2P57A

Gap domain of znf289, an id1-regulated zinc finger protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
124
structure length
124
Chain Sequence
EPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GAP domain of ZNF289, an ID1-regulated zinc finger protein
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords GTPase-activating protein ZNF289
total genus 43
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2p57A00
1DCQA 2P57A 3LVRE 3MDBC 3T9KA 3JUEA 3FM8C 2CRRA 3LVQE 4F1PA 2IQJA 3SUBA 3DWDA 3FEHA 2CRWA 3O47A 2B0OE 3LJUX 2OWAA
chains in the Genus database with same CATH superfamily
2XOYA 4YBSA 3U5NA 3DDTA 2KU3A 2LQ6A 2E6SA 3JUEA 2CSYA 1ZBDB 4NN2A 4QF3A 5AIUA 2KREA 2KR4A 3I2DA 3IHPA 5H1TA 3MHSA 3V43A 5B78A 3N9OA 3FL2A 5TDWA 4O62A 3KDEC 3C6WA 5LKZA 4MVTA 3O36A 3ZPVE 2QICA 4GB0A 3LQJA 2ECTA 2VNFA 2QIZA 2VPDA 5LKXA 2LGGA 1WEVA 2I50A 2K1JA 2ECIA 5C13A 4ZUXU 2CT2A 2F42A 3O33A 4V3LC 2CRRA 3HCSA 1FP0A 3ZVZB 4AYCB 2K16A 3ZYQA 1X4IA 2QJ0A 4GNFA 4LK9A 4W4UA 5FB1A 1DCQA 2MUMA 2YHOA 2E6RA 3SOXA 2YQLA 4IC3A 2DSMA 5FB0A 2Y1NA 3RPGC 3PHDA 5G04B 1JM7A 1VFYA 1WEQA 2LN0A 4WZ2A 2MIQA 2UZGA 1F62A 2MNZA 2JMJA 5KH9A 3SHBA 2VJFA 3N9NA 2LXPC 2K4DA 1FBVA 4BBQA 4FIPA 4F1PA 4BHWA 2CKLB 4YAXA 2D8SA 5B79A 3H7HA 2OWAA 4X3GA 2DX8A 4GNGA 4ZQLA 1MBMA 1T1HA 2JUNA 3GL6A 3FEHA 1MM2A 1N87A 4A49A 4B86C 2KWOA 4UP0A 4I7CA 4Q6FA 2M1RA 1JOCA 2JMDA 2YREA 3ZPV1 4YADA 1DVPA 3GV4A 1RMDA 4PPEA 3RTRB 4L58A 5EYAF 2M85A 2K17A 2JRJA 5SVIA 3LDYA 2IQJA 4A4BA 2MD7B 3M7KA 3KQIA 2E61A 3LVQE 3VK6A 2YQMA 2JMIA 1WFKA 2MA5A 4R7EA 1X4JA 2L7PA 4YBTA 2M13A 3N9PA 2VJFB 4FK5A 4LLBA 3KNVA 1HYJA 4YC9A 5H9MA 2YYRA 4AVXA 2LV9A 4R8PK 5G0FA 1G25A 2VPGA 2VPEA 5DKAA 1JM7B 2LRIC 3NG2A 3M63A 2DJAA 1WEEA 2YUCA 2G43A 5AITA 4H9DA 2HYED 5KH7A 2YSJA 4GNEA 3EB5A 1XWHA 3EB6A 4QF2A 3O37A 4N4FA 2LGVA 1X4UA 5J3XA 2EXUA 2RI7A 1MM3A 1WEPA 2KYUA 3O7AA 3PLWA 3DQVR 3RPGB 2FUUA 4AUQB 1WILA 2C2VS 4LADB 4Z0RA 2YT5A 3FM8C 4CCGX 5LCWB 2PNXA 1WEWA 2PUYA 2YURA 2XEUA 1WENA 1BORA 3O70A 4MSXA 5B77A 3DPLR 3M62A 2FFWA 4WA6A 1E4UA 4C9ZA 2ECGA 2KWJA 4A4CA 2EODA 4ZDTA 4TKPB 1WEOA 4UP5A 2RSDA 2ECJA 2ECNA 5DINA 5D1KB 4YATA 2FSAA 3ZNIA 2OXQC 2FUIA 3MHHA 5B75A 3FAOA 3U5MA 5TDRA 2KIZA 4YBMA 4FJCA 