1HYIA

Solution structure of the eea1 fyve domain complexed with inositol 1,3-bisphosphate
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
65
Chain Sequence
RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOSOME-ASSOCIATED PROTEIN
publication title Structural mechanism of endosome docking by the FYVE domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 7
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1hyiA00
4FJCA 2YHOA 4L58A 2L80A 3FL2A 3O35A 2MA5A 3LQJA 2L0BA 1WENA 5DKAA 2KFTA 4GNFA 5D1MB 2QIZA 2MD7B 4WZ0A 3O34A 3SHBA 2LRIC 4XI1A 5D1KB 5LCWB 3QZVA 1WGMA 5KH9A 2CT2A 4NN2A 4A4BA 5KH7A 5B8DA 3MHHA 4N3WA 2LQ6A 2KU3A 4I7CA 2KGIA 3PURA 4AUQB 1IYMA 5B78A 3O36A 3HCUA 1V87A 4AVXA 4GNEA 3L1XA 3T7LA 5JG6A 4WZ3B 2KWJA 1WFKA 3ZVZB 2OXQC 5TABA 4ZUXU 2VPGA 2CKLA 1JM7A 1WEMA 2KR4A 4MSXA 1N87A 3KV6A 5KH3A 3O33A 3ZVYA 2CSYA 2RSDA 3U5PA 4CCGX 4QF2A 2K17A 3L1ZB 1Z60A 3I2DA 3VK6A 2YT5A 2YSJA 2LGKA 3ZNIA 5H9MA 1Z6UA 2IDAA 4GB0A 1CHCA 2LGVA 5B77A 2VPEA 3ZPVE 5I3LA 1F62A 2MUMA 1VFYA 5EYAF 2ECNA 4YADA 3HCTA 3DPLR 3DQVR 5D1LB 2C2VS 4FK5A 2F6JA 5LKZA 2UZGA 3U5NA 1WEWA 3LQHA 4UP5A 1WEOA 4FO9A 1WEUA 4UI9B 2MNYA 5B76A 3KQIA 2ZETC 3N9OA 1T1HA 1E4UA 4L7XA 1XWHA 3M63A 4S3OB 3KNVA 2C2LA 2LGGA 4S3OC 2M6MA 4GNDA 5H1VA 1BORA 4A49A 1LDJB 2JMIA 2VJEB 4ZDTA 5H1TA 2EA6A 3GL6A 4ZQLA 1X4JA 2KE1A 1G25A 2RI7A 2NAAA 2M85A 4LADB 2JMDA 2YURA 2LGLA 3N9MA 3N9NA 3MHSA 4V3KC 3EB6A 2LDRA 2VP7A 4TKPB 3LQIA 2F42A 1JOCA 3U5OA 2YREA 4R2YA 3ZYQA 1WILA 3O37A 1Z2QA 2H0DB 4LJNA 4YABA 1WIMA 2VPDA 4A0CD 5J3XA 4BHWA 5B79A 5DINA 2Y43A 2JRJA 3GV4A 4AYCA 2K16A 4YBSA 4LLBA 2E6SA 3SOWA 2ECVA 2MA6A 2DX8A 2KWKA 2KREA 2LV9A 2FUIA 2M3HA 5TRBA 3V43A 2ECJA 4WA6A 1MM2A 2LN0A 2VPBA 4MVTA 2MNZA 4W4UA 4YATA 5AIUA 2LXHC 3N9PA 3HTKC 2G45A 1ZBDB 3SOXA 2K1JA 2ECIA 4LK9A 3O70A 3ZPV1 5FERA 4PPEA 1MM3A 4AP4A 3N9LA 3KV5A 5LKTA 1HYIA 3M99A 2YHNA 5TDWA 4GNGA 4N4FA 2VNFA 2MD8C 4Q6FA 2BAYA 4R7EA 4IC2A 1X4UA 2HYED 3IHPA 4BBQA 3ZTGA 1LDKC 3EB5A 1K2FA 1WEVA 2G43A 4C9ZA 1WE9A 2VJFB 2XB1A 4AYCB 5G0FA 1HYJA 2XEUA 5B75A 2FUUA 2L43A 2VJEA 2QICA 4B86C 4X3GA 4YC9A 4P5OB 4UP0A 3RTRB 2PUYA 4R8PK 2LXPC 1FP0A 4A4CA 2E6RA 3U5MA 4I7BA 2I50A 4IC3A 5C13A 2YU4A 2EGPA 2YUCA 4I7DA 2H0DA 4CA1A 5H1UA 4O64A 3SOUA 4QF3A 4YAXA 5C11A 4LKAA 4V3LC 2ECWA 3LRQA 1U6GB 1WESA 1VD4A 5FEYA 2M1RA 1VYXA 1WEQA 3NG2A 2AN6A 2PNXA 2YYRA 3RPGB 3O7AA 3RPGC 3ASLA 3C6WA 2QJ0A 