1HYIA

Solution structure of the eea1 fyve domain complexed with inositol 1,3-bisphosphate
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
65
Chain Sequence
RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of endosome docking by the FYVE domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords ENDOSOME-ASSOCIATED PROTEIN
total genus 7
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1hyiA00
2LRIC 2H0DA 2M6MA 2VJEA 4N3WA 2UZGA 1BORA 2KYUA 5G04B 3SOXA 2C2LA 4GNEA 2YQMA 5D1KB 5B78A 3N9OA 3N9LA 4YAXA 2K17A 2CSZA 4BBQA 1XWHA 4L58A 1ZBDB 5C11A 1JM7A 2VJEB 2KR4A 5B75A 3PHDA 4X3GA 2M1RA 2MUMA 4R2YA 5I3LA 1HYIA 3KNVA 3PURA 1VYXA 2EODA 4LADB 3VK6A 4YBSA 4P5OB 3HCSA 3DPLR 4Q6FA 4FIPA 3O7AA 3C6WA 3FL2A 3ZNIA 3O37A 2G6QA 4UP0A 1WE9A 4V3LC 1WEOA 2D8SA 3SOWA 1WGMA 2VJFA 3ZTGA 3KV6A 2XEUA 4AYCB 2KIZA 2ECVA 4YBMA 2KWJA 3ASLA 2KGGA 2YW8A 4WZ2A 2K16A 3M99A 4YABA 4UP5A 4F52B 4AVXA 2VJFB 4QF2A 4CCGX 4AP4A 1F62A 2YHNA 1WEWA 3PUQA 5LCWB 4WZ3B 2DX8A 1WFKA 2L0BA 2YREA 1WEMA 3RPGC 3MHSA 5TDRA 1WEEA 4I7CA 4AYCA 3U5NA 1JM7B 4O64A 4B86C 2VNFA 2IDAA 2LV9A 2LGGA 2Y43A 3MHHA 2LXHC 2EA6A 4GB0A 1U6GB 3T7LA 3ZYQA 1HYJA 5AIUA 2C2VS 4MVTA 3RPGB 2CKLA 1X4UA 4A4BA 3L1XA 5KH3A 2YQLA 5JG6A 3RTRB 2KGIA 3U5MA 1Z6UA 5H9MA 4YC9A 2F6NA 3N9QA 2ECTA 2RSDA 1WILA 4FJCA 3EB5A 2HYED 1X4JA 2Y1NA 4IC2A 4A4CA 5DKAA 3U5PA 2LXPC 4NN2A 2MIQA 4W4UA 2E6SA 4ZUXU 2ZETC 1JOCA 2FUIA 4R8PK 5FB1A 4A49A 2MT5A 2CSYA 5LKUA 1MM3A 3M63A 2VPDA 2L80A 5D1MB 4R7EA 2YT5A 3V43A 3C5KA 5B79A 3O36A 1WENA 4LKAA 2JMDA 3ZVYA 5H1TA 1FBVA 2ECNA 1MM2A 1WIMA 2RI7A 2YUCA 1WEPA 1WEVA 3O35A 4IC3A 4C9ZA 1VD4A 2YU4A 1V87A 5G0FA 5B8DA 2G45A 4I7BA 5TBNA 3U5OA 2VPEA 2QIZA 1DVPA 3O33A 5KH9A 2VPBA 5B76A 1WEUA 4MSXA 2CKLB 2HDPA 2KWKA 2VP7A 3M62A 2LN0A 5TRBA 3KQIA 3LQIA 2L75A 1N87A 4FO9A 3QZVA 3ZPV1 2LGVA 2VPGA 3GL6A 5G05B 3N9PA 2QICA 4PPEA 1LDKC 1IYMA 2YHOA 1RMDA 1Z60A 3LQJA 1CHCA 1FP0A 4XI1A 2MA5A 1WESA 2OXQC 4L7XA 3EB6A 5LKXA 2KWOA 2JRJA 4GNFA 3I2DA 5FERA 1T1HA 4YADA 5TABA 3SHBA 2K4DA 5AITA 4WA6A 3O34A 4LLBA 3IHPA 2NAAA 4LK9A 2ECWA 3SOUA 2LQ6A 3O70A 2MA6A 4S3OC 1Z2QA 2ECIA 2KU3A 3HCTA 2I50A 2G43A 4UI9B 2M3HA 3KV5A 4N4FA 2YYRA 4A0CD 3HCUA 4LJNA 4BHWA 3ZPVE 4AUQB 5D1LB 2KWNA 2LGKA 2BAYA 2MNZA 3N9MA 2MD7B 1K2FA 4B7YC 1X4IA 2MNYA 2YSJA 3GV4A 3HTKC 2JMIA 3LQHA 2MD8C 3NG2A 2YSMA 1LDJB 2K1JA 1WEQA 4I7DA 5FEYA 4GNDA 2ECJA 4WZ0A 2CT2A 5DINA 2AN6A 2FSAA 2PNXA 4ZQLA 2Y1MA 2YURA 2M85A 5H1UA 3ZVZB 2QJ0A 3L1ZB 4QF3A 2F42A 3DQVR 2FUUA 5H1VA 1VFYA 2JMJA 2LGLA 4YBTA 4PTBA 5B77A 3N9NA 2KE1A 2E6RA 4V3KC 5LKZA 5KH7A 2ECGA 2PUYA 2EGPA 5TDWA 2KFTA 4ZDTA 2KREA 2LDRA 2F6JA 3T6RA 2L5UA 3LRQA 5J3XA 2H0DB 3L11A 2XB1A 5C13A 4CA1A 5LKTA 4S3OB 4YATA 4FK5A 4GNGA 5FB0A 2L43A 4TKPB 1E4UA 5EYAF 1G25A
