2P57A

Gap domain of znf289, an id1-regulated zinc finger protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
124
structure length
124
Chain Sequence
EPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords GTPase-activating protein ZNF289
publication title GAP domain of ZNF289, an ID1-regulated zinc finger protein
rcsb
source organism Homo sapiens
total genus 43
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2p57A00
2IQJA 3LVQE 4F1PA 3JUEA 2CRRA 3LVRE 1DCQA 3DWDA 3FEHA 3O47A 2P57A 3MDBC 3T9KA 2B0OE 2CRWA 3FM8C 3SUBA 3LJUX 2OWAA
chains in the Genus database with same CATH superfamily
4O64A 5LKZA 1VFYA 2KREA 2VP7A 2KGGA 2D8SA 3PHDA 5D1KB 2YURA 2CONA 3KQIA 4FJCA 2L5UA 4QQ4A 1MBMA 2L80A 3FEHA 2LAUA 1N87A 2KWKA 3L11A 2B0OE 4I7DA 1MM3A 1LDKC 5B79A 2D8UA 2ECIA 2YU4A 3FANA 3SHBA 1E4UA 1K2FA 5AITA 5B77A 2YW8A 4PPEA 3U5NA 3ASLA 2LGLA 1WESA 3MHSA 3N9PA 2PUYA 3DPLR 5LKUA 3DQVR 2LRIC 2CRWA 2VPDA 4OGEA 5H1UA 2MNYA 3MHHA 1JOCA 2KFTA 2XB1A 1JM7A 4LJNA 1G25A 4UP0A 3LDYA 4YADA 2ECWA 3FJUB 4S3OB 2Y43A 4V3KC 2LDRA 4LADB 2XP0A 2C2LA 2LGGA 5K3QA 2KYUA 3C5KA 4PTBA 5G04B 2CSYA 2YSJA 3L1ZB 3RPGC 2YHOA 3SUBA 4L7XA 3N9OA 4C9ZA 4YAXA 4P5OB 5I3LA 3T7LA 2FUUA 1X4UA 2L0BA 2YREA 4CA1A 2JM3A 2BAYA 4I7CA 2G45A 4YATA 3ZVYA 5SVXA 3VK6A 3KV6A 2MT5A 5TRBA 1WEUA 5TDRA 1WE9A 4H9DA 4I7BA 5C13A 4IC3A 5LCWB 1VD4A 3I2DA 3LRQA 4R7EA 5H1VA 1DCQA 4LKAA 5J3XA 2G43A 5B8DA 2E61A 4WA6A 1WENA 3O36A 3N9QA 4WZ2A 3SOUA 3FL2A 1LDJB 2KWJA 2C2VS 2K17A 4IC2A 4ZDTA 1VYXA 4TKPB 4A0CD 3LVRE 4R8PK 1WEMA 2YQLA 2EODA 2YVRA 2P57A 2E6RA 1WFKA 3O34A 1WEOA 3HCSA 2HYED 2VJEA 1Z6UA 2VJEB 3ZTGA 4UI9B 2JUNA 3LVQE 2MKEA 1WIMA 2DJAA 4GNEA 3ZPVE 3N9MA 2MA5A 2MA6A 3ZPV1 4ZQLA 2KWNA 4V3LC 2CKLA 1HYIA 3KDEC 5FERA 1CHCA 2EGPA 2M13A 4GB0A 3H7HA 2XOYA 2L43A 2UZGA 2VPEA 2K16A 3LJUX 3RPGB 2Y1MA 2YYRA 2RI7A 3IHPA 1JM7B 2XOCA 1FBVA 2MNZA 4A49A 2FSAA 3HTKC 2VPBA 4YBSA 2JRJA 3KV5A 3HCUA 1WEVA 2CRRA 2DX8A 2VNFA 2L7PA 2EA6A 4Z0OA 3NG2A 1Z2QA 2EXUA 5EYAF 3PUQA 3FM8C 1XWHA 3C6WA 2CSZA 2MD7B 1IYMA 4R2YA 1BORA 2MIQA 4XI1A 5D1LB 2F6NA 2I50A 4CCGX 1WEEA 2NAAA 3V43A 4WZ0A 1X4IA 2YQMA 1WEPA 5TBNA 2XEUA 4GNGA 4A4CA 5G0FA 2E6SA 3FAOA 3M63A 4W4UA 5SVYA 2OXQC 3M62A 3U5OA 4LLBA 2DSMA 4QF2A 