2KIZA 2KWNA 2KWOA 2Y1NA 1X4IA 2CSZA 4F52B 1WEEA 4FIPA 2CKLB 1JM7B 2L5UA 2YQLA 1FBVA 1DVPA 2YSMA 2FSAA 3N9QA 4B7YC 5TBNA 4YBTA 5LKXA 1RMDA 3C5KA 3L11A 2Y1MA 5TDRA 5AITA 4PTBA 2HDPA 5G05B 3PHDA 2YQMA 2EODA 2JMJA 2MT5A 5G04B 3M62A 2KGGA 5FB1A 2YW8A 3HCSA 3T6RA 2L75A 2MIQA 4WZ2A 5LKUA 2G6QA 3PUQA 1WEPA 2ECTA 2ECGA 4YBMA 2F6NA 5FB0A 2K4DA 2D8SA 2KYUA 2VJFA
chains in the Genus database with same CATH superfamily
4FJCA 2YHOA 4L58A 2L80A 2LAUA 3FL2A 3O35A 2MA5A 3LQJA 2L0BA 1WENA 5DKAA 2KFTA 2FFWA 4GNFA 5D1MB 2QIZA 2MD7B 4WZ0A 3O34A 3SHBA 2LRIC 4XI1A 2RR4A 5D1KB 5LCWB 3QZVA 1WGMA 5KH9A 2CT2A 4NN2A 4A4BA 5KH7A 5B8DA 3MHHA 4N3WA 2LQ6A 2KU3A 4I7CA 2KGIA 2YVRA 3PURA 4AUQB 1IYMA 4Z0OA 5B78A 3O36A 3HCUA 3DDTA 5SVYA 1V87A 4AVXA 4GNEA 4O62A 3L1XA 3T7LA 5JG6A 4WZ3B 2KWJA 1WFKA 3ZVZB 2OXQC 5TABA 4ZUXU 2VPGA 2CKLA 1JM7A 1WEMA 2KR4A 4MSXA 1N87A 3LJUX 3KV6A 5KH3A 3O33A 3FANA 3ZVYA 2XOZA 2EXUA 2KKXA 2CSYA 2RSDA 3U5PA 4CCGX 3Q1DA 4QF2A 2MKEA 2K17A 3L1ZB 1Z60A 3I2DA 3VK6A 2YT5A 2YSJA 2LGKA 3ZNIA 5H9MA 1Z6UA 3FEHA 2IDAA 4GB0A 1CHCA 2LGVA 5B77A 3FJUB 4OGCA 2VPEA 1MBMA 3ZPVE 4QQ4A 5I3LA 1F62A 2MUMA 1VFYA 5EYAF 2ECNA 4YADA 3HCTA 3DPLR 3DQVR 5D1LB 2C2VS 4FK5A 2CRRA 2F6JA 5LKZA 2UZGA 3U5NA 1WEWA 3FAOA 3FM8C 3LQHA 4UP5A 1WEOA 4FO9A 1WEUA 4UI9B 2MNYA 5B76A 3KQIA 3SUBA 2ZETC 3N9OA 1T1HA 1E4UA 3MDBC 4L7XA 1XWHA 3M63A 4S3OB 3KNVA 2C2LA 2LGGA 4S3OC 2M6MA 4GNDA 5H1VA 1BORA 4A49A 1LDJB 2B0OE 2JMIA 2VJEB 4ZDTA 5H1TA 2EA6A 3GL6A 4ZQLA 1X4JA 2KE1A 1G25A 2RI7A 2NAAA 2M85A 4LADB 2JMDA 2YURA 2LGLA 3N9MA 3N9NA 3MHSA 5K3QA 4V3KC 3EB6A 2LDRA 2VP7A 4TKPB 3LQIA 2F42A 1JOCA 3U5OA 3KDEC 2YREA 4R2YA 3ZYQA 1WILA 3O37A 1Z2QA 2H0DB 2M13A 4LJNA 2L7PA 4YABA 1WIMA 2VPDA 4A0CD 5J3XA 4BHWA 5B79A 5DINA 2Y43A 2JRJA 3GV4A 3O47A 2K16A 4AYCA 4YBSA 4LLBA 2E6SA 3SOWA 2ECVA 2MA6A 2XOCA 2DX8A 2KWKA 2KREA 2LV9A 1DCQA 2FUIA 2FD4A 5SVIB 2M3HA 5TRBA 2D8UA 3V43A 2ECJA 4WA6A 1MM2A 2LN0A 2VPBA 4MVTA 2MNZA 3PLWA 4W4UA 4YATA 2LXHC 5AIUA 3N9PA 3HTKC 2G45A 1ZBDB 3SOXA 2K1JA 2ECIA 4LK9A 2CRWA 3O70A 3ZPV1 5FERA 4PPEA 1MM3A 4AP4A 3N9LA 3KV5A 5LKTA 2DSMA 1HYIA 3M99A 2YHNA 2KKYA 5TDWA 4GNGA 4N4FA 2VNFA 2MD8C 4Q6FA 2BAYA 2CSVA 4R7EA 4IC2A 1X4UA 2HYED 3IHPA 3E2DA 4BBQA 3ZTGA 4H9DA 4F1PA 1LDKC 3EB5A 1K2FA 1WEVA 2E61A 5SVXA 2G43A 4C9ZA 1WE9A 2VJFB 2XB1A 4AYCB 5G0FA 1HYJA 2XEUA 2JM3A 5B75A 2FUUA 2L43A 2VJEA 2QICA 4B86C 4X3GA 4YC9A 4P5OB 4UP0A 3RTRB 2PUYA 