1HYIA

Solution structure of the eea1 fyve domain complexed with inositol 1,3-bisphosphate
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
65
Chain Sequence
b'RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOSOME-ASSOCIATED PROTEIN
publication title Structural mechanism of endosome docking by the FYVE domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 7
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1hyiA00
3C5KA 4WA6A 4X3GA 2RI7A 4AYCB 4GB0A 1Z60A 2YHNA 5FB0A 2KREA 2BAYA 4UI9B 3LRQA 5TABA 2LGKA 2G45A 3N9NA 2QICA 2LGLA 5EYAF 4C9ZA 3N9PA 4MVTA 4ZQLA 5H1UA 3QZVA 4YBMA 2E6RA 2D8SA 1WEPA 4A0CD 2LGVA 2F6JA 2VPGA 1WFKA 5B78A 2CSYA 1K2FA 3ASLA 4R7EA 4AVXA 4CA1A 2LQ6A 2KR4A 5C11A 1WESA 3L1ZB 4BHWA 4S3OC 3U5PA 4YABA 3EB5A 5H1VA 3L1XA 5TRBA 4MSXA 3N9OA 2L5UA 1JM7A 4I7BA 3ZYQA 2Y1NA 5LKZA 3GV4A 4I7DA 1X4IA 3EB6A 1LDKC 4GNDA 2PUYA 2EGPA 5H9MA 2L0BA 2YSMA 4FIPA 2KU3A 3V43A 2KWJA 2MD7B 1ZBDB 4AP4A 5KH7A 3N9MA 2F6NA 2YQLA 5I3LA 3T6RA 4Q6FA 4S3OB 2MT5A 4N4FA 1LDJB 1X4JA 5G04B 3L11A 4N3WA 2M1RA 5LKUA 2PNXA 2LN0A 3KV5A 2VJFA 3LQIA 2DX8A 5LKXA 4A4BA 1MM3A 1JM7B 1WENA 3FL2A 3U5NA 2CT2A 4I7CA 2RSDA 4XI1A 2JMJA 4YBSA 3RPGC 3M62A 4WZ2A 2K4DA 2VPBA 2QIZA 2LGGA 2VPDA 5DKAA 1X4UA 5D1LB 4R8PK 3ZTGA 4AUQB 2YURA 2F42A 2UZGA 3SOWA 5B8DA 2XEUA 4YATA 4WZ0A 1CHCA 2H0DA 2LXHC 2YT5A 3VK6A 3GL6A 1FBVA 2HDPA 2G43A 2KFTA 2C2LA 4UP5A 4R2YA 2VNFA 5B77A 5LCWB 4BBQA 4WZ3B 2KYUA 5KH3A 1WGMA 4A4CA 3RPGB 3O7AA 2VPEA 3NG2A 4V3KC 3M63A 3O34A 2MUMA 5D1KB 2AN6A 2VP7A 2LRIC 4O64A 1WE9A 2CSZA 5FEYA 2KGIA 4NN2A 2KGGA 3PURA 4L58A 1WEWA 2MIQA 1WEUA 4W4UA 2CKLA 4CCGX 4YAXA 1WILA 5G05B 2JRJA 2VJEA 3LQJA 2YSJA 5AITA 5B75A 2ECWA 5TDRA 5TDWA 2H0DB 2E6SA 3DQVR 1VFYA 1HYJA 1BORA 2ECJA 2YQMA 3MHHA 4FO9A 2I50A 5DINA 2MNYA 2JMDA 2EA6A 5B79A 2ECGA 5FERA 4GNFA 2FSAA 2KWKA 4V3LC 1WEOA 3PHDA 4TKPB 4LKAA 2OXQC 1Z6UA 2QJ0A 1N87A 3O36A 4YADA 2NAAA 1JOCA 3T7LA 1WEVA 4LADB 3M99A 2KWNA 4LK9A 2CKLB 2Y1MA 2KWOA 4YC9A 2JMIA 2VJEB 2YYRA 1IYMA 1HYIA 4L7XA 3LQHA 1T1HA 2K16A 5TBNA 2MA6A 4QF3A 1DVPA 1FP0A 3N9LA 2YU4A 4YBTA 1E4UA 2G6QA 2FUIA 3MHSA 5LKTA 1G25A 5JG6A 1V87A 2XB1A 4UP0A 3SOXA 2LXPC 5G0FA 3KNVA 2K1JA 4GNEA 4LLBA 3RTRB 2L43A 2M85A 3KV6A 2VJFB 1XWHA 3SOUA 2MNZA 4FK5A 4ZDTA 3ZPV1 3HTKC 3O35A 5C13A 2L80A 2MD8C 4P5OB 5KH9A 4A49A 5AIUA 1Z2QA 3I2DA 1VD4A 2KE1A 4PPEA 2ECVA 2LV9A 1U6GB 3DPLR 1VYXA 3O37A 3ZVZB 4B7YC 3KQIA 