2K16A

Solution structure of the free taf3 phd domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 3
publication title Recognition of the H3K4me3 mark by the TAF3-PHD finger
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2k16A00
2ECJA 4YBMA 2VPEA 4WZ3B 3SOWA 3ZPVE 5H1VA 4S3OC 2VPDA 3N9PA 2RSDA 2CKLB 5I3LA 2C2LA 1HYJA 1XWHA 2ECTA 2LRIC 3M99A 2VJFA 4LADB 4W4UA 5J3XA 2LGKA 2NAAA 2PNXA 5DKAA 4FO9A 2ECVA 4GNDA 2CSZA 2F6JA 2CSYA 1BORA 2K16A 3M62A 3N9MA 2MUMA 2MT5A 2F42A 2K4DA 4R7EA 2M1RA 5TABA 4LLBA 2IDAA 5B77A 2C2VS 5TBNA 3GL6A 3DPLR 5H9MA 3LQJA 4LJNA 4YC9A 3C5KA 2MD7B 3LQIA 3O70A 3O33A 2K17A 2CKLA 2ECIA 4IC2A 2EODA 1IYMA 5FEYA 2KWNA 4A4CA 5TDWA 4QF2A 3N9LA 4GNEA 5G04B 2YREA 3O36A 2RI7A 1VFYA 2LDRA 3HCSA 4YABA 1V87A 2LGVA 5KH7A 3O7AA 4LKAA 5H1UA 2EA6A 2JMJA 2K1JA 4AVXA 5JG6A 2KWKA 1ZBDB 4IC3A 2I50A 4N4FA 2ECGA 4C9ZA 2VJFB 2KR4A 2YURA 3N9OA 2JMDA 2G43A 1FBVA 1VYXA 3EB5A 5LKTA 2LXPC 1E4UA 4PPEA 5LKUA 1WEMA 3NG2A 1WEVA 3HCUA 3L1XA 2FSAA 5AITA 4PTBA 4TKPB 4V3KC 1LDKC 2JRJA 1X4JA 4AYCB 1WE9A 2FUIA 2EGPA 5FERA 4L7XA 2BAYA 4CA1A 4ZUXU 4LK9A 2HYED 5B76A 4MVTA 5G05B 5AIUA 3PUQA 3QZVA 5D1MB 5D1LB 3KV5A 5G0FA 3MHHA 2AN6A 3SOXA 3T6RA 1X4IA 4GNGA 1F62A 4YBTA 3I2DA 4UP0A 5LKZA 1Z6UA 4S3OB 2ZETC 2KWJA 2PUYA 4F52B 2MNZA 5B79A 2L43A 1U6GB 2L5UA 2Y43A 3RTRB 2G45A 4AYCA 3O35A 3GV4A 1RMDA 2YQMA 4L58A 3ASLA 2FUUA 3VK6A 1CHCA 2VJEB 2KU3A 2OXQC 4NN2A 2E6RA 2M6MA 3V43A 3M63A 5C11A 3KQIA 4AP4A 4YBSA 1G25A 5KH9A 3KV6A 1X4UA 3RPGC 4XI1A 2Y1NA 2YSJA 2JMIA 2H0DA 2KE1A 1VD4A 2QICA 3KNVA 1WEPA 4YATA 3MHSA 3L11A 2MNYA 1WIMA 2MA5A 3PHDA 2L0BA 3ZVZB 3HTKC 2VPBA 5KH3A 2VJEA 4N3WA 2MIQA 5TDRA 2LXHC 1WENA 1JM7A 3RPGB 5FB1A 2LGGA 3ZNIA 1LDJB 4ZDTA 2QJ0A 2XEUA 2YHNA 2M85A 1WFKA 5H1TA 4QF3A 1WILA 3U5NA 4R2YA 4B86C 4YADA 4UI9B 2VPGA 4R8PK 3HCTA 1WEWA 1MM3A 3ZTGA 5D1KB 5LCWB 1WEEA 3SHBA 1WGMA 2YQLA 4Q6FA 3ZPV1 2KREA 5B8DA 4I7DA 2LQ6A 2YT5A 2YW8A 1MM2A 2VNFA 2H0DB 1WEOA 4I7BA 3T7LA 3PURA 3ZVYA 3N9NA 3N9QA 4GNFA 2VP7A 2UZGA 4A0CD 2YU4A 4P5OB 3SOUA 4A4BA 5FB0A 5EYAF 1FP0A 2L80A 4O64A 2YHOA 4FK5A 4WZ2A 3U5MA 4A49A 2KIZA 2ECNA 1N87A 4B7YC 4UP5A 3LQHA 3U5PA 3DQVR 2KFTA 1JM7B 1Z60A 2XB1A 4I7CA 2YUCA 2KYUA 4WA6A 5B78A 2D8SA 4ZQLA 5LKXA 2ECWA 2LGLA 4BHWA 2KGGA 1DVPA 3U5OA 1HYIA 1Z2QA 1WEQA 3LRQA 4FIPA 2L75A 2MA6A 4MSXA 2Y1MA 5TRBA 2KWOA 2E6SA 4X3GA 3C6WA 2QIZA 2LV9A 4AUQB 5C13A 2KGIA 3ZYQA 3O37A 1WESA 4CCGX 1JOCA 2G6QA 2MD8C 3IHPA 5DINA 2F6NA 2YSMA 1K2FA 2YYRA 2M3HA 5B75A 3EB6A 2CT2A 1T1HA 2DX8A 3L1ZB 4WZ0A 3FL2A 2LN0A 4V3LC 4BBQA 2HDPA 3O34A 4YAXA 4FJCA 4GB0A 1WEUA