chains in the Genus database with same CATH superfamily
2LRIC 2H0DA 2M6MA 2VJEA 2XOCA 4N3WA 5G04B 2UZGA 1BORA 2KYUA 3SOXA 2M13A 2C2LA 2XP0A 4GNEA 2YQMA 5D1KB 5B78A 3N9OA 3N9LA 4YAXA 2K17A 2CSZA 4BBQA 1XWHA 4L58A 1ZBDB 2LAUA 5C11A 1JM7A 2VJEB 5K3QA 2KR4A 2L7PA 5B75A 3PHDA 4X3GA 2M1RA 2MUMA 4R2YA 5I3LA 1HYIA 3KNVA 3PURA 1VYXA 2EODA 4LADB 3FJUB 3VK6A 4YBSA 4P5OB 3HCSA 3DPLR 4Q6FA 5SVXA 4FIPA 3O7AA 3C6WA 3FL2A 3ZNIA 3O37A 4F1PA 2G6QA 2OWAA 4UP0A 1WE9A 4V3LC 3FANA 2EXUA 1WEOA 2D8SA 3SOWA 1WGMA 2VJFA 3ZTGA 3KV6A 2XEUA 4AYCB 2KIZA 2ECVA 4YBMA 2KWJA 3ASLA 2KGGA 2YW8A 4WZ2A 2K16A 3M99A 4YABA 4UP5A 4F52B 4AVXA 2VJFB 4QF2A 4OGEA 4CCGX 2EGMA 4AP4A 1F62A 2YHNA 1WEWA 3PUQA 5LCWB 4WZ3B 3FAOA 1DCQA 2DX8A 1WFKA 2L0BA 2YREA 1WEMA 3RPGC 3MHSA 5TDRA 1WEEA 4I7CA 4Z0OA 4AYCA 3U5NA 1JM7B 4O64A 4QQ4A 4B86C 2VNFA 2IDAA 2LV9A 3DDTA 2LGGA 2Y43A 3MHHA 2LXHC 2FFWA 2B0OE 4GB0A 2EA6A 1U6GB 3T7LA 3FEHA 3ZYQA 1HYJA 5AIUA 2C2VS 4H9DA 4MVTA 3LJUX 3RPGB 2CKLA 1X4UA 4A4BA 3L1XA 5KH3A 2YQLA 5JG6A 3RTRB 2RR4A 2KGIA 3PLWA 3U5MA 1Z6UA 5H9MA 4YC9A 2F6NA 3N9QA 4OGCA 2ECTA 2RSDA 1WILA 4FJCA 3EB5A 2HYED 1X4JA 2Y1NA 4IC2A 4A4CA 5DKAA 3U5PA 2LXPC 4NN2A 2MIQA 4W4UA 2KKYA 3O47A 4O62A 2E6SA 4ZUXU 3LVQE 2ZETC 1JOCA 2FUIA 4R8PK 5FB1A 4A49A 2MT5A 2DSMA 2CSYA 5LKUA 1MM3A 2CRWA 3M63A 2JM3A 2VPDA 2L80A 5D1MB 4R7EA 2YT5A 3V43A 3DWDA 2D8UA 3C5KA 5B79A 3O36A 1WENA 4LKAA 2JMDA 3ZVYA 5H1TA 1FBVA 2ECNA 1MM2A 1WIMA 2RI7A 2YUCA 1WEPA 1WEVA 3O35A 4IC3A 4C9ZA 1VD4A 2YU4A 1V87A 5G0FA 5B8DA 2G45A 3JUEA 4I7BA 5TBNA 3U5OA 3MDBC 2VPEA 2QIZA 2CSVA 1DVPA 3O33A 3KDEC 5KH9A 2VPBA 5B76A 2DJAA 1WEUA 2E61A 4MSXA 2CKLB 2HDPA 2KWKA 2VP7A 3M62A 2LN0A 5TRBA 3KQIA 3LQIA 2L75A 1N87A 4FO9A 3QZVA 2IQJA 2LGVA 3ZPV1 2VPGA 3GL6A 5G05B 3N9PA 2QICA 4PPEA 2XOYA 1LDKC 1IYMA 2YHOA 1RMDA 1Z60A 3LQJA 1CHCA 1FP0A 4XI1A 2MA5A 1WESA 2OXQC 2KKXA 4L7XA 4Z0RA 3EB6A 5LKXA 2KWOA 2P57A 2JRJA 4GNFA 3I2DA 5FERA 1T1HA 4YADA 5TABA 3SHBA 2K4DA 5AITA 4WA6A 3O34A 4LLBA 3SUBA 3IHPA 2NAAA 2CRRA 4LK9A 2ECWA 3M7KA 3SOUA 2LQ6A 3O70A 2MA6A 4S3OC 1Z2QA 