2HYED 3HCTA 2ZETC 4F52B 1WEEA 4ZUXU 3SHBA 5FB1A 2ECNA 4AYCA 5B76A 2KIZA 3HCUA 2MA5A 2LDRA 3O33A 4IC2A 2YUCA 2K17A 2M3HA 2IDAA 4GNGA 2Y43A 1WEMA 3ZPVE 3ZNIA 4QF2A 4B86C 2ECIA 2EODA 1MM2A 3U5OA 2YREA 3HCSA 1RMDA 1WIMA 3ZVYA 3O70A 2M6MA 4PTBA 2ECTA 1WEQA 5D1MB 5H1TA 3IHPA 3PUQA 1F62A 2YW8A 3C6WA 5J3XA 4FJCA 3N9QA 4IC3A 4LJNA 2C2VS 2YHOA 3U5MA 2FUUA 2L75A
chains in the Genus database with same CATH superfamily
3C5KA 4WA6A 4X3GA 2RI7A 4AYCB 4GB0A 1Z60A 2YHNA 5FB0A 2KREA 2BAYA 3LDYA 2CSVA 4UI9B 3LRQA 5TABA 2LGKA 2G45A 3N9NA 2QICA 2LGLA 5EYAF 4C9ZA 3N9PA 4H9DA 4MVTA 4ZQLA 5H1UA 3QZVA 4YBMA 2E6RA 2XOYA 2D8SA 1WEPA 4A0CD 2LGVA 2F6JA 2KKXA 2VPGA 1WFKA 5B78A 4Z0OA 2CSYA 1K2FA 3ASLA 4R7EA 4AVXA 4CA1A 4OGEA 2LQ6A 3LJUX 2KR4A 3T9KA 1WESA 5C11A 3L1ZB 4BHWA 4S3OC 3U5PA 4YABA 3EB5A 5H1VA 3L1XA 5TRBA 4MSXA 3N9OA 2L5UA 1JM7A 4I7BA 3KDEC 3ZYQA 2FD4A 2Y1NA 5LKZA 3GV4A 4I7DA 1X4IA 3EB6A 1LDKC 4GNDA 2PUYA 2EGPA 5H9MA 2L0BA 2D8UA 2YSMA 3H7HA 4FIPA 2KU3A 3V43A 2KWJA 2MD7B 1ZBDB 4AP4A 5KH7A 3N9MA 2F6NA 5SVIA 2YQLA 5I3LA 3T6RA 2XOCA 4Q6FA 4S3OB 2MT5A 4N4FA 1LDJB 1X4JA 5G04B 2LAUA 3L11A 4N3WA 2M1RA 5LKUA 2PNXA 2LN0A 1DCQA 3KV5A 4OGCA 4QQ4A 2VJFA 2B0OE 3LQIA 2DX8A 5LKXA 4A4BA 4Z0RA 3E2DA 1MM3A 3JUEA 1JM7B 1WENA 3FL2A 3U5NA 2CT2A 4I7CA 2RSDA 2EXUA 4XI1A 2JMJA 4YBSA 3RPGC 3M62A 4WZ2A 2K4DA 2VPBA 2QIZA 2LGGA 2VPDA 5DKAA 1X4UA 5D1LB 4R8PK 3ZTGA 4AUQB 2L7PA 2YURA 5K3QA 2F42A 2UZGA 3SOWA 5B8DA 2XEUA 4YATA 4WZ0A 1CHCA 2H0DA 2LXHC 2YT5A 3VK6A 3GL6A 1FBVA 2HDPA 5SVIB 3FEHA 2G43A 2KFTA 2C2LA 4UP5A 4R2YA 2VNFA 5B77A 5LCWB 4BBQA 4WZ3B 4O62A 2KYUA 5KH3A 1WGMA 4A4CA 3RPGB 3O7AA 2VPEA 3NG2A 3M63A 4V3KC 3O34A 2MUMA 5D1KB 2AN6A 2VP7A 2LRIC 4O64A 1WE9A 2CSZA 5FEYA 2KGIA 2XP0A 4NN2A 2KGGA 3PURA 4L58A 1WEWA 2MIQA 1WEUA 4W4UA 2CKLA 4CCGX 4YAXA 1WILA 2P57A 5G05B 2JRJA 2VJEA 3LQJA 2YSJA 5AITA 5B75A 2ECWA 5SVXA 5TDRA 5TDWA 1MBMA 2H0DB 2YVRA 2E6SA 3DQVR 1VFYA 1HYJA 1BORA 2ECJA 2YQMA 3MHHA 2XOZA 4FO9A 2I50A 5DINA 2MNYA 2JMDA 2EGMA 2JUNA 2EA6A 5B79A 2ECGA 5FERA 4GNFA 2FSAA 2KWKA 3M7KA 4V3LC 1WEOA 3PHDA 4TKPB 4LKAA 2OXQC 1Z6UA 2QJ0A 1N87A 3O36A 4YADA 2FFWA 2NAAA 1JOCA 3T7LA 1WEVA 2CRRA 3SUBA 4LADB 3M99A 2KWNA 4LK9A 2CKLB 2Y1MA 2KWOA 4YC9A 2JMIA 2VJEB 2YYRA 1IYMA 3O47A 4L7XA 1HYIA 3LQHA 1T1HA 2K16A 5TBNA 2MA6A 2CONA 4QF3A 1DVPA 1FP0A 3N9LA 2YU4A 4YBTA 1E4UA 3MDBC 4F1PA 2G6QA 2KKYA 2M13A 2FUIA 5SVYA 3MHSA 5LKTA 1G25A 5JG6A 