chains in the Genus database with same CATH superfamily
2ECJA 4YBMA 2VPEA 4WZ3B 3SOWA 3ZPVE 5H1VA 4S3OC 2VPDA 3N9PA 2RSDA 2EGMA 2CKLB 2EXUA 5I3LA 2C2LA 1HYJA 1XWHA 2ECTA 2LRIC 3M99A 2VJFA 4LADB 4W4UA 5J3XA 2LGKA 2NAAA 2PNXA 5DKAA 4FO9A 2ECVA 4Z0OA 4GNDA 2CSZA 2F6JA 2CSYA 2XOCA 1BORA 3LVQE 4QQ4A 2K16A 3M62A 3N9MA 5SVXA 2MUMA 2MT5A 2F42A 3LVRE 2K4DA 2XOYA 2CRRA 4R7EA 2M1RA 5TABA 3SUBA 4LLBA 2IDAA 5B77A 4F1PA 2C2VS 3FANA 5TBNA 3GL6A 3DPLR 3LDYA 5H9MA 2CRWA 3LQJA 4LJNA 2DSMA 4YC9A 3FM8C 3C5KA 2MD7B 3LQIA 3O70A 3O33A 3KDEC 2K17A 5K3QA 2CKLA 2ECIA 5SVIA 4IC2A 2EODA 1IYMA 2M13A 5FEYA 2KWNA 4A4CA 5TDWA 4QF2A 3N9LA 4GNEA 2E61A 4OGCA 5G04B 2YREA 3O36A 2RI7A 1VFYA 2LDRA 3HCSA 4YABA 1V87A 2LGVA 2RR4A 5KH7A 3O7AA 4LKAA 5H1UA 2EA6A 2JMJA 2K1JA 4AVXA 5JG6A 2KWKA 1ZBDB 4IC3A 2I50A 4N4FA 2ECGA 4C9ZA 2VJFB 2KR4A 2YURA 3N9OA 2JMDA 2G43A 1FBVA 1VYXA 3EB5A 5LKTA 2LXPC 1E4UA 4PPEA 5LKUA 1WEMA 3NG2A 1WEVA 3HCUA 2YVRA 3L1XA 2FSAA 5AITA 4PTBA 3MDBC 4TKPB 4V3KC 1LDKC 2JUNA 2JRJA 1X4JA 2KKYA 3E2DA 4AYCB 1WE9A 2FUIA 3T9KA 2EGPA 5FERA 4L7XA 2BAYA 3FJUB 4CA1A 5SVIB 4ZUXU 4LK9A 2HYED 5B76A 2CONA 4MVTA 5G05B 5AIUA 3PUQA 2DJAA 3QZVA 5D1MB 5D1LB 3KV5A 5G0FA 3JUEA 3MHHA 3M7KA 2AN6A 3SOXA 3T6RA 1X4IA 4GNGA 1F62A 4YBTA 2LAUA 3I2DA 4UP0A 1DCQA 5LKZA 1Z6UA 4S3OB 2ZETC 2KWJA 2PUYA 4F52B 2MNZA 2P57A 5B79A 2L43A 1U6GB 2L5UA 2Y43A 3RTRB 4O62A 2G45A 4AYCA 3O35A 3GV4A 1RMDA 2YQMA 4L58A 3ASLA 2FUUA 3VK6A 1CHCA 2VJEB 2KU3A 2OXQC 4NN2A 3FEHA 2E6RA 2M6MA 3V43A 3M63A 5SVYA 5C11A 3KQIA 4AP4A 4YBSA 1G25A 5KH9A 3O47A 3KV6A 1X4UA 3RPGC 4XI1A 2Y1NA 2YSJA 2JMIA 2H0DA 2KE1A 1VD4A 3Q1DA 2QICA 4Z0RA 2XP0A 3KNVA 1WEPA 4YATA 3MHSA 3L11A 2MNYA 1WIMA 2MA5A 3PHDA 2L0BA 3ZVZB 3HTKC 2VPBA 5KH3A 2VJEA 4N3WA 2L7PA 2MIQA 5TDRA 2LXHC 1WENA 1JM7A 3RPGB 2CSVA 2FD4A 5FB1A 2LGGA 3H7HA 3ZNIA 1LDJB 4ZDTA 2QJ0A 2XEUA 1MBMA 4OGEA 2YHNA 2M85A 1WFKA 5H1TA 4QF3A 1WILA 3U5NA 4R2YA 4B86C 4YADA 4UI9B 2VPGA 4R8PK 3HCTA 1WEWA 1MM3A 3ZTGA 5D1KB 5LCWB 1WEEA 3SHBA 1WGMA 2YQLA 2MKEA 4Q6FA 3ZPV1 2KREA 3FAOA 5B8DA 3DDTA 4I7DA 2LQ6A 2YT5A 2YW8A 1MM2A 2VNFA 2H0DB 1WEOA 4I7BA 3T7LA 3PURA 3ZVYA 3N9NA 3PLWA 3N9QA 4GNFA 2KKXA 2VP7A 2UZGA 4A0CD 2YU4A 2OWAA 