2ECIA 2KU3A 3HCTA 2I50A 2G43A 4UI9B 2M3HA 3KV5A 4N4FA 2YYRA 3H7HA 4A0CD 3HCUA 4LJNA 3T9KA 4BHWA 3ZPVE 4AUQB 5D1LB 2XOZA 2KWNA 2LGKA 2BAYA 2MNZA 3LDYA 3N9MA 2MD7B 1K2FA 3LVRE 4B7YC 1X4IA 2JUNA 2MNYA 2YSJA 3GV4A 3HTKC 2JMIA 3LQHA 2MD8C 3NG2A 2MKEA 2YSMA 2CONA 1LDJB 2K1JA 1WEQA 4I7DA 5SVIA 5FEYA 4GNDA 2ECJA 4WZ0A 2CT2A 5DINA 4ZQLA 2AN6A 2FSAA 2PNXA 2Y1MA 2YURA 2M85A 5H1UA 3ZVZB 2QJ0A 3L1ZB 4QF3A 2F42A 3DQVR 2FUUA 1VFYA 2JMJA 2LGLA 4YBTA 5H1VA 4PTBA 5B77A 3N9NA 2KE1A 2E6RA 4V3KC 1MBMA 5SVYA 5KH7A 5LKZA 2ECGA 2PUYA 2EGPA 3E2DA 5TDWA 2KFTA 4ZDTA 2KREA 2LDRA 2F6JA 5SVIB 3T6RA 2L5UA 2FD4A 3LRQA 5J3XA 3Q1DA 2H0DB 2YVRA 3L11A 2XB1A 5C13A 4CA1A 5LKTA 3FM8C 4S3OB 4YATA 4FK5A 4GNGA 5FB0A 2L43A 4TKPB 1E4UA 5EYAF 1G25A
chains in the Genus database with same CATH topology
2LRIC 2H0DA 2M6MA 2VJEA 4N3WA 2UZGA 1BORA 2KYUA 5G04B 3SOXA 2C2LA 4GNEA 2YQMA 5D1KB 5B78A 3N9OA 3N9LA 4YAXA 2K17A 2CSZA 4BBQA 1XWHA 4L58A 1ZBDB 5C11A 1JM7A 2VJEB 2KR4A 5B75A 3PHDA 4X3GA 2M1RA 2MUMA 4R2YA 5I3LA 1HYIA 3KNVA 3PURA 1VYXA 2EODA 4LADB 3VK6A 4YBSA 4P5OB 3HCSA 3DPLR 4Q6FA 4FIPA 3O7AA 3C6WA 3FL2A 3ZNIA 3O37A 2G6QA 4UP0A 1WE9A 4V3LC 1WEOA 2D8SA 3SOWA 1WGMA 2VJFA 3ZTGA 3KV6A 2XEUA 4AYCB 2KIZA 2ECVA 4YBMA 2KWJA 3ASLA 2KGGA 2YW8A 4WZ2A 2K16A 3M99A 4YABA 4UP5A 4F52B 4AVXA 2VJFB 4QF2A 4CCGX 4AP4A 1F62A 2YHNA 1WEWA 3PUQA 5LCWB 4WZ3B 2DX8A 1WFKA 2L0BA 2YREA 1WEMA 3RPGC 3MHSA 5TDRA 1WEEA 4I7CA 4AYCA 3U5NA 1JM7B 4O64A 4B86C 2VNFA 2IDAA 2LV9A 2LGGA 2Y43A 3MHHA 2LXHC 2EA6A 4GB0A 1U6GB 3T7LA 3ZYQA 1HYJA 5AIUA 2C2VS 4MVTA 3RPGB 2CKLA 1X4UA 4A4BA 3L1XA 5KH3A 2YQLA 5JG6A 3RTRB 2KGIA 3U5MA 1Z6UA 5H9MA 4YC9A 2F6NA 3N9QA 2ECTA 2RSDA 1WILA 4FJCA 3EB5A 2HYED 1X4JA 2Y1NA 4IC2A 4A4CA 5DKAA 3U5PA 2LXPC 4NN2A 2MIQA 4W4UA 2E6SA 4ZUXU 2ZETC 1JOCA 2FUIA 4R8PK 5FB1A 4A49A 2MT5A 2CSYA 5LKUA 1MM3A 3M63A 2VPDA 2L80A 5D1MB 4R7EA 2YT5A 3V43A 3C5KA 5B79A 3O36A 1WENA 4LKAA 2JMDA 3ZVYA 5H1TA 1FBVA 2ECNA 1MM2A 1WIMA 2RI7A 2YUCA 1WEPA 1WEVA 3O35A 4IC3A 4C9ZA 1VD4A 2YU4A 1V87A 5G0FA 5B8DA 2G45A 4I7BA 5TBNA 3U5OA 2VPEA 2QIZA 1DVPA 3O33A 5KH9A 2VPBA 5B76A 1WEUA 4MSXA 2CKLB 2HDPA 2KWKA 2VP7A 3M62A 2LN0A 5TRBA 3KQIA 3LQIA 2L75A 1N87A 4FO9A 3QZVA 3ZPV1 2LGVA 2VPGA 3GL6A 5G05B 3N9PA 2QICA 4PPEA 1LDKC 1IYMA 2YHOA 1RMDA 1Z60A 3LQJA 1CHCA 1FP0A 4XI1A 2MA5A 1WESA 2OXQC 4L7XA 3EB6A 5LKXA 2KWOA 2JRJA 4GNFA 3I2DA 5FERA 1T1HA 4YADA 5TABA 3SHBA 2K4DA 5AITA 