4R8PK 2LXPC 1FP0A 4A4CA 2E6RA 3U5MA 4I7BA 2P57A 2I50A 4IC3A 5C13A 2YU4A 2EGPA 3JUEA 2JUNA 3M7KA 2YUCA 4I7DA 2H0DA 4CA1A 5H1UA 4O64A 3SOUA 4QF3A 4YAXA 3T9KA 3LDYA 5C11A 2OWAA 4LKAA 4V3LC 2ECWA 3LRQA 1U6GB 1WESA 1VD4A 5FEYA 2M1RA 1VYXA 1WEQA 3NG2A 2AN6A 2PNXA 2YYRA 3RPGB 3O7AA 3RPGC 3ASLA 2XP0A 3C6WA 2QJ0A 2KIZA 2KWNA 2KWOA 2Y1NA 5SVIA 1X4IA 2CSZA 4F52B 1WEEA 4FIPA 2CKLB 2XOYA 1JM7B 2L5UA 2YQLA 1FBVA 2IQJA 1DVPA 2YSMA 2FSAA 3LVRE 3N9QA 2EGMA 4B7YC 5TBNA 4YBTA 5LKXA 1RMDA 3C5KA 3L11A 2Y1MA 5TDRA 5AITA 4PTBA 4Z0RA 2HDPA 5G05B 3PHDA 2YQMA 2DJAA 2EODA 2JMJA 2MT5A 5G04B 3H7HA 3M62A 2KGGA 3DWDA 5FB1A 2YW8A 2CONA 3HCSA 3T6RA 4OGEA 2L75A 2MIQA 4WZ2A 5LKUA 2G6QA 3PUQA 1WEPA 2ECTA 3LVQE 2ECGA 4YBMA 2F6NA 5FB0A 2K4DA 2D8SA 2KYUA 2VJFA
chains in the Genus database with same CATH topology
4FJCA 2YHOA 4L58A 2L80A 3FL2A 3O35A 2MA5A 3LQJA 2L0BA 1WENA 5DKAA 2KFTA 4GNFA 5D1MB 2QIZA 2MD7B 4WZ0A 3O34A 3SHBA 2LRIC 4XI1A 5D1KB 5LCWB 3QZVA 1WGMA 5KH9A 2CT2A 4NN2A 4A4BA 5KH7A 5B8DA 3MHHA 4N3WA 2LQ6A 2KU3A 4I7CA 2KGIA 3PURA 4AUQB 1IYMA 5B78A 3O36A 3HCUA 1V87A 4AVXA 4GNEA 3L1XA 3T7LA 5JG6A 4WZ3B 2KWJA 1WFKA 3ZVZB 2OXQC 5TABA 4ZUXU 2VPGA 2CKLA 1JM7A 1WEMA 2KR4A 4MSXA 1N87A 3KV6A 5KH3A 3O33A 3ZVYA 2CSYA 2RSDA 3U5PA 4CCGX 4QF2A 2K17A 3L1ZB 1Z60A 3I2DA 3VK6A 2YT5A 2YSJA 2LGKA 3ZNIA 5H9MA 1Z6UA 2IDAA 4GB0A 1CHCA 2LGVA 5B77A 2VPEA 3ZPVE 5I3LA 1F62A 2MUMA 1VFYA 5EYAF 2ECNA 4YADA 3HCTA 3DPLR 3DQVR 5D1LB 2C2VS 4FK5A 2F6JA 5LKZA 2UZGA 3U5NA 1WEWA 3LQHA 4UP5A 1WEOA 4FO9A 1WEUA 4UI9B 2MNYA 5B76A 3KQIA 2ZETC 3N9OA 1T1HA 1E4UA 4L7XA 1XWHA 3M63A 4S3OB 3KNVA 2C2LA 2LGGA 4S3OC 2M6MA 4GNDA 5H1VA 1BORA 4A49A 1LDJB 2JMIA 2VJEB 4ZDTA 5H1TA 2EA6A 3GL6A 4ZQLA 1X4JA 2KE1A 1G25A 2RI7A 2NAAA 2M85A 4LADB 2JMDA 2YURA 2LGLA 3N9MA 3N9NA 3MHSA 4V3KC 3EB6A 2LDRA 2VP7A 4TKPB 3LQIA 2F42A 1JOCA 3U5OA 2YREA 4R2YA 3ZYQA 1WILA 3O37A 1Z2QA 2H0DB 4LJNA 4YABA 1WIMA 2VPDA 4A0CD 5J3XA 4BHWA 5B79A 5DINA 2Y43A 2JRJA 3GV4A 4AYCA 2K16A 4YBSA 4LLBA 2E6SA 3SOWA 2ECVA 2MA6A 2DX8A 2KWKA 2KREA 2LV9A 2FUIA 2M3HA 5TRBA 3V43A 2ECJA 4WA6A 1MM2A 2LN0A 2VPBA 4MVTA 2MNZA 4W4UA 4YATA 5AIUA 2LXHC 3N9PA 3HTKC 2G45A 1ZBDB 3SOXA 2K1JA 2ECIA 4LK9A 3O70A 3ZPV1 5FERA 4PPEA 1MM3A 4AP4A 3N9LA 3KV5A 5LKTA 1HYIA 3M99A 2YHNA 5TDWA 4GNGA 4N4FA 2VNFA 2MD8C 4Q6FA 2BAYA 4R7EA 4IC2A 1X4UA 2HYED 3IHPA 4BBQA 3ZTGA 1LDKC 3EB5A 1K2FA 1WEVA 2G43A 4C9ZA 1WE9A 2VJFB 2XB1A 4AYCB 