4P5OB 3SOUA 4A4BA 5FB0A 5EYAF 2JM3A 1FP0A 2IQJA 2L80A 4O64A 2YHOA 4FK5A 4WZ2A 3U5MA 4A49A 2KIZA 2ECNA 1N87A 4B7YC 2B0OE 3LQHA 4UP5A 3U5PA 2XOZA 3DQVR 2KFTA 1JM7B 1Z60A 3DWDA 2XB1A 4I7CA 2YUCA 2KYUA 4WA6A 5B78A 2FFWA 2D8SA 4ZQLA 5LKXA 2ECWA 2LGLA 4BHWA 2KGGA 1DVPA 3U5OA 1HYIA 3LJUX 1Z2QA 1WEQA 3LRQA 4FIPA 2L75A 2MA6A 4MSXA 2Y1MA 5TRBA 2KWOA 2E6SA 4H9DA 4X3GA 3C6WA 2QIZA 2LV9A 4AUQB 5C13A 2KGIA 3ZYQA 3O37A 1WESA 4CCGX 1JOCA 2G6QA 2MD8C 3IHPA 5DINA 2F6NA 2YSMA 2D8UA 1K2FA 2YYRA 2M3HA 5B75A 3EB6A 2CT2A 1T1HA 2DX8A 3L1ZB 4WZ0A 3FL2A 2LN0A 4V3LC 4BBQA 2HDPA 3O34A 4YAXA 4FJCA 4GB0A 1WEUA
chains in the Genus database with same CATH topology
2ECJA 4YBMA 2VPEA 4WZ3B 3SOWA 3ZPVE 5H1VA 4S3OC 2VPDA 3N9PA 2RSDA 2CKLB 5I3LA 2C2LA 1HYJA 1XWHA 2ECTA 2LRIC 3M99A 2VJFA 4LADB 4W4UA 5J3XA 2LGKA 2NAAA 2PNXA 5DKAA 4FO9A 2ECVA 4GNDA 2CSZA 2F6JA 2CSYA 1BORA 2K16A 3M62A 3N9MA 2MUMA 2MT5A 2F42A 2K4DA 4R7EA 2M1RA 5TABA 4LLBA 2IDAA 5B77A 2C2VS 5TBNA 3GL6A 3DPLR 5H9MA 3LQJA 4LJNA 4YC9A 3C5KA 2MD7B 3LQIA 3O70A 3O33A 2K17A 2CKLA 2ECIA 4IC2A 2EODA 1IYMA 5FEYA 2KWNA 4A4CA 5TDWA 4QF2A 3N9LA 4GNEA 5G04B 2YREA 3O36A 2RI7A 1VFYA 2LDRA 3HCSA 4YABA 1V87A 2LGVA 5KH7A 3O7AA 4LKAA 5H1UA 2EA6A 2JMJA 2K1JA 4AVXA 5JG6A 2KWKA 1ZBDB 4IC3A 2I50A 4N4FA 2ECGA 4C9ZA 2VJFB 2KR4A 2YURA 3N9OA 2JMDA 2G43A 1FBVA 1VYXA 3EB5A 5LKTA 2LXPC 1E4UA 4PPEA 5LKUA 1WEMA 3NG2A 1WEVA 3HCUA 3L1XA 2FSAA 5AITA 4PTBA 4TKPB 4V3KC 1LDKC 2JRJA 1X4JA 4AYCB 1WE9A 2FUIA 2EGPA 5FERA 4L7XA 2BAYA 4CA1A 4ZUXU 4LK9A 2HYED 5B76A 4MVTA 5G05B 5AIUA 3PUQA 3QZVA 5D1MB 5D1LB 3KV5A 5G0FA 3MHHA 2AN6A 3SOXA 3T6RA 1X4IA 4GNGA 1F62A 4YBTA 3I2DA 4UP0A 5LKZA 1Z6UA 4S3OB 2ZETC 2KWJA 2PUYA 4F52B 2MNZA 5B79A 2L43A 1U6GB 2L5UA 2Y43A 3RTRB 2G45A 4AYCA 3O35A 3GV4A 1RMDA 2YQMA 4L58A 3ASLA 2FUUA 3VK6A 1CHCA 2VJEB 2KU3A 2OXQC 4NN2A 2E6RA 2M6MA 3V43A 3M63A 5C11A 3KQIA 4AP4A 4YBSA 1G25A 5KH9A 3KV6A 1X4UA 3RPGC 4XI1A 2Y1NA 2YSJA 2JMIA 2H0DA 2KE1A 1VD4A 2QICA 3KNVA 1WEPA 4YATA 3MHSA 3L11A 2MNYA 1WIMA 2MA5A 3PHDA 2L0BA 3ZVZB 3HTKC 2VPBA 5KH3A 2VJEA 4N3WA 2MIQA 5TDRA 2LXHC 1WENA 1JM7A 3RPGB 5FB1A 2LGGA 3ZNIA 1LDJB 4ZDTA 2QJ0A 2XEUA 2YHNA 2M85A 1WFKA 5H1TA 4QF3A 1WILA 3U5NA 4R2YA 4B86C 4YADA 4UI9B 2VPGA 4R8PK 3HCTA 1WEWA 1MM3A 3ZTGA 5D1KB 5LCWB 1WEEA 3SHBA 1WGMA 2YQLA 4Q6FA 3ZPV1 2KREA 5B8DA 4I7DA 2LQ6A 2YT5A 2YW8A 1MM2A 2VNFA 2H0DB 1WEOA 4I7BA 3T7LA 3PURA 