1V87A 3FAOA 2XB1A 4UP0A 3SOXA 3FJUB 2LXPC 5G0FA 3KNVA 2K1JA 3LVRE 4GNEA 4LLBA 3RTRB 2DJAA 2L43A 2M85A 3KV6A 2VJFB 1XWHA 3SOUA 2MNZA 4FK5A 4ZDTA 3ZPV1 3HTKC 3O35A 2OWAA 3DDTA 5C13A 2L80A 2MD8C 4P5OB 5KH9A 4A49A 5AIUA 1Z2QA 3I2DA 1VD4A 2KE1A 4PPEA 2ECVA 2LV9A 1U6GB 3DPLR 1VYXA 3O37A 3ZVZB 4B7YC 3KQIA 3DWDA 2HYED 3HCTA 2ZETC 4F52B 1WEEA 4ZUXU 3SHBA 2MKEA 5FB1A 3LVQE 2ECNA 4AYCA 5B76A 2KIZA 3HCUA 2MA5A 2LDRA 3O33A 4IC2A 2YUCA 2K17A 2M3HA 2IDAA 4GNGA 2Y43A 1WEMA 3ZPVE 3ZNIA 4QF2A 2E61A 2ECIA 4B86C 2EODA 1MM2A 3U5OA 3FM8C 2YREA 2IQJA 3HCSA 1RMDA 1WIMA 3ZVYA 3O70A 2M6MA 4PTBA 2ECTA 3PLWA 1WEQA 5D1MB 5H1TA 3FANA 2JM3A 3IHPA 3PUQA 1F62A 2YW8A 3C6WA 5J3XA 2RR4A 2CRWA 2DSMA 4FJCA 3N9QA 4IC3A 4LJNA 2C2VS 3Q1DA 2YHOA 3U5MA 2FUUA 2L75A
chains in the Genus database with same CATH topology
3C5KA 4WA6A 4X3GA 2RI7A 4AYCB 4GB0A 1Z60A 2YHNA 5FB0A 2KREA 2BAYA 4UI9B 3LRQA 5TABA 2LGKA 2G45A 3N9NA 2QICA 2LGLA 5EYAF 4C9ZA 3N9PA 4MVTA 4ZQLA 5H1UA 3QZVA 4YBMA 2E6RA 2D8SA 1WEPA 4A0CD 2LGVA 2F6JA 2VPGA 1WFKA 5B78A 2CSYA 1K2FA 3ASLA 4R7EA 4AVXA 4CA1A 2LQ6A 2KR4A 5C11A 1WESA 3L1ZB 4BHWA 4S3OC 3U5PA 4YABA 3EB5A 5H1VA 3L1XA 5TRBA 4MSXA 3N9OA 2L5UA 1JM7A 4I7BA 3ZYQA 2Y1NA 5LKZA 3GV4A 4I7DA 1X4IA 3EB6A 1LDKC 4GNDA 2PUYA 2EGPA 5H9MA 2L0BA 2YSMA 4FIPA 2KU3A 3V43A 2KWJA 2MD7B 1ZBDB 4AP4A 5KH7A 3N9MA 2F6NA 2YQLA 5I3LA 3T6RA 4Q6FA 4S3OB 2MT5A 4N4FA 1LDJB 1X4JA 5G04B 3L11A 4N3WA 2M1RA 5LKUA 2PNXA 2LN0A 3KV5A 2VJFA 3LQIA 2DX8A 5LKXA 4A4BA 1MM3A 1JM7B 1WENA 3FL2A 3U5NA 2CT2A 4I7CA 2RSDA 4XI1A 2JMJA 4YBSA 3RPGC 3M62A 4WZ2A 2K4DA 2VPBA 2QIZA 2LGGA 2VPDA 5DKAA 1X4UA 5D1LB 4R8PK 3ZTGA 4AUQB 2YURA 2F42A 2UZGA 3SOWA 5B8DA 2XEUA 4YATA 4WZ0A 1CHCA 2H0DA 2LXHC 2YT5A 3VK6A 3GL6A 1FBVA 2HDPA 2G43A 2KFTA 2C2LA 4UP5A 4R2YA 2VNFA 5B77A 5LCWB 4BBQA 4WZ3B 2KYUA 5KH3A 1WGMA 4A4CA 3RPGB 3O7AA 2VPEA 3NG2A 4V3KC 3M63A 3O34A 2MUMA 5D1KB 2AN6A 2VP7A 2LRIC 4O64A 1WE9A 2CSZA 5FEYA 2KGIA 4NN2A 2KGGA 3PURA 4L58A 1WEWA 2MIQA 1WEUA 4W4UA 2CKLA 4CCGX 4YAXA 1WILA 5G05B 2JRJA 2VJEA 3LQJA 2YSJA 5AITA 5B75A 2ECWA 5TDRA 5TDWA 2H0DB 2E6SA 3DQVR 1VFYA 1HYJA 1BORA 2ECJA 2YQMA 3MHHA 4FO9A 2I50A 5DINA 2MNYA 2JMDA 2EA6A 5B79A 2ECGA 5FERA 4GNFA 2FSAA 2KWKA 4V3LC 1WEOA 3PHDA 4TKPB 4LKAA 2OXQC 1Z6UA 2QJ0A 1N87A 3O36A 4YADA 2NAAA 1JOCA 3T7LA 1WEVA 4LADB 3M99A 2KWNA 4LK9A 2CKLB 2Y1MA 2KWOA 4YC9A 2JMIA 2VJEB 2YYRA 1IYMA 1HYIA 4L7XA 3LQHA 1T1HA 2K16A 5TBNA 