2P57A

Gap domain of znf289, an id1-regulated zinc finger protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
124
structure length
124
Chain Sequence
EPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GAP domain of ZNF289, an ID1-regulated zinc finger protein
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords GTPase-activating protein ZNF289
total genus 43
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2p57A00
3MDBC 3FM8C 4F1PA 3LJUX 3LVQE 3O47A 2IQJA 3JUEA 3DWDA 3FEHA 2CRWA 3SUBA 3LVRE 2P57A 3T9KA 1DCQA 2B0OE 2OWAA 2CRRA
chains in the Genus database with same CATH superfamily
5DINA 3JUEA 1DVPA 2I50A 3N9LA 4IC2A 5SVXA 4W4UA 2VP7A 2KE1A 5LKZA 1WE9A 5J3XA 4LJNA 3KQIA 3I2DA 2L5UA 5KH9A 1XWHA 4ZQLA 4FIPA 2KYUA 5H9MA 4Z0OA 2KREA 2M13A 3LQJA 3ZTGA 4QF2A 3FANA 3H7HA 3LVRE 3HTKC 1DCQA 2OXQC 4XI1A 3LQIA 5FERA 5G0FA 1FBVA 1WEPA 3PURA 2LGKA 1E4UA 1F62A 1X4UA 4LLBA 5K3QA 2YU4A 2LAUA 5AITA 3KV6A 4NN2A 4GNFA 2XEUA 1G25A 2CSYA 3N9MA 3KDEC 2M3HA 2E6RA 2FUUA 3HCTA 2D8SA 2ECGA 3M99A 2P57A 1WEUA 2KR4A 1VYXA 3L1ZB 4AYCB 4FO9A 2VPDA 4AVXA 5I3LA 3ZYQA 2G6QA 3M63A 2JRJA 2K4DA 3LDYA 5FB0A 2KKXA 1BORA 3HCSA 3LRQA 2C2LA 3V43A 2CKLB 4WZ0A 2IQJA 2YYRA 3ZVYA 2QJ0A 2LXHC 4YADA 3LJUX 5B8DA 5H1VA 1FP0A 2VNFA 2B0OE 5B76A 1WEVA 5FEYA 2D8UA 1WEQA 2LGVA 3O36A 1JM7A 1N87A 4MSXA 3DDTA 2KGGA 5LKUA 2ECJA 4QQ4A 4V3LC 1MBMA 2MIQA 2KFTA 1LDJB 3FAOA 2EXUA 2FUIA 1VFYA 5D1LB 2LGLA 1WEMA 2M1RA 4R7EA 4WZ3B 4YABA 3O70A 2YHNA 4CA1A 1WEWA 4L7XA 1RMDA 4YBTA 2JMIA 5D1MB 4F1PA 2CSZA 5LKXA 3DWDA 5B75A 2K16A 2ECWA 2H0DB 4YBMA 3M62A 4I7BA 3ZVZB 3N9OA 2UZGA 3ZPV1 2RI7A 2M85A 3SOWA 4YATA 2VJFA 2E6SA 4Q6FA 5TDWA 2MD8C 4O62A 4O64A 5B78A 4A49A 1Z2QA 2JM3A 4LK9A 2G45A 2EGMA 4ZUXU 1WIMA 2KU3A 1IYMA 1WFKA 1MM2A 4UP5A 4TKPB 3GV4A 2LRIC 5TBNA 2K1JA 3ZNIA 3IHPA 4FJCA 1U6GB 2L0BA 2M6MA 2XOCA 3FJUB 1T1HA 2YW8A 1X4JA 2VJEA 3FM8C 2YT5A 3L11A 4S3OB 2KIZA 2LQ6A 5LKTA 3N9PA 4OGEA 1Z60A 2YSJA 4WZ2A 4LKAA 2ECNA 3SOXA 3MHSA 2DSMA 4PTBA 5G04B 1WENA 4N3WA 3T6RA 2YHOA 2DJAA 2KWKA 5DKAA 1X4IA 2DX8A 4YC9A 5H1UA 4B7YC 5KH7A 2E61A 3L1XA 4PPEA 2PUYA 2JUNA 2CKLA 4WA6A 2ZETC 2QICA 2KWOA 4GNEA 5B79A 3O34A 3DQVR 2OWAA 4IC3A 4C9ZA 4L58A 4A4CA 5TABA 4LADB 2G43A 4AUQB 2VPBA 