3ZVYA 3N9NA 3N9QA 4GNFA 2VP7A 2UZGA 4A0CD 2YU4A 4P5OB 3SOUA 4A4BA 5FB0A 5EYAF 1FP0A 2L80A 4O64A 2YHOA 4FK5A 4WZ2A 3U5MA 4A49A 2KIZA 2ECNA 1N87A 4B7YC 4UP5A 3LQHA 3U5PA 3DQVR 2KFTA 1JM7B 1Z60A 2XB1A 4I7CA 2YUCA 2KYUA 4WA6A 5B78A 2D8SA 4ZQLA 5LKXA 2ECWA 2LGLA 4BHWA 2KGGA 1DVPA 3U5OA 1HYIA 1Z2QA 1WEQA 3LRQA 4FIPA 2L75A 2MA6A 4MSXA 2Y1MA 5TRBA 2KWOA 2E6SA 4X3GA 3C6WA 2QIZA 2LV9A 4AUQB 5C13A 2KGIA 3ZYQA 3O37A 1WESA 4CCGX 1JOCA 2G6QA 2MD8C 3IHPA 5DINA 2F6NA 2YSMA 1K2FA 2YYRA 2M3HA 5B75A 3EB6A 2CT2A 1T1HA 2DX8A 3L1ZB 4WZ0A 3FL2A 2LN0A 4V3LC 4BBQA 2HDPA 3O34A 4YAXA 4FJCA 4GB0A 1WEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECJ A;  4YBM A;  2VPE A;  4WZ3 B;  3SOW A;  3ZPV E;  5H1V A;  4S3O C;  2VPD A;  3N9P A;  2RSD A;  2CKL B;  5I3L A;  2C2L A;  1HYJ A;  1XWH A;  2ECT A;  2LRI C;  3M99 A;  2VJF A;  4LAD B;  4W4U A;  5J3X A;  2LGK A;  2NAA A;  2PNX A;  5DKA A;  4FO9 A;  2ECV A;  4GND A;  2CSZ A;  2F6J A;  2CSY A;  1BOR A;  2K16 A;  3M62 A;  3N9M A;  2MUM A;  2MT5 A;  2F42 A;  2K4D A;  4R7E A;  2M1R A;  5TAB A;  4LLB A;  2IDA A;  5B77 A;  2C2V S;  5TBN A;  3GL6 A;  3DPL R;  5H9M A;  3LQJ A;  4LJN A;  4YC9 A;  3C5K A;  2MD7 B;  3LQI A;  3O70 A;  3O33 A;  2K17 A;  2CKL A;  2ECI A;  4IC2 A;  2EOD A;  1IYM A;  5FEY A;  2KWN A;  4A4C A;  5TDW A;  4QF2 A;  3N9L A;  4GNE A;  5G04 B;  2YRE A;  3O36 A;  2RI7 A;  1VFY A;  2LDR A;  3HCS A;  4YAB A;  1V87 A;  2LGV A;  5KH7 A;  3O7A A;  4LKA A;  5H1U A;  2EA6 A;  2JMJ A;  2K1J A;  4AVX A;  5JG6 A;  2KWK A;  1ZBD B;  4IC3 A;  2I50 A;  4N4F A;  2ECG A;  4C9Z A;  2VJF B;  2KR4 A;  2YUR A;  3N9O A;  2JMD A;  2G43 A;  1FBV A;  1VYX A;  3EB5 A;  5LKT A;  2LXP C;  1E4U A;  4PPE A;  5LKU A;  1WEM A;  3NG2 A;  1WEV A;  3HCU A;  3L1X A;  2FSA A;  5AIT A;  4PTB A;  4TKP B;  4V3K C;  1LDK C;  2JRJ A;  1X4J A;  4AYC B;  1WE9 A;  2FUI A;  2EGP A;  5FER A;  4L7X A;  2BAY A;  4CA1 A;  4ZUX U;  4LK9 A;  2HYE D;  5B76 A;  4MVT A;  5G05 B;  5AIU A;  3PUQ A;  3QZV A;  5D1M B;  5D1L B;  3KV5 A;  5G0F A;  3MHH A;  2AN6 A;  3SOX A;  3T6R A;  1X4I A;  4GNG A;  1F62 A;  4YBT A;  3I2D A;  4UP0 A;  5LKZ A;  1Z6U A;  4S3O B;  2ZET C;  2KWJ A;  2PUY A;  4F52 B;  2MNZ A;  5B79 A;  2L43 A;  1U6G B;  2L5U A;  2Y43 A;  3RTR B;  2G45 A;  4AYC A;  3O35 A;  3GV4 A;  1RMD A;  2YQM A;  4L58 A;  3ASL A;  2FUU A;  3VK6 A;  1CHC A;  2VJE B;  2KU3 