5G0FA 1HYJA 2XEUA 5B75A 2FUUA 2L43A 2VJEA 2QICA 4B86C 4X3GA 4YC9A 4P5OB 4UP0A 3RTRB 2PUYA 4R8PK 2LXPC 1FP0A 4A4CA 2E6RA 3U5MA 4I7BA 2I50A 4IC3A 5C13A 2YU4A 2EGPA 2YUCA 4I7DA 2H0DA 4CA1A 5H1UA 4O64A 3SOUA 4QF3A 4YAXA 5C11A 4LKAA 4V3LC 2ECWA 3LRQA 1U6GB 1WESA 1VD4A 5FEYA 2M1RA 1VYXA 1WEQA 3NG2A 2AN6A 2PNXA 2YYRA 3RPGB 3O7AA 3RPGC 3ASLA 3C6WA 2QJ0A 2KIZA 2KWNA 2KWOA 2Y1NA 1X4IA 2CSZA 4F52B 1WEEA 4FIPA 2CKLB 1JM7B 2L5UA 2YQLA 1FBVA 1DVPA 2YSMA 2FSAA 3N9QA 4B7YC 5TBNA 4YBTA 5LKXA 1RMDA 3C5KA 3L11A 2Y1MA 5TDRA 5AITA 4PTBA 2HDPA 5G05B 3PHDA 2YQMA 2EODA 2JMJA 2MT5A 5G04B 3M62A 2KGGA 5FB1A 2YW8A 3HCSA 3T6RA 2L75A 2MIQA 4WZ2A 5LKUA 2G6QA 3PUQA 1WEPA 2ECTA 2ECGA 4YBMA 2F6NA 5FB0A 2K4DA 2D8SA 2KYUA 2VJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJC A;  2YHO A;  4L58 A;  2L80 A;  3FL2 A;  3O35 A;  2MA5 A;  3LQJ A;  2L0B A;  1WEN A;  5DKA A;  2KFT A;  4GNF A;  5D1M B;  2QIZ A;  2MD7 B;  4WZ0 A;  3O34 A;  3SHB A;  2LRI C;  4XI1 A;  5D1K B;  5LCW B;  3QZV A;  1WGM A;  5KH9 A;  2CT2 A;  4NN2 A;  4A4B A;  5KH7 A;  5B8D A;  3MHH A;  4N3W A;  2LQ6 A;  2KU3 A;  4I7C A;  2KGI A;  3PUR A;  4AUQ B;  1IYM A;  5B78 A;  3O36 A;  3HCU A;  1V87 A;  4AVX A;  4GNE A;  3L1X A;  3T7L A;  5JG6 A;  4WZ3 B;  2KWJ A;  1WFK A;  3ZVZ B;  2OXQ C;  5TAB A;  4ZUX U;  2VPG A;  2CKL A;  1JM7 A;  1WEM A;  2KR4 A;  4MSX A;  1N87 A;  3KV6 A;  5KH3 A;  3O33 A;  3ZVY A;  2CSY A;  2RSD A;  3U5P A;  4CCG X;  4QF2 A;  2K17 A;  3L1Z B;  1Z60 A;  3I2D A;  3VK6 A;  2YT5 A;  2YSJ A;  2LGK A;  3ZNI A;  5H9M A;  1Z6U A;  2IDA A;  4GB0 A;  1CHC A;  2LGV A;  5B77 A;  2VPE A;  3ZPV E;  5I3L A;  1F62 A;  2MUM A;  1VFY A;  5EYA F;  2ECN A;  4YAD A;  3HCT A;  3DPL R;  3DQV R;  5D1L B;  2C2V S;  4FK5 A;  2F6J A;  5LKZ A;  2UZG A;  3U5N A;  1WEW A;  3LQH A;  4UP5 A;  1WEO A;  4FO9 A;  1WEU A;  4UI9 B;  2MNY A;  5B76 A;  3KQI A;  2ZET C;  3N9O A;  1T1H A;  1E4U A;  4L7X A;  1XWH A;  3M63 A;  4S3O B;  3KNV A;  2C2L A;  2LGG A;  4S3O C;  2M6M A;  4GND A;  5H1V A;  1BOR A;  4A49 A;  1LDJ B;  2JMI A;  2VJE B;  4ZDT A;  5H1T A;  2EA6 A;  3GL6 A;  4ZQL A;  1X4J A;  2KE1 A;  1G25 A;  2RI7 A;  2NAA A;  2M85 A;  4LAD B;  2JMD A;  2YUR A;  2LGL A;  3N9M A;  3N9N A;  3MHS A;  4V3K C;  3EB6 A;  2LDR A;  2VP7 A;  4TKP B;  3LQI A;  2F42 A;  1JOC A;  3U5O A;  2YRE A;  4R2Y A;  3ZYQ A;  1WIL A;  3O37 A;  1Z2Q A;  2H0D B;  4LJN A;  4YAB