2YHNA 2HDPA 5H1UA 1VD4A 3ASLA 5LKUA 2KWNA 3C5KA 3QZVA 3LRQA 4YABA 3L11A 2L75A 5SVYA 4R2YA 2KFTA 3LQHA 3U5PA 2M3HA 2L5UA 2KE1A 2G45A 3FJUB 3ZVYA 2LGKA 2EGPA 2NAAA 4AYCA 3KV5A 3L1XA 2LDRA 5C11A 2MNYA 2KWKA 2RR4A 3N9MA 4GNDA 2CSZA 2CRWA 2LXHC 5B76A 5TBNA 2F6JA 3M99A 3SOWA 4I7BA 2LGLA 2VJEA 2YW8A 2G6QA 2AN6A 2ECVA 1WIMA 2XOZA 2BAYA 4Z0OA 4LJNA 2MKEA 3T9KA 1Z60A 3N9LA 2ZETC 2FD4A 4OGEA 3ZTGA 5KH3A 4O64A 4L7XA 1WGMA 1Z6UA 2D8UA 2F6NA 2ECWA 3T7LA 2M6MA 1LDJB 5G05B 3O34A 3O47A 4S3OB 2KGGA 4QQ4A 2VJEB 3SOUA 5B8DA 5K3QA 1K2FA 4P5OB 2VPBA 2KGIA 4S3OC 1WEMA 1Z2QA 2IDAA 2KKXA 3HCTA 1WESA 4WZ3B 2CKLA 2CONA 3LVRE 2VP7A 4B7YC 2B0OE 2YU4A 4FO9A 5TRBA 4F52B 3L1ZB 3HTKC 5LKTA 1WEUA 1HYIA 2EGMA 1VYXA 2CSVA 5TABA 2YSMA 4A0CD 3MDBC 4WZ0A 1IYMA 5JG6A 4AP4A 3PUQA 2L80A 2MD8C 2JM3A 4V3KC 3T6RA 1U6GB 2XB1A 2L43A 3O35A 5SVXA 5FERA 3N9QA 4PTBA 1CHCA 3KV6A 3Q1DA 5SVIB 4UI9B 3E2DA 5FEYA 5I3LA 4I7DA 2P57A 1WE9A 2MT5A 3SUBA 3FANA 5D1LB 2YVRA 4CA1A 1LDKC 2XOCA 2H0DB 3DWDA 1V87A 4N3WA 4IC2A 3HCUA 3LQIA 2MA6A 2LAUA 4LKAA 2H0DA 2L0BA 2XP0A 3U5OA 2KKYA 3PURA 5D1MB 2C2LA 2Y1MA 4XI1A 4OGCA 5H1VA 2Y43A 2EA6A 3LJUX
chains in the Genus database with same CATH topology
1DCQA 2E61A 2JM3A 3LVRE 5SVYA 4F1PA 3LVQE 2XOCA 4Z0RA 2XOYA 2DJAA 3DWDA 5SVXA 2XOZA 3O47A 2B0OE 3DDTA 3FJUB 2OWAA 3FM8C 3H7HA 4QQ4A 2LAUA 2MKEA 2L7PA 4Z0OA 3T9KA 3JUEA 2CRRA 2XP0A 2YREA 4H9DA 2M13A 5K3QA 2KKYA 2FD4A 4OGEA 2RR4A 3Q1DA 5SVIB 2FFWA 3E2DA 2EGMA 2CSVA 2CRWA 2KKXA 4OGCA 2EXUA 2P57A 2JUNA 3MDBC 5SVIA 3LDYA 2D8UA 2IQJA 3SUBA 4O62A 3FEHA 2CONA 3M7KA 3PLWA 3KDEC 3LJUX 2YVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCQ A;  2P57 A;  3LVR E;  3MDB C;  3T9K A;  3JUE A;  3FM8 C;  2CRR A;  3LVQ E;  4F1P A;  2IQJ A;  3SUB A;  3DWD A;  3FEH A;  2CRW A;  3O47 A;  2B0O E;  3LJU X;  2OWA A; 
#chains in the Genus database with same CATH topology
 2XOY A;  4YBS A;  3U5N A;  3DDT A;  2KU3 A;  2LQ6 A;  2E6S A;  3JUE A;  2CSY A;  1ZBD B;  4NN2 A;  4QF3 A;  5AIU A;  2KRE A;  2KR4 A;  3I2D A;  3IHP A;  5H1T A;  3MHS A;  3V43 A;  5B78 A;  3N9O A;  3FL2 A;  5TDW A;  4O62 A;  3KDE C;  3C6W A;  5LKZ A;  4MVT A;  3O36 A;  3ZPV E;  2QIC A;  4GB0 A;  3LQJ A;  2ECT A;  2VNF A;  2QIZ A;  2VPD