4WA6A 3O34A 4LLBA 3IHPA 2NAAA 4LK9A 2ECWA 3SOUA 2LQ6A 3O70A 2MA6A 4S3OC 1Z2QA 2ECIA 2KU3A 3HCTA 2I50A 2G43A 4UI9B 2M3HA 3KV5A 4N4FA 2YYRA 4A0CD 3HCUA 4LJNA 4BHWA 3ZPVE 4AUQB 5D1LB 2KWNA 2LGKA 2BAYA 2MNZA 3N9MA 2MD7B 1K2FA 4B7YC 1X4IA 2MNYA 2YSJA 3GV4A 3HTKC 2JMIA 3LQHA 2MD8C 3NG2A 2YSMA 1LDJB 2K1JA 1WEQA 4I7DA 5FEYA 4GNDA 2ECJA 4WZ0A 2CT2A 5DINA 2AN6A 2FSAA 2PNXA 4ZQLA 2Y1MA 2YURA 2M85A 5H1UA 3ZVZB 2QJ0A 3L1ZB 4QF3A 2F42A 3DQVR 2FUUA 5H1VA 1VFYA 2JMJA 2LGLA 4YBTA 4PTBA 5B77A 3N9NA 2KE1A 2E6RA 4V3KC 5LKZA 5KH7A 2ECGA 2PUYA 2EGPA 5TDWA 2KFTA 4ZDTA 2KREA 2LDRA 2F6JA 3T6RA 2L5UA 3LRQA 5J3XA 2H0DB 3L11A 2XB1A 5C13A 4CA1A 5LKTA 4S3OB 4YATA 4FK5A 4GNGA 5FB0A 2L43A 4TKPB 1E4UA 5EYAF 1G25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRI C;  2H0D A;  2M6M A;  2VJE A;  4N3W A;  2UZG A;  1BOR A;  2KYU A;  5G04 B;  3SOX A;  2C2L A;  4GNE A;  2YQM A;  5D1K B;  5B78 A;  3N9O A;  3N9L A;  4YAX A;  2K17 A;  2CSZ A;  4BBQ A;  1XWH A;  4L58 A;  1ZBD B;  5C11 A;  1JM7 A;  2VJE B;  2KR4 A;  5B75 A;  3PHD A;  4X3G A;  2M1R A;  2MUM A;  4R2Y A;  5I3L A;  1HYI A;  3KNV A;  3PUR A;  1VYX A;  2EOD A;  4LAD B;  3VK6 A;  4YBS A;  4P5O B;  3HCS A;  3DPL R;  4Q6F A;  4FIP A;  3O7A A;  3C6W A;  3FL2 A;  3ZNI A;  3O37 A;  2G6Q A;  4UP0 A;  1WE9 A;  4V3L C;  1WEO A;  2D8S A;  3SOW A;  1WGM A;  2VJF A;  3ZTG A;  3KV6 A;  2XEU A;  4AYC B;  2KIZ A;  2ECV A;  4YBM A;  2KWJ A;  3ASL A;  2KGG A;  2YW8 A;  4WZ2 A;  2K16 A;  3M99 A;  4YAB A;  4UP5 A;  4F52 B;  4AVX A;  2VJF B;  4QF2 A;  4CCG X;  4AP4 A;  1F62 A;  2YHN A;  1WEW A;  3PUQ A;  5LCW B;  4WZ3 B;  2DX8 A;  1WFK A;  2L0B A;  2YRE A;  1WEM A;  3RPG C;  3MHS A;  5TDR A;  1WEE A;  4I7C A;  4AYC A;  3U5N A;  1JM7 B;  4O64 A;  4B86 C;  2VNF A;  2IDA A;  2LV9 A;  2LGG A;  2Y43 A;  3MHH A;  2LXH C;  2EA6 A;  4GB0 A;  1U6G B;  3T7L A;  3ZYQ A;  1HYJ A;  5AIU A;  2C2V S;  4MVT A;  3RPG B;  2CKL A;  1X4U A;  4A4B A;  3L1X A;  5KH3 A;  2YQL A;  5JG6 A;  3RTR B;  2KGI A;  3U5M A;  1Z6U A;  5H9M A;  4YC9 A;  2F6N A;  3N9Q A;  2ECT A;  2RSD A;  1WIL A;  4FJC A;  3EB5 A;  2HYE D;  1X4J A;  2Y1N A;  4IC2 A;  4A4C A;  5DKA A;  3U5P A;  2LXP C;  4NN2 A;  2MIQ A;  4W4U A;  2E6S A;  4ZUX U;  2ZET C;  1JOC A;  2FUI A;  4R8P K;  5FB1 A;  4A49 A;  2MT5 A;  2CSY A;  5LKU A;  1MM3 A;  3M63 A;  2VPD A;  2L80 A;  5D1M B;  4R7E A;  2YT5 A;  3V43 A;  3C5K A;  5B79 A;  