A;  1WIM A;  2VPD A;  4A0C D;  5J3X A;  4BHW A;  5B79 A;  5DIN A;  2Y43 A;  2JRJ A;  3GV4 A;  4AYC A;  2K16 A;  4YBS A;  4LLB A;  2E6S A;  3SOW A;  2ECV A;  2MA6 A;  2DX8 A;  2KWK A;  2KRE A;  2LV9 A;  2FUI A;  2M3H A;  5TRB A;  3V43 A;  2ECJ A;  4WA6 A;  1MM2 A;  2LN0 A;  2VPB A;  4MVT A;  2MNZ A;  4W4U A;  4YAT A;  5AIU A;  2LXH C;  3N9P A;  3HTK C;  2G45 A;  1ZBD B;  3SOX A;  2K1J A;  2ECI A;  4LK9 A;  3O70 A;  3ZPV 1;  5FER A;  4PPE A;  1MM3 A;  4AP4 A;  3N9L A;  3KV5 A;  5LKT A;  1HYI A;  3M99 A;  2YHN A;  5TDW A;  4GNG A;  4N4F A;  2VNF A;  2MD8 C;  4Q6F A;  2BAY A;  4R7E A;  4IC2 A;  1X4U A;  2HYE D;  3IHP A;  4BBQ A;  3ZTG A;  1LDK C;  3EB5 A;  1K2F A;  1WEV A;  2G43 A;  4C9Z A;  1WE9 A;  2VJF B;  2XB1 A;  4AYC B;  5G0F A;  1HYJ A;  2XEU A;  5B75 A;  2FUU A;  2L43 A;  2VJE A;  2QIC A;  4B86 C;  4X3G A;  4YC9 A;  4P5O B;  4UP0 A;  3RTR B;  2PUY A;  4R8P K;  2LXP C;  1FP0 A;  4A4C A;  2E6R A;  3U5M A;  4I7B A;  2I50 A;  4IC3 A;  5C13 A;  2YU4 A;  2EGP A;  2YUC A;  4I7D A;  2H0D A;  4CA1 A;  5H1U A;  4O64 A;  3SOU A;  4QF3 A;  4YAX A;  5C11 A;  4LKA A;  4V3L C;  2ECW A;  3LRQ A;  1U6G B;  1WES A;  1VD4 A;  5FEY A;  2M1R A;  1VYX A;  1WEQ A;  3NG2 A;  2AN6 A;  2PNX A;  2YYR A;  3RPG B;  3O7A A;  3RPG C;  3ASL A;  3C6W A;  2QJ0 A;  2KIZ A;  2KWN A;  2KWO A;  2Y1N A;  1X4I A;  2CSZ A;  4F52 B;  1WEE A;  4FIP A;  2CKL B;  1JM7 B;  2L5U A;  2YQL A;  1FBV A;  1DVP A;  2YSM A;  2FSA A;  3N9Q A;  4B7Y C;  5TBN A;  4YBT A;  5LKX A;  1RMD A;  3C5K A;  3L11 A;  2Y1M A;  5TDR A;  5AIT A;  4PTB A;  2HDP A;  5G05 B;  3PHD A;  2YQM A;  2EOD A;  2JMJ A;  2MT5 A;  5G04 B;  3M62 A;  2KGG A;  5FB1 A;  2YW8 A;  3HCS A;  3T6R A;  2L75 A;  2MIQ A;  4WZ2 A;  5LKU A;  2G6Q A;  3PUQ A;  1WEP A;  2ECT A;  2ECG A;  4YBM A;  2F6N A;  5FB0 A;  2K4D A;  2D8S A;  2KYU A;  2VJF A; 
#chains in the Genus database with same CATH topology
 4FJC A;  2YHO A;  4L58 A;  2L80 A;  2LAU A;  3FL2 A;  3O35 A;  2MA5 A;  3LQJ A;  2L0B A;  1WEN A;  5DKA A;  2KFT A;  2FFW A;  4GNF A;  5D1M B;  2QIZ A;  2MD7 B;  4WZ0 A;  3O34 A;  3SHB A;  2LRI C;  4XI1 A;  2RR4 A;  5D1K B;  5LCW B;  3QZV A;  1WGM A;  5KH9 A;  2CT2 A;  4NN2 A;  4A4B A;  5KH7 A;  5B8D A;  3MHH A;  4N3W A;  2LQ6 A;  2KU3 A;  4I7C A;  2KGI A;  2YVR A;  3PUR A;  4AUQ B;  1IYM A;  4Z0O A;  5B78 A;  3O36 A;  3HCU A;  3DDT A;  5SVY A;  1V87 A;  4AVX A;  