43 A;  1JM7 B;  2D8S A;  4R2Y A;  1X4I A;  2IDA A;  2P57 A;  5FB0 A;  2ECT A;  2F6N A;  3N9M A;  1K2F A;  2YSJ A;  2K16 A;  3LVQ E;  4AYC B;  2LGK A;  4B86 C;  3V43 A;  2H0D B;  2XOY A;  2M85 A;  2CRW A;  5TRB A;  2VPB A;  2KFT A;  3MHH A;  2VJF B;  2CON A;  4TKP B;  2MKE A;  2YHO A;  4A4B A;  4FIP A;  3KV6 A;  4FK5 A;  4R8P K;  1WEP A;  2JRJ A;  3VK6 A;  3U5O A;  1WEO A;  4Q6F A;  4N3W A;  4ZDT A;  5SVX A;  2LXH C;  2YW8 A;  3LDY A;  4BBQ A;  3ZPV E;  5FEY A;  1V87 A;  3JUE A;  2ECV A;  2K1J A;  2CT2 A;  3N9Q A;  4YC9 A;  4YAB A;  3FAO A;  2PUY A;  3DDT A;  4LLB A;  2KKX A;  4FJC A;  3O47 A;  2FSA A;  2VPD A;  2L5U A;  4L7X A;  4L58 A;  2HYE D;  5H1U A;  3LVR E;  4AUQ B;  2MNY A;  5G04 B;  2DJA A;  1Z60 A;  2LGL A;  2JM3 A;  2YYR A;  5DIN A;  3KDE C;  2YUR A;  4YBS A;  1WES A;  2MNZ A;  1WEE A;  2LN0 A;  3SHB A;  2LV9 A;  3SOW A;  2KE1 A;  3HTK C;  4WZ2 A;  2MD8 C;  4WA6 A;  3IHP A;  4O64 A;  4I7B A;  1WEM A;  4OGE A;  1MBM A;  1VFY A;  4NN2 A;  1HYJ A;  3T9K A;  4GB0 A;  2E61 A;  2XOC A;  2YT5 A;  3ZTG A;  2M3H A;  2KWN A;  1X4J A;  5TDW A;  3ZVY A;  3RTR B;  3M7K A;  3RPG B;  1MM3 A;  2ECG A;  4N4F A;  4YAX A;  4AYC A;  2MD7 B;  3KNV A;  4BHW A;  3FAN A;  1DCQ A;  3N9N A;  2K17 A;  4GNE A;  3O7A A;  5TBN A;  4IC3 A;  5KH7 A;  2KWJ A;  5B78 A;  3N9O A;  4H9D A;  3ZYQ A;  2UZG A;  2M1R A;  5AIT A;  2KYU A;  3O70 A;  3PLW A;  4S3O B;  4WZ0 A;  1LDK C;  3MDB C;  3N9P A;  5LKZ A;  4GNG A;  3FL2 A;  3O36 A;  2CSY A;  1JOC A;  3O37 A;  3HCU A;  3O35 A;  2VP7 A;  4F52 B;  4CA1 A;  4I7D A;  2Y1M A;  2JUN A;  2LGG A;  2EA6 A;  4UP5 A;  4OGC A;  4I7C A;  2KKY A;  2CRR A;  2DSM A;  2YSM A;  3E2D A;  4LK9 A;  3C5K A;  2YQL A;  4UI9 B;  5H1V A;  1N87 A;  2LDR A;  2KIZ A;  5LKX A;  4W4U A;  4B7Y C;  2VJE B;  4YAD A; 
#chains in the Genus database with same CATH homology
 3LVR E;  5SVI B;  2CRW A;  1DCQ A;  5SVI A;  3Q1D A;  3SUB A;  2CON A;  2MKE A;  4OGE A;  5K3Q A;  2DJA A;  2D8U A;  3FEH A;  3FJU B;  2EGM A;  2YRE A;  3T9K A;  2JM3 A;  2FD4 A;  2CSV A;  2IQJ A;  3LJU X;  4H9D A;  2JUN A;  2OWA A;  4QQ4 A;  3KDE C;  2E61 A;  2XOC A;  2LAU A;  2P57 A;  2XOZ A;  3DDT A;  2KKY A;  4OGC A;  4Z0O A;  2M13 A;  2RR4 A;  4Z0R A;  2CRR A;  2B0O E;  3E2D A;  2KKX A;  3FM8 C;  2FFW A;  4O62 A;  5SVX A;  3LDY A;  3DWD A;  3O47 A;  2L7P A;  2XP0 A;  2YVR A;  3PLW A;  3LVQ E;  4F1P A;  3H7H A;  3M7K A;  2EXU A;  3JUE A;  2XOY A;  3MDB C;  5SVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...