A;  2OXQ C;  4NN2 A;  2E6R A;  2M6M A;  3V43 A;  3M63 A;  5C11 A;  3KQI A;  4AP4 A;  4YBS A;  1G25 A;  5KH9 A;  3KV6 A;  1X4U A;  3RPG C;  4XI1 A;  2Y1N A;  2YSJ A;  2JMI A;  2H0D A;  2KE1 A;  1VD4 A;  2QIC A;  3KNV A;  1WEP A;  4YAT A;  3MHS A;  3L11 A;  2MNY A;  1WIM A;  2MA5 A;  3PHD A;  2L0B A;  3ZVZ B;  3HTK C;  2VPB A;  5KH3 A;  2VJE A;  4N3W A;  2MIQ A;  5TDR A;  2LXH C;  1WEN A;  1JM7 A;  3RPG B;  5FB1 A;  2LGG A;  3ZNI A;  1LDJ B;  4ZDT A;  2QJ0 A;  2XEU A;  2YHN A;  2M85 A;  1WFK A;  5H1T A;  4QF3 A;  1WIL A;  3U5N A;  4R2Y A;  4B86 C;  4YAD A;  4UI9 B;  2VPG A;  4R8P K;  3HCT A;  1WEW A;  1MM3 A;  3ZTG A;  5D1K B;  5LCW B;  1WEE A;  3SHB A;  1WGM A;  2YQL A;  4Q6F A;  3ZPV 1;  2KRE A;  5B8D A;  4I7D A;  2LQ6 A;  2YT5 A;  2YW8 A;  1MM2 A;  2VNF A;  2H0D B;  1WEO A;  4I7B A;  3T7L A;  3PUR A;  3ZVY A;  3N9N A;  3N9Q A;  4GNF A;  2VP7 A;  2UZG A;  4A0C D;  2YU4 A;  4P5O B;  3SOU A;  4A4B A;  5FB0 A;  5EYA F;  1FP0 A;  2L80 A;  4O64 A;  2YHO A;  4FK5 A;  4WZ2 A;  3U5M A;  4A49 A;  2KIZ A;  2ECN A;  1N87 A;  4B7Y C;  4UP5 A;  3LQH A;  3U5P A;  3DQV R;  2KFT A;  1JM7 B;  1Z60 A;  2XB1 A;  4I7C A;  2YUC A;  2KYU A;  4WA6 A;  5B78 A;  2D8S A;  4ZQL A;  5LKX A;  2ECW A;  2LGL A;  4BHW A;  2KGG A;  1DVP A;  3U5O A;  1HYI A;  1Z2Q A;  1WEQ A;  3LRQ A;  4FIP A;  2L75 A;  2MA6 A;  4MSX A;  2Y1M A;  5TRB A;  2KWO A;  2E6S A;  4X3G A;  3C6W A;  2QIZ A;  2LV9 A;  4AUQ B;  5C13 A;  2KGI A;  3ZYQ A;  3O37 A;  1WES A;  4CCG X;  1JOC A;  2G6Q A;  2MD8 C;  3IHP A;  5DIN A;  2F6N A;  2YSM A;  1K2F A;  2YYR A;  2M3H A;  5B75 A;  3EB6 A;  2CT2 A;  1T1H A;  2DX8 A;  3L1Z B;  4WZ0 A;  3FL2 A;  2LN0 A;  4V3L C;  4BBQ A;  2HDP A;  3O34 A;  4YAX A;  4FJC A;  4GB0 A;  1WEU A; 
#chains in the Genus database with same CATH topology
 2ECJ A;  4YBM A;  2VPE A;  4WZ3 B;  3SOW A;  3ZPV E;  5H1V A;  4S3O C;  2VPD A;  3N9P A;  2RSD A;  2EGM A;  2CKL B;  2EXU A;  5I3L A;  2C2L A;  1HYJ A;  1XWH A;  2ECT A;  2LRI C;  3M99 A;  2VJF A;  4LAD B;  4W4U A;  5J3X A;  2LGK A;  2NAA A;  2PNX A;  5DKA A;  4FO9 A;  2ECV A;  4Z0O A;  4GND A;  2CSZ A;  2F6J A;  2CSY A;  2XOC A;  1BOR A;  3LVQ E;  4QQ4 A;  2K16 A;  3M62 A;  3N9M A;  5SVX A;  2MUM A;  2MT5 A;  2F42 A;  3LVR E;  2K4D A;  2XOY A;  2CRR A;  4R7E A;  2M1R A;  5TAB A;  3SUB A;  4LLB A;  2IDA A;  5B77 A;  4F1P A;  2C2V S;  