2MA6A 4QF3A 1DVPA 1FP0A 3N9LA 2YU4A 4YBTA 1E4UA 2G6QA 2FUIA 3MHSA 5LKTA 1G25A 5JG6A 1V87A 2XB1A 4UP0A 3SOXA 2LXPC 5G0FA 3KNVA 2K1JA 4GNEA 4LLBA 3RTRB 2L43A 2M85A 3KV6A 2VJFB 1XWHA 3SOUA 2MNZA 4FK5A 4ZDTA 3ZPV1 3HTKC 3O35A 5C13A 2L80A 2MD8C 4P5OB 5KH9A 4A49A 5AIUA 1Z2QA 3I2DA 1VD4A 2KE1A 4PPEA 2ECVA 2LV9A 1U6GB 3DPLR 1VYXA 3O37A 3ZVZB 4B7YC 3KQIA 2HYED 3HCTA 2ZETC 4F52B 1WEEA 4ZUXU 3SHBA 5FB1A 2ECNA 4AYCA 5B76A 2KIZA 3HCUA 2MA5A 2LDRA 3O33A 4IC2A 2YUCA 2K17A 2M3HA 2IDAA 4GNGA 2Y43A 1WEMA 3ZPVE 3ZNIA 4QF2A 4B86C 2ECIA 2EODA 1MM2A 3U5OA 2YREA 3HCSA 1RMDA 1WIMA 3ZVYA 3O70A 2M6MA 4PTBA 2ECTA 1WEQA 5D1MB 5H1TA 3IHPA 3PUQA 1F62A 2YW8A 3C6WA 5J3XA 4FJCA 3N9QA 4IC3A 4LJNA 2C2VS 2YHOA 3U5MA 2FUUA 2L75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5K A;  4WA6 A;  4X3G A;  2RI7 A;  4AYC B;  4GB0 A;  1Z60 A;  2YHN A;  5FB0 A;  2KRE A;  2BAY A;  4UI9 B;  3LRQ A;  5TAB A;  2LGK A;  2G45 A;  3N9N A;  2QIC A;  2LGL A;  5EYA F;  4C9Z A;  3N9P A;  4MVT A;  4ZQL A;  5H1U A;  3QZV A;  4YBM A;  2E6R A;  2D8S A;  1WEP A;  4A0C D;  2LGV A;  2F6J A;  2VPG A;  1WFK A;  5B78 A;  2CSY A;  1K2F A;  3ASL A;  4R7E A;  4AVX A;  4CA1 A;  2LQ6 A;  2KR4 A;  5C11 A;  1WES A;  3L1Z B;  4BHW A;  4S3O C;  3U5P A;  4YAB A;  3EB5 A;  5H1V A;  3L1X A;  5TRB A;  4MSX A;  3N9O A;  2L5U A;  1JM7 A;  4I7B A;  3ZYQ A;  2Y1N A;  5LKZ A;  3GV4 A;  4I7D A;  1X4I A;  3EB6 A;  1LDK C;  4GND A;  2PUY A;  2EGP A;  5H9M A;  2L0B A;  2YSM A;  4FIP A;  2KU3 A;  3V43 A;  2KWJ A;  2MD7 B;  1ZBD B;  4AP4 A;  5KH7 A;  3N9M A;  2F6N A;  2YQL A;  5I3L A;  3T6R A;  4Q6F A;  4S3O B;  2MT5 A;  4N4F A;  1LDJ B;  1X4J A;  5G04 B;  3L11 A;  4N3W A;  2M1R A;  5LKU A;  2PNX A;  2LN0 A;  3KV5 A;  2VJF A;  3LQI A;  2DX8 A;  5LKX A;  4A4B A;  1MM3 A;  1JM7 B;  1WEN A;  3FL2 A;  3U5N A;  2CT2 A;  4I7C A;  2RSD A;  4XI1 A;  2JMJ A;  4YBS A;  3RPG C;  3M62 A;  4WZ2 A;  2K4D A;  2VPB A;  2QIZ A;  2LGG A;  2VPD A;  5DKA A;  1X4U A;  5D1L B;  4R8P K;  3ZTG A;  4AUQ B;  2YUR A;  2F42 A;  2UZG A;  3SOW A;  5B8D A;  2XEU A;  4YAT A;  4WZ0 A;  1CHC A;  2H0D A;  2LXH C;  2YT5 A;  3VK6 A;  3GL6 A;  1FBV A;  2HDP A;  2G43 A;  2KFT A;  2C2L A;  4UP5 A;  4R2Y A;  2VNF A;  5B77 A;  5LCW B;  4BBQ A;  4WZ3 B;  2KYU A;  5KH3 A;  1WGM A;  4A4C A;  3RPG B;  3O7A A;  2VPE A;  3NG2 A;  4V3K C;  3M63 A;  3O34 A;  2MUM A;  5D1K B;  2AN6 A;  2VP7 A;  2LRI