A;  5LKX A;  2LGG A;  1WEV A;  2I50 A;  2K1J A;  2ECI A;  5C13 A;  4ZUX U;  2CT2 A;  2F42 A;  3O33 A;  4V3L C;  2CRR A;  3HCS A;  1FP0 A;  3ZVZ B;  4AYC B;  2K16 A;  3ZYQ A;  1X4I A;  2QJ0 A;  4GNF A;  4LK9 A;  4W4U A;  5FB1 A;  1DCQ A;  2MUM A;  2YHO A;  2E6R A;  3SOX A;  2YQL A;  4IC3 A;  2DSM A;  5FB0 A;  2Y1N A;  3RPG C;  3PHD A;  5G04 B;  1JM7 A;  1VFY A;  1WEQ A;  2LN0 A;  4WZ2 A;  2MIQ A;  2UZG A;  1F62 A;  2MNZ A;  2JMJ A;  5KH9 A;  3SHB A;  2VJF A;  3N9N A;  2LXP C;  2K4D A;  1FBV A;  4BBQ A;  4FIP A;  4F1P A;  4BHW A;  2CKL B;  4YAX A;  2D8S A;  5B79 A;  3H7H A;  2OWA A;  4X3G A;  2DX8 A;  4GNG A;  4ZQL A;  1MBM A;  1T1H A;  2JUN A;  3GL6 A;  3FEH A;  1MM2 A;  1N87 A;  4A49 A;  4B86 C;  2KWO A;  4UP0 A;  4I7C A;  4Q6F A;  2M1R A;  1JOC A;  2JMD A;  2YRE A;  3ZPV 1;  4YAD A;  1DVP A;  3GV4 A;  1RMD A;  4PPE A;  3RTR B;  4L58 A;  5EYA F;  2M85 A;  2K17 A;  2JRJ A;  5SVI A;  3LDY A;  2IQJ A;  4A4B A;  2MD7 B;  3M7K A;  3KQI A;  2E61 A;  3LVQ E;  3VK6 A;  2YQM A;  2JMI A;  1WFK A;  2MA5 A;  4R7E A;  1X4J A;  2L7P A;  4YBT A;  2M13 A;  3N9P A;  2VJF B;  4FK5 A;  4LLB A;  3KNV A;  1HYJ A;  4YC9 A;  5H9M A;  2YYR A;  4AVX A;  2LV9 A;  4R8P K;  5G0F A;  1G25 A;  2VPG A;  2VPE A;  5DKA A;  1JM7 B;  2LRI C;  3NG2 A;  3M63 A;  2DJA A;  1WEE A;  2YUC A;  2G43 A;  5AIT A;  4H9D A;  2HYE D;  5KH7 A;  2YSJ A;  4GNE A;  3EB5 A;  1XWH A;  3EB6 A;  4QF2 A;  3O37 A;  4N4F A;  2LGV A;  1X4U A;  5J3X A;  2EXU A;  2RI7 A;  1MM3 A;  1WEP A;  2KYU A;  3O7A A;  3PLW A;  3DQV R;  3RPG B;  2FUU A;  4AUQ B;  1WIL A;  2C2V S;  4LAD B;  4Z0R A;  2YT5 A;  3FM8 C;  4CCG X;  5LCW B;  2PNX A;  1WEW A;  2PUY A;  2YUR A;  2XEU A;  1WEN A;  1BOR A;  3O70 A;  4MSX A;  5B77 A;  3DPL R;  3M62 A;  2FFW A;  4WA6 A;  1E4U A;  4C9Z A;  2ECG A;  2KWJ A;  4A4C A;  2EOD A;  4ZDT A;  4TKP B;  1WEO A;  4UP5 A;  2RSD A;  2ECJ A;  2ECN A;  5DIN A;  5D1K B;  4YAT A;  2FSA A;  3ZNI A;  2OXQ C;  2FUI A;  3MHH A;  5B75 A;  3FAO A;  3U5M A;  5TDR A;  2KIZ A;  4YBM A;  4FJC A;  2YHN A;  2HDP A;  5H1U A;  1VD4 A;  3ASL A;  5LKU A;  2KWN A;  3C5K A;  3QZV A;  3LRQ A;  4YAB A;  3L11 A;  2L75 A;  5SVY A;  4R2Y A;  2KFT A;  3LQH A;  3U5P A;  2M3H A;  2L5U