2KU3A 3GL6A 4LK9A 5B75A 2ECNA 3EB5A 4B86C 2CT2A 2HDPA 2KIZA 3O47A 4MVTA 2YT5A 1DVPA 2L75A 2G6QA 1MM2A 1V87A 2LV9A 4L58A 4GNFA 2MUMA 4NN2A 4N4FA 1WEQA 4Q6FA 4Z0RA 3JUEA 1F62A 2CSVA 5B76A 2ZETC 3DWDA 3ZYQA 4AYCA 5SVIA 3HCTA 5LKXA 2ECJA 5SVIB 5LKTA 2LQ6A 3ZNIA 2Y1NA 3L1XA 1U6GB 2KKXA 4FK5A 4FO9A 3PLWA 2YUCA 5DINA 4F52B 2XOZA 4O62A 2EGMA 3Q1DA 4AUQB 5FB1A 2FD4A 2YSMA 2M85A 3U5MA 4OGCA 1WILA 2M3HA 5TABA 2CKLB 1ZBDB 2ECVA 1Z60A 2ECGA 3LQIA 5H9MA 4YBMA 3O7AA 2MD8C 5D1MB 3N9NA 3LQHA 3M99A 3SOWA 2M6MA 2K1JA 5KH9A 2FFWA 5TDWA 2KKYA 4QF3A 2LXPC 2KWOA 4N3WA 2JMJA 3T6RA 1WEWA 4YABA 3E2DA 4X3GA 3O35A 2KE1A 4BBQA 4F1PA 2VJFA 1T1HA 2LGVA 2VJFB 5JG6A 5KH3A 3O33A 2KR4A 3QZVA 3N9LA 2IDAA 2ECTA 2FUIA 4MSXA 2LN0A 1FP0A 5DKAA 4WZ3B 3LQJA 3MDBC 2AN6A 5G05B 2LGKA 2VPGA 4S3OC 5KH7A 5B78A 1X4JA 3O70A 2IQJA 4BHWA 2RR4A 2QJ0A 3GV4A 2M1RA 2H0DA 2PNXA 2H0DB 5FB0A 4B7YC 4ZUXU 1HYJA 3KNVA 5C11A 2F42A 4YC9A 1RMDA 5AIUA 4AP4A 3RTRB 4GNDA 3M7KA 1WGMA 2K4DA 2JMIA 2LXHC 3DDTA 4UP5A 3U5PA 2YHNA 4A4BA 4AVXA 3O37A 5H1TA 3ZVZB 4YBTA 2F6JA 3PURA 4AYCB 3T9KA 3EB6A 2KGIA 2QIZA 2JMDA 2RSDA 3SOXA 4FIPA 5FEYA 2QICA 2OWAA
chains in the Genus database with same CATH topology
2D8UA 2XOCA 2IQJA 2MKEA 3LVQE 2YREA 2DJAA 4O62A 4F1PA 2EGMA 3FJUB 2RR4A 3M7KA 4Z0RA 2JM3A 3JUEA 3DDTA 2FFWA 2CONA 3Q1DA 2KKYA 2CSVA 2XP0A 2CRRA 2FD4A 3LVRE 1DCQA 2L7PA 3DWDA 4QQ4A 4OGCA 5K3QA 5SVIA 2E61A 2LAUA 2YVRA 3FEHA 4Z0OA 2EXUA 3O47A 2P57A 5SVXA 5SVIB 3KDEC 3MDBC 3T9KA 2B0OE 2M13A 2CRWA 4H9DA 4OGEA 2XOZA 2KKXA 3FM8C 3H7HA 2XOYA 3SUBA 3E2DA 3PLWA 5SVYA 3LJUX 2OWAA 2JUNA 3LDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IQJ A;  3LVQ E;  4F1P A;  3JUE A;  2CRR A;  3LVR E;  1DCQ A;  3DWD A;  3FEH A;  3O47 A;  2P57 A;  3MDB C;  3T9K A;  2B0O E;  2CRW A;  3FM8 C;  3SUB A;  3LJU X;  2OWA A; 
#chains in the Genus database with same CATH topology
 4O64 A;  5LKZ A;  1VFY A;  2KRE A;  2VP7 A;  2KGG A;  2D8S A;  3PHD A;  5D1K B;  2YUR A;  2CON A;  3KQI A;  4FJC A;  2L5U A;  4QQ4 A;  1MBM A;  2L80 A;  3FEH A;  2LAU A;  1N87 A;  2KWK A;  3L11 A;  2B0O E;  4I7D A;  1MM3 A;  1LDK C;  5B79 A;  2D8U A;  2ECI A;  2YU4 A;  3FAN A;  3SHB A;  1E4U A;  1K2F A;  5AIT A;  5B77 A;  2YW8 A;  4PPE