C;  4O64 A;  1WE9 A;  2CSZ A;  5FEY A;  2KGI A;  4NN2 A;  2KGG A;  3PUR A;  4L58 A;  1WEW A;  2MIQ A;  1WEU A;  4W4U A;  2CKL A;  4CCG X;  4YAX A;  1WIL A;  5G05 B;  2JRJ A;  2VJE A;  3LQJ A;  2YSJ A;  5AIT A;  5B75 A;  2ECW A;  5TDR A;  5TDW A;  2H0D B;  2E6S A;  3DQV R;  1VFY A;  1HYJ A;  1BOR A;  2ECJ A;  2YQM A;  3MHH A;  4FO9 A;  2I50 A;  5DIN A;  2MNY A;  2JMD A;  2EA6 A;  5B79 A;  2ECG A;  5FER A;  4GNF A;  2FSA A;  2KWK A;  4V3L C;  1WEO A;  3PHD A;  4TKP B;  4LKA A;  2OXQ C;  1Z6U A;  2QJ0 A;  1N87 A;  3O36 A;  4YAD A;  2NAA A;  1JOC A;  3T7L A;  1WEV A;  4LAD B;  3M99 A;  2KWN A;  4LK9 A;  2CKL B;  2Y1M A;  2KWO A;  4YC9 A;  2JMI A;  2VJE B;  2YYR A;  1IYM A;  1HYI A;  4L7X A;  3LQH A;  1T1H A;  2K16 A;  5TBN A;  2MA6 A;  4QF3 A;  1DVP A;  1FP0 A;  3N9L A;  2YU4 A;  4YBT A;  1E4U A;  2G6Q A;  2FUI A;  3MHS A;  5LKT A;  1G25 A;  5JG6 A;  1V87 A;  2XB1 A;  4UP0 A;  3SOX A;  2LXP C;  5G0F A;  3KNV A;  2K1J A;  4GNE A;  4LLB A;  3RTR B;  2L43 A;  2M85 A;  3KV6 A;  2VJF B;  1XWH A;  3SOU A;  2MNZ A;  4FK5 A;  4ZDT A;  3ZPV 1;  3HTK C;  3O35 A;  5C13 A;  2L80 A;  2MD8 C;  4P5O B;  5KH9 A;  4A49 A;  5AIU A;  1Z2Q A;  3I2D A;  1VD4 A;  2KE1 A;  4PPE A;  2ECV A;  2LV9 A;  1U6G B;  3DPL R;  1VYX A;  3O37 A;  3ZVZ B;  4B7Y C;  3KQI A;  2HYE D;  3HCT A;  2ZET C;  4F52 B;  1WEE A;  4ZUX U;  3SHB A;  5FB1 A;  2ECN A;  4AYC A;  5B76 A;  2KIZ A;  3HCU A;  2MA5 A;  2LDR A;  3O33 A;  4IC2 A;  2YUC A;  2K17 A;  2M3H A;  2IDA A;  4GNG A;  2Y43 A;  1WEM A;  3ZPV E;  3ZNI A;  4QF2 A;  4B86 C;  2ECI A;  2EOD A;  1MM2 A;  3U5O A;  2YRE A;  3HCS A;  1RMD A;  1WIM A;  3ZVY A;  3O70 A;  2M6M A;  4PTB A;  2ECT A;  1WEQ A;  5D1M B;  5H1T A;  3IHP A;  3PUQ A;  1F62 A;  2YW8 A;  3C6W A;  5J3X A;  4FJC A;  3N9Q A;  4IC3 A;  4LJN A;  2C2V S;  2YHO A;  3U5M A;  2FUU A;  2L75 A; 
#chains in the Genus database with same CATH topology
 3C5K A;  4WA6 A;  4X3G A;  2RI7 A;  4AYC B;  4GB0 A;  1Z60 A;  2YHN A;  5FB0 A;  2KRE A;  2BAY A;  3LDY A;  2CSV A;  4UI9 B;  3LRQ A;  5TAB A;  2LGK A;  2G45 A;  3N9N A;  2QIC A;  2LGL A;  5EYA F;  4C9Z A;  3N9P A;  4H9D A;  4MVT A;  4ZQL A;  5H1U A;  3QZV A;  4YBM A;  2E6R A;  2XOY A;  2D8S A;  1WEP A;  4A0C D;  2LGV A;  2F6J A;  2KKX A;  2VPG A;  1WFK A;  5B78 A;  4Z0O A;  2CSY A;  1K2F A;  3ASL A;  4R7E A;  4AVX A;  4CA1 A;  4OGE A;  2LQ6 A;  3LJU X;  2KR4 A;  