3FAN A;  5TBN A;  3GL6 A;  3DPL R;  3LDY A;  5H9M A;  2CRW A;  3LQJ A;  4LJN A;  2DSM A;  4YC9 A;  3FM8 C;  3C5K A;  2MD7 B;  3LQI A;  3O70 A;  3O33 A;  3KDE C;  2K17 A;  5K3Q A;  2CKL A;  2ECI A;  5SVI A;  4IC2 A;  2EOD A;  1IYM A;  2M13 A;  5FEY A;  2KWN A;  4A4C A;  5TDW A;  4QF2 A;  3N9L A;  4GNE A;  2E61 A;  4OGC A;  5G04 B;  2YRE A;  3O36 A;  2RI7 A;  1VFY A;  2LDR A;  3HCS A;  4YAB A;  1V87 A;  2LGV A;  2RR4 A;  5KH7 A;  3O7A A;  4LKA A;  5H1U A;  2EA6 A;  2JMJ A;  2K1J A;  4AVX A;  5JG6 A;  2KWK A;  1ZBD B;  4IC3 A;  2I50 A;  4N4F A;  2ECG A;  4C9Z A;  2VJF B;  2KR4 A;  2YUR A;  3N9O A;  2JMD A;  2G43 A;  1FBV A;  1VYX A;  3EB5 A;  5LKT A;  2LXP C;  1E4U A;  4PPE A;  5LKU A;  1WEM A;  3NG2 A;  1WEV A;  3HCU A;  2YVR A;  3L1X A;  2FSA A;  5AIT A;  4PTB A;  3MDB C;  4TKP B;  4V3K C;  1LDK C;  2JUN A;  2JRJ A;  1X4J A;  2KKY A;  3E2D A;  4AYC B;  1WE9 A;  2FUI A;  3T9K A;  2EGP A;  5FER A;  4L7X A;  2BAY A;  3FJU B;  4CA1 A;  5SVI B;  4ZUX U;  4LK9 A;  2HYE D;  5B76 A;  2CON A;  4MVT A;  5G05 B;  5AIU A;  3PUQ A;  2DJA A;  3QZV A;  5D1M B;  5D1L B;  3KV5 A;  5G0F A;  3JUE A;  3MHH A;  3M7K A;  2AN6 A;  3SOX A;  3T6R A;  1X4I A;  4GNG A;  1F62 A;  4YBT A;  2LAU A;  3I2D A;  4UP0 A;  1DCQ A;  5LKZ A;  1Z6U A;  4S3O B;  2ZET C;  2KWJ A;  2PUY A;  4F52 B;  2MNZ A;  2P57 A;  5B79 A;  2L43 A;  1U6G B;  2L5U A;  2Y43 A;  3RTR B;  4O62 A;  2G45 A;  4AYC A;  3O35 A;  3GV4 A;  1RMD A;  2YQM A;  4L58 A;  3ASL A;  2FUU A;  3VK6 A;  1CHC A;  2VJE B;  2KU3 A;  2OXQ C;  4NN2 A;  3FEH A;  2E6R A;  2M6M A;  3V43 A;  3M63 A;  5SVY A;  5C11 A;  3KQI A;  4AP4 A;  4YBS A;  1G25 A;  5KH9 A;  3O47 A;  3KV6 A;  1X4U A;  3RPG C;  4XI1 A;  2Y1N A;  2YSJ A;  2JMI A;  2H0D A;  2KE1 A;  1VD4 A;  3Q1D A;  2QIC A;  4Z0R A;  2XP0 A;  3KNV A;  1WEP A;  4YAT A;  3MHS A;  3L11 A;  2MNY A;  1WIM A;  2MA5 A;  3PHD A;  2L0B A;  3ZVZ B;  3HTK C;  2VPB A;  5KH3 A;  2VJE A;  4N3W A;  2L7P A;  2MIQ A;  5TDR A;  2LXH C;  1WEN A;  1JM7 A;  3RPG B;  2CSV A;  2FD4 A;  5FB1 A;  2LGG A;  3H7H A;  3ZNI A;  1LDJ B;  4ZDT A;  2QJ0 A;  2XEU A;  1MBM A;  4OGE A;  2YHN A;  2M85 A;  1WFK A;  5H1T A;  4QF3 A;  1WIL A;  3U5N A;  4R2Y A;  4B86 C;  4YAD A;  4UI9 B;  2VPG A;  4R8P K;  3HCT A;  1WEW A;  1MM3 A;  3ZTG A;  5D1K B;  5LCW B;  1WEE A;  3SHB A;  1WGM A;  2YQL A;  2MKE A;  4Q6F A;  3ZPV 