A;  3U5N A;  3ASL A;  2LGL A;  1WES A;  3MHS A;  3N9P A;  2PUY A;  3DPL R;  5LKU A;  3DQV R;  2LRI C;  2CRW A;  2VPD A;  4OGE A;  5H1U A;  2MNY A;  3MHH A;  1JOC A;  2KFT A;  2XB1 A;  1JM7 A;  4LJN A;  1G25 A;  4UP0 A;  3LDY A;  4YAD A;  2ECW A;  3FJU B;  4S3O B;  2Y43 A;  4V3K C;  2LDR A;  4LAD B;  2XP0 A;  2C2L A;  2LGG A;  5K3Q A;  2KYU A;  3C5K A;  4PTB A;  5G04 B;  2CSY A;  2YSJ A;  3L1Z B;  3RPG C;  2YHO A;  3SUB A;  4L7X A;  3N9O A;  4C9Z A;  4YAX A;  4P5O B;  5I3L A;  3T7L A;  2FUU A;  1X4U A;  2L0B A;  2YRE A;  4CA1 A;  2JM3 A;  2BAY A;  4I7C A;  2G45 A;  4YAT A;  3ZVY A;  5SVX A;  3VK6 A;  3KV6 A;  2MT5 A;  5TRB A;  1WEU A;  5TDR A;  1WE9 A;  4H9D A;  4I7B A;  5C13 A;  4IC3 A;  5LCW B;  1VD4 A;  3I2D A;  3LRQ A;  4R7E A;  5H1V A;  1DCQ A;  4LKA A;  5J3X A;  2G43 A;  5B8D A;  2E61 A;  4WA6 A;  1WEN A;  3O36 A;  3N9Q A;  4WZ2 A;  3SOU A;  3FL2 A;  1LDJ B;  2KWJ A;  2C2V S;  2K17 A;  4IC2 A;  4ZDT A;  1VYX A;  4TKP B;  4A0C D;  3LVR E;  4R8P K;  1WEM A;  2YQL A;  2EOD A;  2YVR A;  2P57 A;  2E6R A;  1WFK A;  3O34 A;  1WEO A;  3HCS A;  2HYE D;  2VJE A;  1Z6U A;  2VJE B;  3ZTG A;  4UI9 B;  2JUN A;  3LVQ E;  2MKE A;  1WIM A;  2DJA A;  4GNE A;  3ZPV E;  3N9M A;  2MA5 A;  2MA6 A;  3ZPV 1;  4ZQL A;  2KWN A;  4V3L C;  2CKL A;  1HYI A;  3KDE C;  5FER A;  1CHC A;  2EGP A;  2M13 A;  4GB0 A;  3H7H A;  2XOY A;  2L43 A;  2UZG A;  2VPE A;  2K16 A;  3LJU X;  3RPG B;  2Y1M A;  2YYR A;  2RI7 A;  3IHP A;  1JM7 B;  2XOC A;  1FBV A;  2MNZ A;  4A49 A;  2FSA A;  3HTK C;  2VPB A;  4YBS A;  2JRJ A;  3KV5 A;  3HCU A;  1WEV A;  2CRR A;  2DX8 A;  2VNF A;  2L7P A;  2EA6 A;  4Z0O A;  3NG2 A;  1Z2Q A;  2EXU A;  5EYA F;  3PUQ A;  3FM8 C;  1XWH A;  3C6W A;  2CSZ A;  2MD7 B;  1IYM A;  4R2Y A;  1BOR A;  2MIQ A;  4XI1 A;  5D1L B;  2F6N A;  2I50 A;  4CCG X;  1WEE A;  2NAA A;  3V43 A;  4WZ0 A;  1X4I A;  2YQM A;  1WEP A;  5TBN A;  2XEU A;  4GNG A;  4A4C A;  5G0F A;  2E6S A;  3FAO A;  3M63 A;  4W4U A;  5SVY A;  2OXQ C;  3M62 A;  3U5O A;  4LLB A;  2DSM A;  4QF2 A;  2KU3 A;  3GL6 A;  4LK9 A;  5B75 A;  2ECN A;  3EB5 A;  4B86 C;  2CT2 A;  2HDP A;  2KIZ A;  3O47 A;  4MVT A;  2YT5 A;  1DVP A;  2L75 A;  2G6Q A;  1MM2 A;  1V87 A;  2LV9 A;  4L58 