4GNE A;  4O62 A;  3L1X A;  3T7L A;  5JG6 A;  4WZ3 B;  2KWJ A;  1WFK A;  3ZVZ B;  2OXQ C;  5TAB A;  4ZUX U;  2VPG A;  2CKL A;  1JM7 A;  1WEM A;  2KR4 A;  4MSX A;  1N87 A;  3LJU X;  3KV6 A;  5KH3 A;  3O33 A;  3FAN A;  3ZVY A;  2XOZ A;  2EXU A;  2KKX A;  2CSY A;  2RSD A;  3U5P A;  4CCG X;  3Q1D A;  4QF2 A;  2MKE A;  2K17 A;  3L1Z B;  1Z60 A;  3I2D A;  3VK6 A;  2YT5 A;  2YSJ A;  2LGK A;  3ZNI A;  5H9M A;  1Z6U A;  3FEH A;  2IDA A;  4GB0 A;  1CHC A;  2LGV A;  5B77 A;  3FJU B;  4OGC A;  2VPE A;  1MBM A;  3ZPV E;  4QQ4 A;  5I3L A;  1F62 A;  2MUM A;  1VFY A;  5EYA F;  2ECN A;  4YAD A;  3HCT A;  3DPL R;  3DQV R;  5D1L B;  2C2V S;  4FK5 A;  2CRR A;  2F6J A;  5LKZ A;  2UZG A;  3U5N A;  1WEW A;  3FAO A;  3FM8 C;  3LQH A;  4UP5 A;  1WEO A;  4FO9 A;  1WEU A;  4UI9 B;  2MNY A;  5B76 A;  3KQI A;  3SUB A;  2ZET C;  3N9O A;  1T1H A;  1E4U A;  3MDB C;  4L7X A;  1XWH A;  3M63 A;  4S3O B;  3KNV A;  2C2L A;  2LGG A;  4S3O C;  2M6M A;  4GND A;  5H1V A;  1BOR A;  4A49 A;  1LDJ B;  2B0O E;  2JMI A;  2VJE B;  4ZDT A;  5H1T A;  2EA6 A;  3GL6 A;  4ZQL A;  1X4J A;  2KE1 A;  1G25 A;  2RI7 A;  2NAA A;  2M85 A;  4LAD B;  2JMD A;  2YUR A;  2LGL A;  3N9M A;  3N9N A;  3MHS A;  5K3Q A;  4V3K C;  3EB6 A;  2LDR A;  2VP7 A;  4TKP B;  3LQI A;  2F42 A;  1JOC A;  3U5O A;  3KDE C;  2YRE A;  4R2Y A;  3ZYQ A;  1WIL A;  3O37 A;  1Z2Q A;  2H0D B;  2M13 A;  4LJN A;  2L7P A;  4YAB A;  1WIM A;  2VPD A;  4A0C D;  5J3X A;  4BHW A;  5B79 A;  5DIN A;  2Y43 A;  2JRJ A;  3GV4 A;  3O47 A;  2K16 A;  4AYC A;  4YBS A;  4LLB A;  2E6S A;  3SOW A;  2ECV A;  2MA6 A;  2XOC A;  2DX8 A;  2KWK A;  2KRE A;  2LV9 A;  1DCQ A;  2FUI A;  2FD4 A;  5SVI B;  2M3H A;  5TRB A;  2D8U A;  3V43 A;  2ECJ A;  4WA6 A;  1MM2 A;  2LN0 A;  2VPB A;  4MVT A;  2MNZ A;  3PLW A;  4W4U A;  4YAT A;  2LXH C;  5AIU A;  3N9P A;  3HTK C;  2G45 A;  1ZBD B;  3SOX A;  2K1J A;  2ECI A;  4LK9 A;  2CRW A;  3O70 A;  3ZPV 1;  5FER A;  4PPE A;  1MM3 A;  4AP4 A;  3N9L A;  3KV5 A;  5LKT A;  2DSM A;  1HYI A;  3M99 A;  2YHN A;  2KKY A;  5TDW A;  4GNG A;  4N4F A;  2VNF A;  2MD8 C;  4Q6F A;  2BAY A;  2CSV A;  4R7E A;  4IC2 A;  1X4U A;  2HYE D;  3IHP A;  3E2D A;  4BBQ A;  3ZTG A;  4H9D A;  4F1P A;  1LDK C;  3EB5 A;  1K2F A;  1WEV A;  2E61 A;  5SVX A;  2G43 A;  4C9Z A;  1WE9 A;  2VJF B;  2XB1 A;  4AYC B;  5G0F A;  1HYJ A;  2XEU A;  2JM3 A;  5B75 A;  2FUU A;  2L43 A;  2VJE A;  