3O36 A;  1WEN A;  4LKA A;  2JMD A;  3ZVY A;  5H1T A;  1FBV A;  2ECN A;  1MM2 A;  1WIM A;  2RI7 A;  2YUC A;  1WEP A;  1WEV A;  3O35 A;  4IC3 A;  4C9Z A;  1VD4 A;  2YU4 A;  1V87 A;  5G0F A;  5B8D A;  2G45 A;  4I7B A;  5TBN A;  3U5O A;  2VPE A;  2QIZ A;  1DVP A;  3O33 A;  5KH9 A;  2VPB A;  5B76 A;  1WEU A;  4MSX A;  2CKL B;  2HDP A;  2KWK A;  2VP7 A;  3M62 A;  2LN0 A;  5TRB A;  3KQI A;  3LQI A;  2L75 A;  1N87 A;  4FO9 A;  3QZV A;  3ZPV 1;  2LGV A;  2VPG A;  3GL6 A;  5G05 B;  3N9P A;  2QIC A;  4PPE A;  1LDK C;  1IYM A;  2YHO A;  1RMD A;  1Z60 A;  3LQJ A;  1CHC A;  1FP0 A;  4XI1 A;  2MA5 A;  1WES A;  2OXQ C;  4L7X A;  3EB6 A;  5LKX A;  2KWO A;  2JRJ A;  4GNF A;  3I2D A;  5FER A;  1T1H A;  4YAD A;  5TAB A;  3SHB A;  2K4D A;  5AIT A;  4WA6 A;  3O34 A;  4LLB A;  3IHP A;  2NAA A;  4LK9 A;  2ECW A;  3SOU A;  2LQ6 A;  3O70 A;  2MA6 A;  4S3O C;  1Z2Q A;  2ECI A;  2KU3 A;  3HCT A;  2I50 A;  2G43 A;  4UI9 B;  2M3H A;  3KV5 A;  4N4F A;  2YYR A;  4A0C D;  3HCU A;  4LJN A;  4BHW A;  3ZPV E;  4AUQ B;  5D1L B;  2KWN A;  2LGK A;  2BAY A;  2MNZ A;  3N9M A;  2MD7 B;  1K2F A;  4B7Y C;  1X4I A;  2MNY A;  2YSJ A;  3GV4 A;  3HTK C;  2JMI A;  3LQH A;  2MD8 C;  3NG2 A;  2YSM A;  1LDJ B;  2K1J A;  1WEQ A;  4I7D A;  5FEY A;  4GND A;  2ECJ A;  4WZ0 A;  2CT2 A;  5DIN A;  2AN6 A;  2FSA A;  2PNX A;  4ZQL A;  2Y1M A;  2YUR A;  2M85 A;  5H1U A;  3ZVZ B;  2QJ0 A;  3L1Z B;  4QF3 A;  2F42 A;  3DQV R;  2FUU A;  5H1V A;  1VFY A;  2JMJ A;  2LGL A;  4YBT A;  4PTB A;  5B77 A;  3N9N A;  2KE1 A;  2E6R A;  4V3K C;  5LKZ A;  5KH7 A;  2ECG A;  2PUY A;  2EGP A;  5TDW A;  2KFT A;  4ZDT A;  2KRE A;  2LDR A;  2F6J A;  3T6R A;  2L5U A;  3LRQ A;  5J3X A;  2H0D B;  3L11 A;  2XB1 A;  5C13 A;  4CA1 A;  5LKT A;  4S3O B;  4YAT A;  4FK5 A;  4GNG A;  5FB0 A;  2L43 A;  4TKP B;  1E4U A;  5EYA F;  1G25 A; 
#chains in the Genus database with same CATH topology
 2LRI C;  2H0D A;  2M6M A;  2VJE A;  2XOC A;  4N3W A;  5G04 B;  2UZG A;  1BOR A;  2KYU A;  3SOX A;  2M13 A;  2C2L A;  2XP0 A;  4GNE A;  2YQM A;  5D1K B;  5B78 A;  3N9O A;  3N9L A;  4YAX A;  2K17 A;  2CSZ A;  4BBQ A;  1XWH A;  4L58 A;  1ZBD B;  2LAU A;  5C11 A;  1JM7 A;  2VJE B;  5K3Q A;  2KR4 A;  2L7P A;  5B75 A;  3PHD A;  4X3G A;  2M1R A;  2MUM A;  4R2Y A;  5I3L A;  1HYI A;  3KNV A;  3PUR A;  1VYX A;  2EOD A;  4LAD B;  3FJU B;  3VK6 A;  4YBS A;  4P5O B;  3HCS A;  3DPL