A;  4GNF A;  2MUM A;  4NN2 A;  4N4F A;  1WEQ A;  4Q6F A;  4Z0R A;  3JUE A;  1F62 A;  2CSV A;  5B76 A;  2ZET C;  3DWD A;  3ZYQ A;  4AYC A;  5SVI A;  3HCT A;  5LKX A;  2ECJ A;  5SVI B;  5LKT A;  2LQ6 A;  3ZNI A;  2Y1N A;  3L1X A;  1U6G B;  2KKX A;  4FK5 A;  4FO9 A;  3PLW A;  2YUC A;  5DIN A;  4F52 B;  2XOZ A;  4O62 A;  2EGM A;  3Q1D A;  4AUQ B;  5FB1 A;  2FD4 A;  2YSM A;  2M85 A;  3U5M A;  4OGC A;  1WIL A;  2M3H A;  5TAB A;  2CKL B;  1ZBD B;  2ECV A;  1Z60 A;  2ECG A;  3LQI A;  5H9M A;  4YBM A;  3O7A A;  2MD8 C;  5D1M B;  3N9N A;  3LQH A;  3M99 A;  3SOW A;  2M6M A;  2K1J A;  5KH9 A;  2FFW A;  5TDW A;  2KKY A;  4QF3 A;  2LXP C;  2KWO A;  4N3W A;  2JMJ A;  3T6R A;  1WEW A;  4YAB A;  3E2D A;  4X3G A;  3O35 A;  2KE1 A;  4BBQ A;  4F1P A;  2VJF A;  1T1H A;  2LGV A;  2VJF B;  5JG6 A;  5KH3 A;  3O33 A;  2KR4 A;  3QZV A;  3N9L A;  2IDA A;  2ECT A;  2FUI A;  4MSX A;  2LN0 A;  1FP0 A;  5DKA A;  4WZ3 B;  3LQJ A;  3MDB C;  2AN6 A;  5G05 B;  2LGK A;  2VPG A;  4S3O C;  5KH7 A;  5B78 A;  1X4J A;  3O70 A;  2IQJ A;  4BHW A;  2RR4 A;  2QJ0 A;  3GV4 A;  2M1R A;  2H0D A;  2PNX A;  2H0D B;  5FB0 A;  4B7Y C;  4ZUX U;  1HYJ A;  3KNV A;  5C11 A;  2F42 A;  4YC9 A;  1RMD A;  5AIU A;  4AP4 A;  3RTR B;  4GND A;  3M7K A;  1WGM A;  2K4D A;  2JMI A;  2LXH C;  3DDT A;  4UP5 A;  3U5P A;  2YHN A;  4A4B A;  4AVX A;  3O37 A;  5H1T A;  3ZVZ B;  4YBT A;  2F6J A;  3PUR A;  4AYC B;  3T9K A;  3EB6 A;  2KGI A;  2QIZ A;  2JMD A;  2RSD A;  3SOX A;  4FIP A;  5FEY A;  2QIC A;  2OWA A; 
#chains in the Genus database with same CATH homology
 2D8U A;  2XOC A;  2IQJ A;  2MKE A;  3LVQ E;  2YRE A;  2DJA A;  4O62 A;  4F1P A;  2EGM A;  3FJU B;  2RR4 A;  3M7K A;  4Z0R A;  2JM3 A;  3JUE A;  3DDT A;  2FFW A;  2CON A;  3Q1D A;  2KKY A;  2CSV A;  2XP0 A;  2CRR A;  2FD4 A;  3LVR E;  1DCQ A;  2L7P A;  3DWD A;  4QQ4 A;  4OGC A;  5K3Q A;  5SVI A;  2E61 A;  2LAU A;  2YVR A;  3FEH A;  4Z0O A;  2EXU A;  3O47 A;  2P57 A;  5SVX A;  5SVI B;  3KDE C;  3MDB C;  3T9K A;  2B0O E;  2M13 A;  2CRW A;  4H9D A;  4OGE A;  2XOZ A;  2KKX A;  3FM8 C;  3H7H A;  2XOY A;  3SUB A;  3E2D A;  3PLW A;  5SVY A;  3LJU X;  2OWA A;  2JUN A;  3LDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...