1;  2KRE A;  3FAO A;  5B8D A;  3DDT A;  4I7D A;  2LQ6 A;  2YT5 A;  2YW8 A;  1MM2 A;  2VNF A;  2H0D B;  1WEO A;  4I7B A;  3T7L A;  3PUR A;  3ZVY A;  3N9N A;  3PLW A;  3N9Q A;  4GNF A;  2KKX A;  2VP7 A;  2UZG A;  4A0C D;  2YU4 A;  2OWA A;  4P5O B;  3SOU A;  4A4B A;  5FB0 A;  5EYA F;  2JM3 A;  1FP0 A;  2IQJ A;  2L80 A;  4O64 A;  2YHO A;  4FK5 A;  4WZ2 A;  3U5M A;  4A49 A;  2KIZ A;  2ECN A;  1N87 A;  4B7Y C;  2B0O E;  3LQH A;  4UP5 A;  3U5P A;  2XOZ A;  3DQV R;  2KFT A;  1JM7 B;  1Z60 A;  3DWD A;  2XB1 A;  4I7C A;  2YUC A;  2KYU A;  4WA6 A;  5B78 A;  2FFW A;  2D8S A;  4ZQL A;  5LKX A;  2ECW A;  2LGL A;  4BHW A;  2KGG A;  1DVP A;  3U5O A;  1HYI A;  3LJU X;  1Z2Q A;  1WEQ A;  3LRQ A;  4FIP A;  2L75 A;  2MA6 A;  4MSX A;  2Y1M A;  5TRB A;  2KWO A;  2E6S A;  4H9D A;  4X3G A;  3C6W A;  2QIZ A;  2LV9 A;  4AUQ B;  5C13 A;  2KGI A;  3ZYQ A;  3O37 A;  1WES A;  4CCG X;  1JOC A;  2G6Q A;  2MD8 C;  3IHP A;  5DIN A;  2F6N A;  2YSM A;  2D8U A;  1K2F A;  2YYR A;  2M3H A;  5B75 A;  3EB6 A;  2CT2 A;  1T1H A;  2DX8 A;  3L1Z B;  4WZ0 A;  3FL2 A;  2LN0 A;  4V3L C;  4BBQ A;  2HDP A;  3O34 A;  4YAX A;  4FJC A;  4GB0 A;  1WEU A; 
#chains in the Genus database with same CATH homology
 2ECJ A;  4YBM A;  2VPE A;  4WZ3 B;  3SOW A;  3ZPV E;  5H1V A;  4S3O C;  2VPD A;  3N9P A;  2RSD A;  2CKL B;  5I3L A;  2C2L A;  1HYJ A;  1XWH A;  2ECT A;  2LRI C;  3M99 A;  2VJF A;  4LAD B;  4W4U A;  5J3X A;  2LGK A;  2NAA A;  2PNX A;  5DKA A;  4FO9 A;  2ECV A;  4GND A;  2CSZ A;  2F6J A;  2CSY A;  1BOR A;  2K16 A;  3M62 A;  3N9M A;  2MUM A;  2MT5 A;  2F42 A;  2K4D A;  4R7E A;  2M1R A;  5TAB A;  4LLB A;  2IDA A;  5B77 A;  2C2V S;  5TBN A;  3GL6 A;  3DPL R;  5H9M A;  3LQJ A;  4LJN A;  4YC9 A;  3C5K A;  2MD7 B;  3LQI A;  3O70 A;  3O33 A;  2K17 A;  2CKL A;  2ECI A;  4IC2 A;  2EOD A;  1IYM A;  5FEY A;  2KWN A;  4A4C A;  5TDW A;  4QF2 A;  3N9L A;  4GNE A;  5G04 B;  2YRE A;  3O36 A;  2RI7 A;  1VFY A;  2LDR A;  3HCS A;  4YAB A;  1V87 A;  2LGV A;  5KH7 A;  3O7A A;  4LKA A;  5H1U A;  2EA6 A;  2JMJ A;  2K1J A;  4AVX A;  5JG6 A;  2KWK A;  1ZBD B;  4IC3 A;  2I50 A;  4N4F A;  2ECG A;  4C9Z A;  2VJF B;  2KR4 A;  2YUR A;  3N9O A;  2JMD A;  2G43 A;  1FBV A;  1VYX A;  3EB5 A;  5LKT A;  2LXP C;  1E4U A;  4PPE A;  5LKU A;  1WEM A;  3NG2 A;  1WEV A;  3HCU A;  3L1X A;  2FSA A;  5AIT A;  4PTB A;  4TKP B;  4V3K C;  