R;  4Q6F A;  5SVX A;  4FIP A;  3O7A A;  3C6W A;  3FL2 A;  3ZNI A;  3O37 A;  4F1P A;  2G6Q A;  2OWA A;  4UP0 A;  1WE9 A;  4V3L C;  3FAN A;  2EXU A;  1WEO A;  2D8S A;  3SOW A;  1WGM A;  2VJF A;  3ZTG A;  3KV6 A;  2XEU A;  4AYC B;  2KIZ A;  2ECV A;  4YBM A;  2KWJ A;  3ASL A;  2KGG A;  2YW8 A;  4WZ2 A;  2K16 A;  3M99 A;  4YAB A;  4UP5 A;  4F52 B;  4AVX A;  2VJF B;  4QF2 A;  4OGE A;  4CCG X;  2EGM A;  4AP4 A;  1F62 A;  2YHN A;  1WEW A;  3PUQ A;  5LCW B;  4WZ3 B;  3FAO A;  1DCQ A;  2DX8 A;  1WFK A;  2L0B A;  2YRE A;  1WEM A;  3RPG C;  3MHS A;  5TDR A;  1WEE A;  4I7C A;  4Z0O A;  4AYC A;  3U5N A;  1JM7 B;  4O64 A;  4QQ4 A;  4B86 C;  2VNF A;  2IDA A;  2LV9 A;  3DDT A;  2LGG A;  2Y43 A;  3MHH A;  2LXH C;  2FFW A;  2B0O E;  4GB0 A;  2EA6 A;  1U6G B;  3T7L A;  3FEH A;  3ZYQ A;  1HYJ A;  5AIU A;  2C2V S;  4H9D A;  4MVT A;  3LJU X;  3RPG B;  2CKL A;  1X4U A;  4A4B A;  3L1X A;  5KH3 A;  2YQL A;  5JG6 A;  3RTR B;  2RR4 A;  2KGI A;  3PLW A;  3U5M A;  1Z6U A;  5H9M A;  4YC9 A;  2F6N A;  3N9Q A;  4OGC A;  2ECT A;  2RSD A;  1WIL A;  4FJC A;  3EB5 A;  2HYE D;  1X4J A;  2Y1N A;  4IC2 A;  4A4C A;  5DKA A;  3U5P A;  2LXP C;  4NN2 A;  2MIQ A;  4W4U A;  2KKY A;  3O47 A;  4O62 A;  2E6S A;  4ZUX U;  3LVQ E;  2ZET C;  1JOC A;  2FUI A;  4R8P K;  5FB1 A;  4A49 A;  2MT5 A;  2DSM A;  2CSY A;  5LKU A;  1MM3 A;  2CRW A;  3M63 A;  2JM3 A;  2VPD A;  2L80 A;  5D1M B;  4R7E A;  2YT5 A;  3V43 A;  3DWD A;  2D8U A;  3C5K A;  5B79 A;  3O36 A;  1WEN A;  4LKA A;  2JMD A;  3ZVY A;  5H1T A;  1FBV A;  2ECN A;  1MM2 A;  1WIM A;  2RI7 A;  2YUC A;  1WEP A;  1WEV A;  3O35 A;  4IC3 A;  4C9Z A;  1VD4 A;  2YU4 A;  1V87 A;  5G0F A;  5B8D A;  2G45 A;  3JUE A;  4I7B A;  5TBN A;  3U5O A;  3MDB C;  2VPE A;  2QIZ A;  2CSV A;  1DVP A;  3O33 A;  3KDE C;  5KH9 A;  2VPB A;  5B76 A;  2DJA A;  1WEU A;  2E61 A;  4MSX A;  2CKL B;  2HDP A;  2KWK A;  2VP7 A;  3M62 A;  2LN0 A;  5TRB A;  3KQI A;  3LQI A;  2L75 A;  1N87 A;  4FO9 A;  3QZV A;  2IQJ A;  2LGV A;  3ZPV 1;  2VPG A;  3GL6 A;  5G05 B;  3N9P A;  2QIC A;  4PPE A;  2XOY A;  1LDK C;  1IYM A;  2YHO A;  1RMD A;  1Z60 A;  3LQJ A;  1CHC A;  1FP0 A;  4XI1 A;  2MA5 A;  1WES A;  2OXQ C;  2KKX A;  4L7X A;  4Z0R A;  3EB6 A;  5LKX A;  2KWO A;  2P57 A;  2JRJ A;  4GNF A;  3I2D A;  5FER A;  1T1H A;  4YAD A;  5TAB A;  3SHB A;  2K4D A;  5AIT A;  4WA6 A;  3O34 A;  4LLB A;  3SUB A;  3IHP A;  2NAA