3T9K A;  1WES A;  5C11 A;  3L1Z B;  4BHW A;  4S3O C;  3U5P A;  4YAB A;  3EB5 A;  5H1V A;  3L1X A;  5TRB A;  4MSX A;  3N9O A;  2L5U A;  1JM7 A;  4I7B A;  3KDE C;  3ZYQ A;  2FD4 A;  2Y1N A;  5LKZ A;  3GV4 A;  4I7D A;  1X4I A;  3EB6 A;  1LDK C;  4GND A;  2PUY A;  2EGP A;  5H9M A;  2L0B A;  2D8U A;  2YSM A;  3H7H A;  4FIP A;  2KU3 A;  3V43 A;  2KWJ A;  2MD7 B;  1ZBD B;  4AP4 A;  5KH7 A;  3N9M A;  2F6N A;  5SVI A;  2YQL A;  5I3L A;  3T6R A;  2XOC A;  4Q6F A;  4S3O B;  2MT5 A;  4N4F A;  1LDJ B;  1X4J A;  5G04 B;  2LAU A;  3L11 A;  4N3W A;  2M1R A;  5LKU A;  2PNX A;  2LN0 A;  1DCQ A;  3KV5 A;  4OGC A;  4QQ4 A;  2VJF A;  2B0O E;  3LQI A;  2DX8 A;  5LKX A;  4A4B A;  4Z0R A;  3E2D A;  1MM3 A;  3JUE A;  1JM7 B;  1WEN A;  3FL2 A;  3U5N A;  2CT2 A;  4I7C A;  2RSD A;  2EXU A;  4XI1 A;  2JMJ A;  4YBS A;  3RPG C;  3M62 A;  4WZ2 A;  2K4D A;  2VPB A;  2QIZ A;  2LGG A;  2VPD A;  5DKA A;  1X4U A;  5D1L B;  4R8P K;  3ZTG A;  4AUQ B;  2L7P A;  2YUR A;  5K3Q A;  2F42 A;  2UZG A;  3SOW A;  5B8D A;  2XEU A;  4YAT A;  4WZ0 A;  1CHC A;  2H0D A;  2LXH C;  2YT5 A;  3VK6 A;  3GL6 A;  1FBV A;  2HDP A;  5SVI B;  3FEH A;  2G43 A;  2KFT A;  2C2L A;  4UP5 A;  4R2Y A;  2VNF A;  5B77 A;  5LCW B;  4BBQ A;  4WZ3 B;  4O62 A;  2KYU A;  5KH3 A;  1WGM A;  4A4C A;  3RPG B;  3O7A A;  2VPE A;  3NG2 A;  3M63 A;  4V3K C;  3O34 A;  2MUM A;  5D1K B;  2AN6 A;  2VP7 A;  2LRI C;  4O64 A;  1WE9 A;  2CSZ A;  5FEY A;  2KGI A;  2XP0 A;  4NN2 A;  2KGG A;  3PUR A;  4L58 A;  1WEW A;  2MIQ A;  1WEU A;  4W4U A;  2CKL A;  4CCG X;  4YAX A;  1WIL A;  2P57 A;  5G05 B;  2JRJ A;  2VJE A;  3LQJ A;  2YSJ A;  5AIT A;  5B75 A;  2ECW A;  5SVX A;  5TDR A;  5TDW A;  1MBM A;  2H0D B;  2YVR A;  2E6S A;  3DQV R;  1VFY A;  1HYJ A;  1BOR A;  2ECJ A;  2YQM A;  3MHH A;  2XOZ A;  4FO9 A;  2I50 A;  5DIN A;  2MNY A;  2JMD A;  2EGM A;  2JUN A;  2EA6 A;  5B79 A;  2ECG A;  5FER A;  4GNF A;  2FSA A;  2KWK A;  3M7K A;  4V3L C;  1WEO A;  3PHD A;  4TKP B;  4LKA A;  2OXQ C;  1Z6U A;  2QJ0 A;  1N87 A;  3O36 A;  4YAD A;  2FFW A;  2NAA A;  1JOC A;  3T7L A;  1WEV A;  2CRR A;  3SUB A;  4LAD B;  3M99 A;  2KWN A;  4LK9 A;  2CKL B;  2Y1M A;  2KWO A;  4YC9 A;  2JMI A;  2VJE B;  2YYR A;  1IYM A;  3O47 A;  4L7X A;  1HYI A;  3LQH A;  1T1H A;  2K16 A;  5TBN A;  2MA6 A;  2CON A;  4QF3 A;  1DVP A;  1FP0 A;  3N9L A;  2YU4 A;  4YBT A;  1E4U A;  3MDB C;  4F1P A;  2G6Q A;  