3M7KA 4CCGX 2VPEA 4GNDA 4I7CA 2YQMA 2L80A 3O35A 3PUQA 3SHBA 2JMJA 2L7PA 2ECTA 2QIZA 4OGCA 2YQLA 2LXPC 2RSDA 3KNVA 3T7LA 3LVQE 2EGPA 5G05B 2MNYA 2LGGA 2KGIA 3E2DA 4BBQA 2CSVA 2CONA 1WEEA 4Z0RA 3SUBA 1VD4A 2KWJA 2LN0A 4X3GA 3O33A 4GNGA 3DPLR 5AIUA 2XOZA 3FL2A 3O37A 2YSMA 3N9NA 2NAAA 3GL6A 2HDPA 4A4BA 4QF3A 2Y43A 2ECIA 4R2YA 4YBSA 1K2FA 2MA6A 4S3OC 2YREA 5JG6A 5B77A 3VK6A 5C13A 5SVYA 4AYCA 2AN6A 2IDAA 4V3KC 3ASLA 4I7DA 3O47A 5SVIB 3U5OA 1HYJA 2K17A 2ECVA 2VJFB 5D1KB 3FEHA 2KWNA 1MM3A 3NG2A 3U5MA 4MVTA 3KV5A 2EA6A 3U5PA 3PHDA 2XOYA 2Y1MA 1WEOA 2MUMA 3RTRB 3ZPVE 4AP4A 1WESA 5EYAF 3C5KA 4UP0A 1WGMA 5H1TA 3PLWA 2CRWA 2Y1NA 3U5NA 2MKEA 1WILA 3O7AA 3RPGC 2FD4A 2YUCA 1ZBDB 2L75A 2VPGA 3T9KA 4F52B 3LQHA 3EB5A 1HYIA 5TDRA 4B86C 2XB1A 3QZVA 5C11A 1Z6UA 2YVRA 4ZDTA 2MT5A 4N4FA 4R8PK 2L43A 1LDKC 2F6NA 2MD7B 2MA5A 1V87A 2F42A 3EB6A 5SVIA 1JM7B 4H9DA 5TRBA 3HCUA 3RPGB 2MNZA 2HYED 2FSAA 3C6WA 5FB1A 2PNXA 2FFWA 2C2VS 2CT2A 1JOCA 2H0DA 2LV9A 3MDBC 2EODA 4FK5A 2F6JA 2JMDA 1CHCA 4UI9B 4A0CD 4BHWA 2LDRA 3MHHA 2KKYA 3SOUA 2RR4A 2BAYA 2YURA 4P5OB 2XP0A 3Q1DA 4GB0A 2VJEB 5KH3A 3N9QA 5LCWB 4YAXA 2CRRA
chains in the Genus database with same CATH topology
3MDBC 5K3QA 3LJUX 4OGCA 3PLWA 3JUEA 2CRWA 2LAUA 2YVRA 4Z0OA 2XOZA 2B0OE 2M13A 2OWAA 4O62A 4F1PA 2MKEA 2D8UA 3LVQE 3O47A 2DJAA 2XOCA 3FJUB 3H7HA 3DWDA 5SVXA 5SVIB 3LDYA 2KKXA 3LVRE 2JM3A 3DDTA 3KDEC 1DCQA 2EGMA 3FEHA 3M7KA 3E2DA 3FM8C 4QQ4A 5SVIA 2FD4A 2IQJA 4H9DA 2CSVA 2KKYA 2P57A 2CONA 2RR4A 3T9KA 2EXUA 2YREA 4Z0RA 2XOYA 2E61A 4OGEA 2XP0A 3Q1DA 3SUBA 2JUNA 5SVYA 2FFWA 2L7PA 2CRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MDB C;  3FM8 C;  4F1P A;  3LJU X;  3LVQ E;  3O47 A;  2IQJ A;  3JUE A;  3DWD A;  3FEH A;  2CRW A;  3SUB A;  3LVR E;  2P57 A;  3T9K A;  1DCQ A;  2B0O E;  2OWA A;  2CRR A; 
#chains in the Genus database with same CATH topology
 5DIN A;  3JUE A;  1DVP A;  2I50 A;  3N9L A;  4IC2 A;  5SVX A;  4W4U A;  2VP7 A;  2KE1 A;  5LKZ A;  1WE9 A;  5J3X A;  4LJN A;  3KQI A;  3I2D A;  2L5U A;  5KH9 A;  1XWH A;  4ZQL A;  4FIP A;  2KYU A;  5H9M A;  4Z0O A;  2KRE A;  2M13 A;  3LQJ A;  3ZTG A;  4QF2 A;  3FAN A;  3H7H A;  3LVR E;  3HTK C;  1DCQ A;  2OXQ C;  4XI1 A;  3LQI A;  5FER