A;  2CRR A;  4LK9 A;  2ECW A;  3M7K A;  3SOU A;  2LQ6 A;  3O70 A;  2MA6 A;  4S3O C;  1Z2Q A;  2ECI A;  2KU3 A;  3HCT A;  2I50 A;  2G43 A;  4UI9 B;  2M3H A;  3KV5 A;  4N4F A;  2YYR A;  3H7H A;  4A0C D;  3HCU A;  4LJN A;  3T9K A;  4BHW A;  3ZPV E;  4AUQ B;  5D1L B;  2XOZ A;  2KWN A;  2LGK A;  2BAY A;  2MNZ A;  3LDY A;  3N9M A;  2MD7 B;  1K2F A;  3LVR E;  4B7Y C;  1X4I A;  2JUN A;  2MNY A;  2YSJ A;  3GV4 A;  3HTK C;  2JMI A;  3LQH A;  2MD8 C;  3NG2 A;  2MKE A;  2YSM A;  2CON A;  1LDJ B;  2K1J A;  1WEQ A;  4I7D A;  5SVI A;  5FEY A;  4GND A;  2ECJ A;  4WZ0 A;  2CT2 A;  5DIN A;  4ZQL A;  2AN6 A;  2FSA A;  2PNX A;  2Y1M A;  2YUR A;  2M85 A;  5H1U A;  3ZVZ B;  2QJ0 A;  3L1Z B;  4QF3 A;  2F42 A;  3DQV R;  2FUU A;  1VFY A;  2JMJ A;  2LGL A;  4YBT A;  5H1V A;  4PTB A;  5B77 A;  3N9N A;  2KE1 A;  2E6R A;  4V3K C;  1MBM A;  5SVY A;  5KH7 A;  5LKZ A;  2ECG A;  2PUY A;  2EGP A;  3E2D A;  5TDW A;  2KFT A;  4ZDT A;  2KRE A;  2LDR A;  2F6J A;  5SVI B;  3T6R A;  2L5U A;  2FD4 A;  3LRQ A;  5J3X A;  3Q1D A;  2H0D B;  2YVR A;  3L11 A;  2XB1 A;  5C13 A;  4CA1 A;  5LKT A;  3FM8 C;  4S3O B;  4YAT A;  4FK5 A;  4GNG A;  5FB0 A;  2L43 A;  4TKP B;  1E4U A;  5EYA F;  1G25 A; 
#chains in the Genus database with same CATH homology
 2LRI C;  2H0D A;  2M6M A;  2VJE A;  4N3W A;  2UZG A;  1BOR A;  2KYU A;  5G04 B;  3SOX A;  2C2L A;  4GNE A;  2YQM A;  5D1K B;  5B78 A;  3N9O A;  3N9L A;  4YAX A;  2K17 A;  2CSZ A;  4BBQ A;  1XWH A;  4L58 A;  1ZBD B;  5C11 A;  1JM7 A;  2VJE B;  2KR4 A;  5B75 A;  3PHD A;  4X3G A;  2M1R A;  2MUM A;  4R2Y A;  5I3L A;  1HYI A;  3KNV A;  3PUR A;  1VYX A;  2EOD A;  4LAD B;  3VK6 A;  4YBS A;  4P5O B;  3HCS A;  3DPL R;  4Q6F A;  4FIP A;  3O7A A;  3C6W A;  3FL2 A;  3ZNI A;  3O37 A;  2G6Q A;  4UP0 A;  1WE9 A;  4V3L C;  1WEO A;  2D8S A;  3SOW A;  1WGM A;  2VJF A;  3ZTG A;  3KV6 A;  2XEU A;  4AYC B;  2KIZ A;  2ECV A;  4YBM A;  2KWJ A;  3ASL A;  2KGG A;  2YW8 A;  4WZ2 A;  2K16 A;  3M99 A;  4YAB A;  4UP5 A;  4F52 B;  4AVX A;  2VJF B;  4QF2 A;  4CCG X;  4AP4 A;  1F62 A;  2YHN A;  1WEW A;  3PUQ A;  5LCW B;  4WZ3 B;  2DX8 A;  1WFK A;  2L0B A;  2YRE A;  1WEM A;  3RPG C;  3MHS A;  5TDR A;  1WEE A;  4I7C A;  4AYC A;  3U5N A;  1JM7 B;  4O64 A;  4B86 C;  2VNF A;  2IDA A;  2LV9 A;  2LGG A;  2Y43 A;  3MHH A;  2LXH C;  2EA6 A;  4GB0 A;  1U6G B;  3T7L A;  3ZYQ A;  1HYJ A;  5AIU A;  2C2V S;  4MVT