2KKY A;  2M13 A;  2FUI A;  5SVY A;  3MHS A;  5LKT A;  1G25 A;  5JG6 A;  1V87 A;  3FAO A;  2XB1 A;  4UP0 A;  3SOX A;  3FJU B;  2LXP C;  5G0F A;  3KNV A;  2K1J A;  3LVR E;  4GNE A;  4LLB A;  3RTR B;  2DJA A;  2L43 A;  2M85 A;  3KV6 A;  2VJF B;  1XWH A;  3SOU A;  2MNZ A;  4FK5 A;  4ZDT A;  3ZPV 1;  3HTK C;  3O35 A;  2OWA A;  3DDT A;  5C13 A;  2L80 A;  2MD8 C;  4P5O B;  5KH9 A;  4A49 A;  5AIU A;  1Z2Q A;  3I2D A;  1VD4 A;  2KE1 A;  4PPE A;  2ECV A;  2LV9 A;  1U6G B;  3DPL R;  1VYX A;  3O37 A;  3ZVZ B;  4B7Y C;  3KQI A;  3DWD A;  2HYE D;  3HCT A;  2ZET C;  4F52 B;  1WEE A;  4ZUX U;  3SHB A;  2MKE A;  5FB1 A;  3LVQ E;  2ECN A;  4AYC A;  5B76 A;  2KIZ A;  3HCU A;  2MA5 A;  2LDR A;  3O33 A;  4IC2 A;  2YUC A;  2K17 A;  2M3H A;  2IDA A;  4GNG A;  2Y43 A;  1WEM A;  3ZPV E;  3ZNI A;  4QF2 A;  2E61 A;  2ECI A;  4B86 C;  2EOD A;  1MM2 A;  3U5O A;  3FM8 C;  2YRE A;  2IQJ A;  3HCS A;  1RMD A;  1WIM A;  3ZVY A;  3O70 A;  2M6M A;  4PTB A;  2ECT A;  3PLW A;  1WEQ A;  5D1M B;  5H1T A;  3FAN A;  2JM3 A;  3IHP A;  3PUQ A;  1F62 A;  2YW8 A;  3C6W A;  5J3X A;  2RR4 A;  2CRW A;  2DSM A;  4FJC A;  3N9Q A;  4IC3 A;  4LJN A;  2C2V S;  3Q1D A;  2YHO A;  3U5M A;  2FUU A;  2L75 A; 
#chains in the Genus database with same CATH homology
 3C5K A;  4WA6 A;  4X3G A;  2RI7 A;  4AYC B;  4GB0 A;  1Z60 A;  2YHN A;  5FB0 A;  2KRE A;  2BAY A;  4UI9 B;  3LRQ A;  5TAB A;  2LGK A;  2G45 A;  3N9N A;  2QIC A;  2LGL A;  5EYA F;  4C9Z A;  3N9P A;  4MVT A;  4ZQL A;  5H1U A;  3QZV A;  4YBM A;  2E6R A;  2D8S A;  1WEP A;  4A0C D;  2LGV A;  2F6J A;  2VPG A;  1WFK A;  5B78 A;  2CSY A;  1K2F A;  3ASL A;  4R7E A;  4AVX A;  4CA1 A;  2LQ6 A;  2KR4 A;  5C11 A;  1WES A;  3L1Z B;  4BHW A;  4S3O C;  3U5P A;  4YAB A;  3EB5 A;  5H1V A;  3L1X A;  5TRB A;  4MSX A;  3N9O A;  2L5U A;  1JM7 A;  4I7B A;  3ZYQ A;  2Y1N A;  5LKZ A;  3GV4 A;  4I7D A;  1X4I A;  3EB6 A;  1LDK C;  4GND A;  2PUY A;  2EGP A;  5H9M A;  2L0B A;  2YSM A;  4FIP A;  2KU3 A;  3V43 A;  2KWJ A;  2MD7 B;  1ZBD B;  4AP4 A;  5KH7 A;  3N9M A;  2F6N A;  2YQL A;  5I3L A;  3T6R A;  4Q6F A;  4S3O B;  2MT5 A;  4N4F A;  1LDJ B;  1X4J A;  5G04 B;  3L11 A;  4N3W A;  2M1R A;  5LKU A;  2PNX A;  2LN0 A;  3KV5 A;  2VJF A;  3LQI A;  2DX8 A;  5LKX A;  4A4B A;  1MM3 A;  1JM7 B;  1WEN A;  3FL2 A;  3U5N A;  2CT2 A;  4I7C A;  2RSD A;  4XI1 A;  2JMJ A;  4YBS A;  3RPG C;  3M62 A;  4WZ2 A;  2K4D