A;  2KE1 A;  2G45 A;  3FJU B;  3ZVY A;  2LGK A;  2EGP A;  2NAA A;  4AYC A;  3KV5 A;  3L1X A;  2LDR A;  5C11 A;  2MNY A;  2KWK A;  2RR4 A;  3N9M A;  4GND A;  2CSZ A;  2CRW A;  2LXH C;  5B76 A;  5TBN A;  2F6J A;  3M99 A;  3SOW A;  4I7B A;  2LGL A;  2VJE A;  2YW8 A;  2G6Q A;  2AN6 A;  2ECV A;  1WIM A;  2XOZ A;  2BAY A;  4Z0O A;  4LJN A;  2MKE A;  3T9K A;  1Z60 A;  3N9L A;  2ZET C;  2FD4 A;  4OGE A;  3ZTG A;  5KH3 A;  4O64 A;  4L7X A;  1WGM A;  1Z6U A;  2D8U A;  2F6N A;  2ECW A;  3T7L A;  2M6M A;  1LDJ B;  5G05 B;  3O34 A;  3O47 A;  4S3O B;  2KGG A;  4QQ4 A;  2VJE B;  3SOU A;  5B8D A;  5K3Q A;  1K2F A;  4P5O B;  2VPB A;  2KGI A;  4S3O C;  1WEM A;  1Z2Q A;  2IDA A;  2KKX A;  3HCT A;  1WES A;  4WZ3 B;  2CKL A;  2CON A;  3LVR E;  2VP7 A;  4B7Y C;  2B0O E;  2YU4 A;  4FO9 A;  5TRB A;  4F52 B;  3L1Z B;  3HTK C;  5LKT A;  1WEU A;  1HYI A;  2EGM A;  1VYX A;  2CSV A;  5TAB A;  2YSM A;  4A0C D;  3MDB C;  4WZ0 A;  1IYM A;  5JG6 A;  4AP4 A;  3PUQ A;  2L80 A;  2MD8 C;  2JM3 A;  4V3K C;  3T6R A;  1U6G B;  2XB1 A;  2L43 A;  3O35 A;  5SVX A;  5FER A;  3N9Q A;  4PTB A;  1CHC A;  3KV6 A;  3Q1D A;  5SVI B;  4UI9 B;  3E2D A;  5FEY A;  5I3L A;  4I7D A;  2P57 A;  1WE9 A;  2MT5 A;  3SUB A;  3FAN A;  5D1L B;  2YVR A;  4CA1 A;  1LDK C;  2XOC A;  2H0D B;  3DWD A;  1V87 A;  4N3W A;  4IC2 A;  3HCU A;  3LQI A;  2MA6 A;  2LAU A;  4LKA A;  2H0D A;  2L0B A;  2XP0 A;  3U5O A;  2KKY A;  3PUR A;  5D1M B;  2C2L A;  2Y1M A;  4XI1 A;  4OGC A;  5H1V A;  2Y43 A;  2EA6 A;  3LJU X; 
#chains in the Genus database with same CATH homology
 1DCQ A;  2E61 A;  2JM3 A;  3LVR E;  5SVY A;  4F1P A;  3LVQ E;  2XOC A;  4Z0R A;  2XOY A;  2DJA A;  3DWD A;  5SVX A;  2XOZ A;  3O47 A;  2B0O E;  3DDT A;  3FJU B;  2OWA A;  3FM8 C;  3H7H A;  4QQ4 A;  2LAU A;  2MKE A;  2L7P A;  4Z0O A;  3T9K A;  3JUE A;  2CRR A;  2XP0 A;  2YRE A;  4H9D A;  2M13 A;  5K3Q A;  2KKY A;  2FD4 A;  4OGE A;  2RR4 A;  3Q1D A;  5SVI B;  2FFW A;  3E2D A;  2EGM A;  2CSV A;  2CRW A;  2KKX A;  4OGC A;  2EXU A;  2P57 A;  2JUN A;  3MDB C;  5SVI A;  3LDY A;  2D8U A;  2IQJ A;  3SUB A;  4O62 A;  3FEH A;  2CON A;  3M7K A;  3PLW A;  3KDE C;  3LJU X;  2YVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...