2QIC A;  4B86 C;  4X3G A;  4YC9 A;  4P5O B;  4UP0 A;  3RTR B;  2PUY A;  4R8P K;  2LXP C;  1FP0 A;  4A4C A;  2E6R A;  3U5M A;  4I7B A;  2P57 A;  2I50 A;  4IC3 A;  5C13 A;  2YU4 A;  2EGP A;  3JUE A;  2JUN A;  3M7K A;  2YUC A;  4I7D A;  2H0D A;  4CA1 A;  5H1U A;  4O64 A;  3SOU A;  4QF3 A;  4YAX A;  3T9K A;  3LDY A;  5C11 A;  2OWA A;  4LKA A;  4V3L C;  2ECW A;  3LRQ A;  1U6G B;  1WES A;  1VD4 A;  5FEY A;  2M1R A;  1VYX A;  1WEQ A;  3NG2 A;  2AN6 A;  2PNX A;  2YYR A;  3RPG B;  3O7A A;  3RPG C;  3ASL A;  2XP0 A;  3C6W A;  2QJ0 A;  2KIZ A;  2KWN A;  2KWO A;  2Y1N A;  5SVI A;  1X4I A;  2CSZ A;  4F52 B;  1WEE A;  4FIP A;  2CKL B;  2XOY A;  1JM7 B;  2L5U A;  2YQL A;  1FBV A;  2IQJ A;  1DVP A;  2YSM A;  2FSA A;  3LVR E;  3N9Q A;  2EGM A;  4B7Y C;  5TBN A;  4YBT A;  5LKX A;  1RMD A;  3C5K A;  3L11 A;  2Y1M A;  5TDR A;  5AIT A;  4PTB A;  4Z0R A;  2HDP A;  5G05 B;  3PHD A;  2YQM A;  2DJA A;  2EOD A;  2JMJ A;  2MT5 A;  5G04 B;  3H7H A;  3M62 A;  2KGG A;  3DWD A;  5FB1 A;  2YW8 A;  2CON A;  3HCS A;  3T6R A;  4OGE A;  2L75 A;  2MIQ A;  4WZ2 A;  5LKU A;  2G6Q A;  3PUQ A;  1WEP A;  2ECT A;  3LVQ E;  2ECG A;  4YBM A;  2F6N A;  5FB0 A;  2K4D A;  2D8S A;  2KYU A;  2VJF A; 
#chains in the Genus database with same CATH homology
 4FJC A;  2YHO A;  4L58 A;  2L80 A;  3FL2 A;  3O35 A;  2MA5 A;  3LQJ A;  2L0B A;  1WEN A;  5DKA A;  2KFT A;  4GNF A;  5D1M B;  2QIZ A;  2MD7 B;  4WZ0 A;  3O34 A;  3SHB A;  2LRI C;  4XI1 A;  5D1K B;  5LCW B;  3QZV A;  1WGM A;  5KH9 A;  2CT2 A;  4NN2 A;  4A4B A;  5KH7 A;  5B8D A;  3MHH A;  4N3W A;  2LQ6 A;  2KU3 A;  4I7C A;  2KGI A;  3PUR A;  4AUQ B;  1IYM A;  5B78 A;  3O36 A;  3HCU A;  1V87 A;  4AVX A;  4GNE A;  3L1X A;  3T7L A;  5JG6 A;  4WZ3 B;  2KWJ A;  1WFK A;  3ZVZ B;  2OXQ C;  5TAB A;  4ZUX U;  2VPG A;  2CKL A;  1JM7 A;  1WEM A;  2KR4 A;  4MSX A;  1N87 A;  3KV6 A;  5KH3 A;  3O33 A;  3ZVY A;  2CSY A;  2RSD A;  3U5P A;  4CCG X;  4QF2 A;  2K17 A;  3L1Z B;  1Z60 A;  3I2D A;  3VK6 A;  2YT5 A;  2YSJ A;  2LGK A;  3ZNI A;  5H9M A;  1Z6U A;  2IDA A;  4GB0 A;  1CHC A;  2LGV A;  5B77 A;  2VPE A;  3ZPV E;  5I3L A;  1F62 A;  2MUM A;  1VFY A;  5EYA F;  2ECN A;  4YAD A;  3HCT A;  3DPL R;  3DQV R;  5D1L B;  2C2V S;  4FK5 A;  2F6J A;  5LKZ A;  2UZG A;  3U5N A;  1WEW A;  3LQH A;  4UP5 A;  1WEO A;  4FO9 A;  1WEU A;  4UI9 B;  2MNY A;  5B76 A;  3KQI A;  2ZET C;  3N9O A;  1T1H A;  1E4U