1LDK C;  2JRJ A;  1X4J A;  4AYC B;  1WE9 A;  2FUI A;  2EGP A;  5FER A;  4L7X A;  2BAY A;  4CA1 A;  4ZUX U;  4LK9 A;  2HYE D;  5B76 A;  4MVT A;  5G05 B;  5AIU A;  3PUQ A;  3QZV A;  5D1M B;  5D1L B;  3KV5 A;  5G0F A;  3MHH A;  2AN6 A;  3SOX A;  3T6R A;  1X4I A;  4GNG A;  1F62 A;  4YBT A;  3I2D A;  4UP0 A;  5LKZ A;  1Z6U A;  4S3O B;  2ZET C;  2KWJ A;  2PUY A;  4F52 B;  2MNZ A;  5B79 A;  2L43 A;  1U6G B;  2L5U A;  2Y43 A;  3RTR B;  2G45 A;  4AYC A;  3O35 A;  3GV4 A;  1RMD A;  2YQM A;  4L58 A;  3ASL A;  2FUU A;  3VK6 A;  1CHC A;  2VJE B;  2KU3 A;  2OXQ C;  4NN2 A;  2E6R A;  2M6M A;  3V43 A;  3M63 A;  5C11 A;  3KQI A;  4AP4 A;  4YBS A;  1G25 A;  5KH9 A;  3KV6 A;  1X4U A;  3RPG C;  4XI1 A;  2Y1N A;  2YSJ A;  2JMI A;  2H0D A;  2KE1 A;  1VD4 A;  2QIC A;  3KNV A;  1WEP A;  4YAT A;  3MHS A;  3L11 A;  2MNY A;  1WIM A;  2MA5 A;  3PHD A;  2L0B A;  3ZVZ B;  3HTK C;  2VPB A;  5KH3 A;  2VJE A;  4N3W A;  2MIQ A;  5TDR A;  2LXH C;  1WEN A;  1JM7 A;  3RPG B;  5FB1 A;  2LGG A;  3ZNI A;  1LDJ B;  4ZDT A;  2QJ0 A;  2XEU A;  2YHN A;  2M85 A;  1WFK A;  5H1T A;  4QF3 A;  1WIL A;  3U5N A;  4R2Y A;  4B86 C;  4YAD A;  4UI9 B;  2VPG A;  4R8P K;  3HCT A;  1WEW A;  1MM3 A;  3ZTG A;  5D1K B;  5LCW B;  1WEE A;  3SHB A;  1WGM A;  2YQL A;  4Q6F A;  3ZPV 1;  2KRE A;  5B8D A;  4I7D A;  2LQ6 A;  2YT5 A;  2YW8 A;  1MM2 A;  2VNF A;  2H0D B;  1WEO A;  4I7B A;  3T7L A;  3PUR A;  3ZVY A;  3N9N A;  3N9Q A;  4GNF A;  2VP7 A;  2UZG A;  4A0C D;  2YU4 A;  4P5O B;  3SOU A;  4A4B A;  5FB0 A;  5EYA F;  1FP0 A;  2L80 A;  4O64 A;  2YHO A;  4FK5 A;  4WZ2 A;  3U5M A;  4A49 A;  2KIZ A;  2ECN A;  1N87 A;  4B7Y C;  4UP5 A;  3LQH A;  3U5P A;  3DQV R;  2KFT A;  1JM7 B;  1Z60 A;  2XB1 A;  4I7C A;  2YUC A;  2KYU A;  4WA6 A;  5B78 A;  2D8S A;  4ZQL A;  5LKX A;  2ECW A;  2LGL A;  4BHW A;  2KGG A;  1DVP A;  3U5O A;  1HYI A;  1Z2Q A;  1WEQ A;  3LRQ A;  4FIP A;  2L75 A;  2MA6 A;  4MSX A;  2Y1M A;  5TRB A;  2KWO A;  2E6S A;  4X3G A;  3C6W A;  2QIZ A;  2LV9 A;  4AUQ B;  5C13 A;  2KGI A;  3ZYQ A;  3O37 A;  1WES A;  4CCG X;  1JOC A;  2G6Q A;  2MD8 C;  3IHP A;  5DIN A;  2F6N A;  2YSM A;  1K2F A;  2YYR A;  2M3H A;  5B75 A;  3EB6 A;  2CT2 A;  1T1H A;  2DX8 A;  3L1Z B;  4WZ0 A;  3FL2 A;  2LN0 A;  4V3L C;  4BBQ A;  2HDP A;  3O34 A;  4YAX A;  4FJC A;  4GB0 A;  1WEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...