A;  2VPB A;  2QIZ A;  2LGG A;  2VPD A;  5DKA A;  1X4U A;  5D1L B;  4R8P K;  3ZTG A;  4AUQ B;  2YUR A;  2F42 A;  2UZG A;  3SOW A;  5B8D A;  2XEU A;  4YAT A;  4WZ0 A;  1CHC A;  2H0D A;  2LXH C;  2YT5 A;  3VK6 A;  3GL6 A;  1FBV A;  2HDP A;  2G43 A;  2KFT A;  2C2L A;  4UP5 A;  4R2Y A;  2VNF A;  5B77 A;  5LCW B;  4BBQ A;  4WZ3 B;  2KYU A;  5KH3 A;  1WGM A;  4A4C A;  3RPG B;  3O7A A;  2VPE A;  3NG2 A;  4V3K C;  3M63 A;  3O34 A;  2MUM A;  5D1K B;  2AN6 A;  2VP7 A;  2LRI C;  4O64 A;  1WE9 A;  2CSZ A;  5FEY A;  2KGI A;  4NN2 A;  2KGG A;  3PUR A;  4L58 A;  1WEW A;  2MIQ A;  1WEU A;  4W4U A;  2CKL A;  4CCG X;  4YAX A;  1WIL A;  5G05 B;  2JRJ A;  2VJE A;  3LQJ A;  2YSJ A;  5AIT A;  5B75 A;  2ECW A;  5TDR A;  5TDW A;  2H0D B;  2E6S A;  3DQV R;  1VFY A;  1HYJ A;  1BOR A;  2ECJ A;  2YQM A;  3MHH A;  4FO9 A;  2I50 A;  5DIN A;  2MNY A;  2JMD A;  2EA6 A;  5B79 A;  2ECG A;  5FER A;  4GNF A;  2FSA A;  2KWK A;  4V3L C;  1WEO A;  3PHD A;  4TKP B;  4LKA A;  2OXQ C;  1Z6U A;  2QJ0 A;  1N87 A;  3O36 A;  4YAD A;  2NAA A;  1JOC A;  3T7L A;  1WEV A;  4LAD B;  3M99 A;  2KWN A;  4LK9 A;  2CKL B;  2Y1M A;  2KWO A;  4YC9 A;  2JMI A;  2VJE B;  2YYR A;  1IYM A;  1HYI A;  4L7X A;  3LQH A;  1T1H A;  2K16 A;  5TBN A;  2MA6 A;  4QF3 A;  1DVP A;  1FP0 A;  3N9L A;  2YU4 A;  4YBT A;  1E4U A;  2G6Q A;  2FUI A;  3MHS A;  5LKT A;  1G25 A;  5JG6 A;  1V87 A;  2XB1 A;  4UP0 A;  3SOX A;  2LXP C;  5G0F A;  3KNV A;  2K1J A;  4GNE A;  4LLB A;  3RTR B;  2L43 A;  2M85 A;  3KV6 A;  2VJF B;  1XWH A;  3SOU A;  2MNZ A;  4FK5 A;  4ZDT A;  3ZPV 1;  3HTK C;  3O35 A;  5C13 A;  2L80 A;  2MD8 C;  4P5O B;  5KH9 A;  4A49 A;  5AIU A;  1Z2Q A;  3I2D A;  1VD4 A;  2KE1 A;  4PPE A;  2ECV A;  2LV9 A;  1U6G B;  3DPL R;  1VYX A;  3O37 A;  3ZVZ B;  4B7Y C;  3KQI A;  2HYE D;  3HCT A;  2ZET C;  4F52 B;  1WEE A;  4ZUX U;  3SHB A;  5FB1 A;  2ECN A;  4AYC A;  5B76 A;  2KIZ A;  3HCU A;  2MA5 A;  2LDR A;  3O33 A;  4IC2 A;  2YUC A;  2K17 A;  2M3H A;  2IDA A;  4GNG A;  2Y43 A;  1WEM A;  3ZPV E;  3ZNI A;  4QF2 A;  4B86 C;  2ECI A;  2EOD A;  1MM2 A;  3U5O A;  2YRE A;  3HCS A;  1RMD A;  1WIM A;  3ZVY A;  3O70 A;  2M6M A;  4PTB A;  2ECT A;  1WEQ A;  5D1M B;  5H1T A;  3IHP A;  3PUQ A;  1F62 A;  2YW8 A;  3C6W A;  5J3X A;  4FJC A;  3N9Q A;  4IC3 A;  4LJN A;  2C2V S;  2YHO A;  3U5M A;  2FUU A;  2L75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...