A;  3RPG B;  2CKL A;  1X4U A;  4A4B A;  3L1X A;  5KH3 A;  2YQL A;  5JG6 A;  3RTR B;  2KGI A;  3U5M A;  1Z6U A;  5H9M A;  4YC9 A;  2F6N A;  3N9Q A;  2ECT A;  2RSD A;  1WIL A;  4FJC A;  3EB5 A;  2HYE D;  1X4J A;  2Y1N A;  4IC2 A;  4A4C A;  5DKA A;  3U5P A;  2LXP C;  4NN2 A;  2MIQ A;  4W4U A;  2E6S A;  4ZUX U;  2ZET C;  1JOC A;  2FUI A;  4R8P K;  5FB1 A;  4A49 A;  2MT5 A;  2CSY A;  5LKU A;  1MM3 A;  3M63 A;  2VPD A;  2L80 A;  5D1M B;  4R7E A;  2YT5 A;  3V43 A;  3C5K A;  5B79 A;  3O36 A;  1WEN A;  4LKA A;  2JMD A;  3ZVY A;  5H1T A;  1FBV A;  2ECN A;  1MM2 A;  1WIM A;  2RI7 A;  2YUC A;  1WEP A;  1WEV A;  3O35 A;  4IC3 A;  4C9Z A;  1VD4 A;  2YU4 A;  1V87 A;  5G0F A;  5B8D A;  2G45 A;  4I7B A;  5TBN A;  3U5O A;  2VPE A;  2QIZ A;  1DVP A;  3O33 A;  5KH9 A;  2VPB A;  5B76 A;  1WEU A;  4MSX A;  2CKL B;  2HDP A;  2KWK A;  2VP7 A;  3M62 A;  2LN0 A;  5TRB A;  3KQI A;  3LQI A;  2L75 A;  1N87 A;  4FO9 A;  3QZV A;  3ZPV 1;  2LGV A;  2VPG A;  3GL6 A;  5G05 B;  3N9P A;  2QIC A;  4PPE A;  1LDK C;  1IYM A;  2YHO A;  1RMD A;  1Z60 A;  3LQJ A;  1CHC A;  1FP0 A;  4XI1 A;  2MA5 A;  1WES A;  2OXQ C;  4L7X A;  3EB6 A;  5LKX A;  2KWO A;  2JRJ A;  4GNF A;  3I2D A;  5FER A;  1T1H A;  4YAD A;  5TAB A;  3SHB A;  2K4D A;  5AIT A;  4WA6 A;  3O34 A;  4LLB A;  3IHP A;  2NAA A;  4LK9 A;  2ECW A;  3SOU A;  2LQ6 A;  3O70 A;  2MA6 A;  4S3O C;  1Z2Q A;  2ECI A;  2KU3 A;  3HCT A;  2I50 A;  2G43 A;  4UI9 B;  2M3H A;  3KV5 A;  4N4F A;  2YYR A;  4A0C D;  3HCU A;  4LJN A;  4BHW A;  3ZPV E;  4AUQ B;  5D1L B;  2KWN A;  2LGK A;  2BAY A;  2MNZ A;  3N9M A;  2MD7 B;  1K2F A;  4B7Y C;  1X4I A;  2MNY A;  2YSJ A;  3GV4 A;  3HTK C;  2JMI A;  3LQH A;  2MD8 C;  3NG2 A;  2YSM A;  1LDJ B;  2K1J A;  1WEQ A;  4I7D A;  5FEY A;  4GND A;  2ECJ A;  4WZ0 A;  2CT2 A;  5DIN A;  2AN6 A;  2FSA A;  2PNX A;  4ZQL A;  2Y1M A;  2YUR A;  2M85 A;  5H1U A;  3ZVZ B;  2QJ0 A;  3L1Z B;  4QF3 A;  2F42 A;  3DQV R;  2FUU A;  5H1V A;  1VFY A;  2JMJ A;  2LGL A;  4YBT A;  4PTB A;  5B77 A;  3N9N A;  2KE1 A;  2E6R A;  4V3K C;  5LKZ A;  5KH7 A;  2ECG A;  2PUY A;  2EGP A;  5TDW A;  2KFT A;  4ZDT A;  2KRE A;  2LDR A;  2F6J A;  3T6R A;  2L5U A;  3LRQ A;  5J3X A;  2H0D B;  3L11 A;  2XB1 A;  5C13 A;  4CA1 A;  5LKT A;  4S3O B;  4YAT A;  4FK5 A;  4GNG A;  5FB0 A;  2L43 A;  4TKP B;  1E4U A;  5EYA F;  1G25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...