A;  5G0F A;  1FBV A;  1WEP A;  3PUR A;  2LGK A;  1E4U A;  1F62 A;  1X4U A;  4LLB A;  5K3Q A;  2YU4 A;  2LAU A;  5AIT A;  3KV6 A;  4NN2 A;  4GNF A;  2XEU A;  1G25 A;  2CSY A;  3N9M A;  3KDE C;  2M3H A;  2E6R A;  2FUU A;  3HCT A;  2D8S A;  2ECG A;  3M99 A;  2P57 A;  1WEU A;  2KR4 A;  1VYX A;  3L1Z B;  4AYC B;  4FO9 A;  2VPD A;  4AVX A;  5I3L A;  3ZYQ A;  2G6Q A;  3M63 A;  2JRJ A;  2K4D A;  3LDY A;  5FB0 A;  2KKX A;  1BOR A;  3HCS A;  3LRQ A;  2C2L A;  3V43 A;  2CKL B;  4WZ0 A;  2IQJ A;  2YYR A;  3ZVY A;  2QJ0 A;  2LXH C;  4YAD A;  3LJU X;  5B8D A;  5H1V A;  1FP0 A;  2VNF A;  2B0O E;  5B76 A;  1WEV A;  5FEY A;  2D8U A;  1WEQ A;  2LGV A;  3O36 A;  1JM7 A;  1N87 A;  4MSX A;  3DDT A;  2KGG A;  5LKU A;  2ECJ A;  4QQ4 A;  4V3L C;  1MBM A;  2MIQ A;  2KFT A;  1LDJ B;  3FAO A;  2EXU A;  2FUI A;  1VFY A;  5D1L B;  2LGL A;  1WEM A;  2M1R A;  4R7E A;  4WZ3 B;  4YAB A;  3O70 A;  2YHN A;  4CA1 A;  1WEW A;  4L7X A;  1RMD A;  4YBT A;  2JMI A;  5D1M B;  4F1P A;  2CSZ A;  5LKX A;  3DWD A;  5B75 A;  2K16 A;  2ECW A;  2H0D B;  4YBM A;  3M62 A;  4I7B A;  3ZVZ B;  3N9O A;  2UZG A;  3ZPV 1;  2RI7 A;  2M85 A;  3SOW A;  4YAT A;  2VJF A;  2E6S A;  4Q6F A;  5TDW A;  2MD8 C;  4O62 A;  4O64 A;  5B78 A;  4A49 A;  1Z2Q A;  2JM3 A;  4LK9 A;  2G45 A;  2EGM A;  4ZUX U;  1WIM A;  2KU3 A;  1IYM A;  1WFK A;  1MM2 A;  4UP5 A;  4TKP B;  3GV4 A;  2LRI C;  5TBN A;  2K1J A;  3ZNI A;  3IHP A;  4FJC A;  1U6G B;  2L0B A;  2M6M A;  2XOC A;  3FJU B;  1T1H A;  2YW8 A;  1X4J A;  2VJE A;  3FM8 C;  2YT5 A;  3L11 A;  4S3O B;  2KIZ A;  2LQ6 A;  5LKT A;  3N9P A;  4OGE A;  1Z60 A;  2YSJ A;  4WZ2 A;  4LKA A;  2ECN A;  3SOX A;  3MHS A;  2DSM A;  4PTB A;  5G04 B;  1WEN A;  4N3W A;  3T6R A;  2YHO A;  2DJA A;  2KWK A;  5DKA A;  1X4I A;  2DX8 A;  4YC9 A;  5H1U A;  4B7Y C;  5KH7 A;  2E61 A;  3L1X A;  4PPE A;  2PUY A;  2JUN A;  2CKL A;  4WA6 A;  2ZET C;  2QIC A;  2KWO A;  4GNE A;  5B79 A;  3O34 A;  3DQV R;  2OWA A;  4IC3 A;  4C9Z A;  4L58 A;  4A4C A;  5TAB A;  4LAD B;  2G43 A;  4AUQ B;  2VPB A;  3M7K A;  4CCG X;  2VPE A;  4GND A;  4I7C A;  2YQM A;  2L80 A;  3O35 A;  3PUQ A;  3SHB A;  2JMJ A;  2L7P A;  2ECT A;  2QIZ A;  4OGC A;  2YQL A;  2LXP C;  2RSD A;  3KNV A;  3T7L