A;  4L7X A;  1XWH A;  3M63 A;  4S3O B;  3KNV A;  2C2L A;  2LGG A;  4S3O C;  2M6M A;  4GND A;  5H1V A;  1BOR A;  4A49 A;  1LDJ B;  2JMI A;  2VJE B;  4ZDT A;  5H1T A;  2EA6 A;  3GL6 A;  4ZQL A;  1X4J A;  2KE1 A;  1G25 A;  2RI7 A;  2NAA A;  2M85 A;  4LAD B;  2JMD A;  2YUR A;  2LGL A;  3N9M A;  3N9N A;  3MHS A;  4V3K C;  3EB6 A;  2LDR A;  2VP7 A;  4TKP B;  3LQI A;  2F42 A;  1JOC A;  3U5O A;  2YRE A;  4R2Y A;  3ZYQ A;  1WIL A;  3O37 A;  1Z2Q A;  2H0D B;  4LJN A;  4YAB A;  1WIM A;  2VPD A;  4A0C D;  5J3X A;  4BHW A;  5B79 A;  5DIN A;  2Y43 A;  2JRJ A;  3GV4 A;  4AYC A;  2K16 A;  4YBS A;  4LLB A;  2E6S A;  3SOW A;  2ECV A;  2MA6 A;  2DX8 A;  2KWK A;  2KRE A;  2LV9 A;  2FUI A;  2M3H A;  5TRB A;  3V43 A;  2ECJ A;  4WA6 A;  1MM2 A;  2LN0 A;  2VPB A;  4MVT A;  2MNZ A;  4W4U A;  4YAT A;  5AIU A;  2LXH C;  3N9P A;  3HTK C;  2G45 A;  1ZBD B;  3SOX A;  2K1J A;  2ECI A;  4LK9 A;  3O70 A;  3ZPV 1;  5FER A;  4PPE A;  1MM3 A;  4AP4 A;  3N9L A;  3KV5 A;  5LKT A;  1HYI A;  3M99 A;  2YHN A;  5TDW A;  4GNG A;  4N4F A;  2VNF A;  2MD8 C;  4Q6F A;  2BAY A;  4R7E A;  4IC2 A;  1X4U A;  2HYE D;  3IHP A;  4BBQ A;  3ZTG A;  1LDK C;  3EB5 A;  1K2F A;  1WEV A;  2G43 A;  4C9Z A;  1WE9 A;  2VJF B;  2XB1 A;  4AYC B;  5G0F A;  1HYJ A;  2XEU A;  5B75 A;  2FUU A;  2L43 A;  2VJE A;  2QIC A;  4B86 C;  4X3G A;  4YC9 A;  4P5O B;  4UP0 A;  3RTR B;  2PUY A;  4R8P K;  2LXP C;  1FP0 A;  4A4C A;  2E6R A;  3U5M A;  4I7B A;  2I50 A;  4IC3 A;  5C13 A;  2YU4 A;  2EGP A;  2YUC A;  4I7D A;  2H0D A;  4CA1 A;  5H1U A;  4O64 A;  3SOU A;  4QF3 A;  4YAX A;  5C11 A;  4LKA A;  4V3L C;  2ECW A;  3LRQ A;  1U6G B;  1WES A;  1VD4 A;  5FEY A;  2M1R A;  1VYX A;  1WEQ A;  3NG2 A;  2AN6 A;  2PNX A;  2YYR A;  3RPG B;  3O7A A;  3RPG C;  3ASL A;  3C6W A;  2QJ0 A;  2KIZ A;  2KWN A;  2KWO A;  2Y1N A;  1X4I A;  2CSZ A;  4F52 B;  1WEE A;  4FIP A;  2CKL B;  1JM7 B;  2L5U A;  2YQL A;  1FBV A;  1DVP A;  2YSM A;  2FSA A;  3N9Q A;  4B7Y C;  5TBN A;  4YBT A;  5LKX A;  1RMD A;  3C5K A;  3L11 A;  2Y1M A;  5TDR A;  5AIT A;  4PTB A;  2HDP A;  5G05 B;  3PHD A;  2YQM A;  2EOD A;  2JMJ A;  2MT5 A;  5G04 B;  3M62 A;  2KGG A;  5FB1 A;  2YW8 A;  3HCS A;  3T6R A;  2L75 A;  2MIQ A;  4WZ2 A;  5LKU A;  2G6Q A;  3PUQ A;  1WEP A;  2ECT A;  2ECG A;  4YBM A;  2F6N A;  5FB0 A;  2K4D A;  2D8S A;  2KYU A;  2VJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...