A;  3LVQ E;  2EGP A;  5G05 B;  2MNY A;  2LGG A;  2KGI A;  3E2D A;  4BBQ A;  2CSV A;  2CON A;  1WEE A;  4Z0R A;  3SUB A;  1VD4 A;  2KWJ A;  2LN0 A;  4X3G A;  3O33 A;  4GNG A;  3DPL R;  5AIU A;  2XOZ A;  3FL2 A;  3O37 A;  2YSM A;  3N9N A;  2NAA A;  3GL6 A;  2HDP A;  4A4B A;  4QF3 A;  2Y43 A;  2ECI A;  4R2Y A;  4YBS A;  1K2F A;  2MA6 A;  4S3O C;  2YRE A;  5JG6 A;  5B77 A;  3VK6 A;  5C13 A;  5SVY A;  4AYC A;  2AN6 A;  2IDA A;  4V3K C;  3ASL A;  4I7D A;  3O47 A;  5SVI B;  3U5O A;  1HYJ A;  2K17 A;  2ECV A;  2VJF B;  5D1K B;  3FEH A;  2KWN A;  1MM3 A;  3NG2 A;  3U5M A;  4MVT A;  3KV5 A;  2EA6 A;  3U5P A;  3PHD A;  2XOY A;  2Y1M A;  1WEO A;  2MUM A;  3RTR B;  3ZPV E;  4AP4 A;  1WES A;  5EYA F;  3C5K A;  4UP0 A;  1WGM A;  5H1T A;  3PLW A;  2CRW A;  2Y1N A;  3U5N A;  2MKE A;  1WIL A;  3O7A A;  3RPG C;  2FD4 A;  2YUC A;  1ZBD B;  2L75 A;  2VPG A;  3T9K A;  4F52 B;  3LQH A;  3EB5 A;  1HYI A;  5TDR A;  4B86 C;  2XB1 A;  3QZV A;  5C11 A;  1Z6U A;  2YVR A;  4ZDT A;  2MT5 A;  4N4F A;  4R8P K;  2L43 A;  1LDK C;  2F6N A;  2MD7 B;  2MA5 A;  1V87 A;  2F42 A;  3EB6 A;  5SVI A;  1JM7 B;  4H9D A;  5TRB A;  3HCU A;  3RPG B;  2MNZ A;  2HYE D;  2FSA A;  3C6W A;  5FB1 A;  2PNX A;  2FFW A;  2C2V S;  2CT2 A;  1JOC A;  2H0D A;  2LV9 A;  3MDB C;  2EOD A;  4FK5 A;  2F6J A;  2JMD A;  1CHC A;  4UI9 B;  4A0C D;  4BHW A;  2LDR A;  3MHH A;  2KKY A;  3SOU A;  2RR4 A;  2BAY A;  2YUR A;  4P5O B;  2XP0 A;  3Q1D A;  4GB0 A;  2VJE B;  5KH3 A;  3N9Q A;  5LCW B;  4YAX A;  2CRR A; 
#chains in the Genus database with same CATH homology
 3MDB C;  5K3Q A;  3LJU X;  4OGC A;  3PLW A;  3JUE A;  2CRW A;  2LAU A;  2YVR A;  4Z0O A;  2XOZ A;  2B0O E;  2M13 A;  2OWA A;  4O62 A;  4F1P A;  2MKE A;  2D8U A;  3LVQ E;  3O47 A;  2DJA A;  2XOC A;  3FJU B;  3H7H A;  3DWD A;  5SVX A;  5SVI B;  3LDY A;  2KKX A;  3LVR E;  2JM3 A;  3DDT A;  3KDE C;  1DCQ A;  2EGM A;  3FEH A;  3M7K A;  3E2D A;  3FM8 C;  4QQ4 A;  5SVI A;  2FD4 A;  2IQJ A;  4H9D A;  2CSV A;  2KKY A;  2P57 A;  2CON A;  2RR4 A;  3T9K A;  2EXU A;  2YRE A;  4Z0R A;  2XOY A;  2E61 A;  4OGE A;  2XP0 A;  3Q1D A;  3SUB A;  2JUN A;  5SVY A;  2FFW A;  2L7P A;  2CRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...