2K16A

Solution structure of the free taf3 phd domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription initiation factor TFIID subunit 3
publication title Recognition of the H3K4me3 mark by the TAF3-PHD finger
rcsb
source organism Mus musculus
total genus 14
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2k16A00
2G43A 2E6SA 2ECTA 2QIZA 5D1LB 2NAAA 4YABA 4PTBA 2AN6A 2VJFA 2M85A 1MM3A 1U6GB 2KWOA 2XB1A 5AIUA 4WZ3B 3VK6A 1K2FA 4R7EA 3O7AA 2QJ0A 2VPEA 2KR4A 4YC9A 2ECJA 2LGKA 1ZBDB 2EGPA 4L58A 1X4UA 3O34A 2E6RA 4GNDA 3SOXA 5H9MA 2JRJA 2YURA 2CSZA 2UZGA 4L7XA 2VJFB 1WEPA 2I50A 1WGMA 4BHWA 2HYED 4UP5A 4YATA 4QF3A 2ECVA 3NG2A 2MA6A 1JM7A 4AP4A 2YQLA 2MD8C 2H0DB 2IDAA 2ZETC 3EB5A 2K4DA 3IHPA 4YADA 3T6RA 3M63A 2Y1NA 2JMDA 5C13A 5KH9A 3L1XA 4AUQB 5B75A 1WEVA 3T7LA 5J3XA 2CKLA 3LQIA 5FB1A 5KH3A 3KNVA 4P5OB 4GNFA 4LJNA 2PNXA 5H1TA 1V87A 3N9MA 2YREA 2G45A 2PUYA 5LCWB 4AYCB 5DKAA 2YHOA 2C2LA 3ASLA 3ZNIA 5JG6A 1WENA 4N4FA 1LDJB 1FBVA 3QZVA 5B77A 4MSXA 5B8DA 5D1MB 4GB0A 4FJCA 2CKLB 3PUQA 4S3OC 2YW8A 5LKXA 2KE1A 1MM2A 3DQVR 5TRBA 2F6NA 2LRIC 3MHSA 5EYAF 2YYRA 3N9LA 3M62A 3PURA 3L11A 2ECWA 3HCTA 2M3HA 2ECIA 2HDPA 2D8SA 3RPGB 1WEOA 2EODA 2RSDA 4BBQA 2KYUA 4YBTA 2MA5A 2H0DA 4A49A 1Z2QA 3EB6A 2CSYA 4GNGA 1WILA 2XEUA 2M1RA 3O35A 2ECGA 5DINA 2YSMA 2KGIA 1F62A 2KWJA 4FO9A 4B7YC 4I7DA 1HYJA 3M99A 2YSJA 2OXQC 2QICA 2YUCA 2YQMA 1WFKA 4LADB 4CA1A 5TBNA 2DX8A 4MVTA 3PHDA 5H1VA 2M6MA 2VPDA 2JMIA 2LV9A 3O70A 3N9OA 2KWKA 3U5MA 4AYCA 3SOWA 3O33A 4F52B 4WA6A 5C11A 4LLBA 4YAXA 3I2DA 3V43A 4UI9B 2LXHC 3ZTGA 1WEUA 1RMDA 5H1UA 2VP7A 5B79A 1LDKC 2F6JA 3ZVYA 3N9NA 5FB0A 4IC2A 2BAYA 1VD4A 2EA6A 3HCSA 5AITA 3C6WA 2KREA 3MHHA 4LKAA 3ZPV1 4V3KC 4WZ0A 3LQJA 3KV5A 3KV6A 5LKZA 3N9QA 1E4UA 5TDRA 1Z6UA 1VYXA 2LGGA 4YBSA 4QF2A 2FUUA 2KIZA 2LGLA 4AVXA 4NN2A 2KWNA 1JOCA 3KQIA 2L5UA 2FUIA 1WEMA 3O36A 5B76A 2MNYA 3ZVZB 2ECNA 4O64A 4N3WA 3RTRB 2MUMA 5LKUA 2FSAA 3U5PA 1XWHA 3HCUA 3LQHA 4V3LC 4I7BA 4Q6FA 4TKPB 2MNZA 5I3LA 2JMJA 2YHNA 5G04B 1WEEA 2KFTA 4IC3A 3U5NA 2MD7B 5KH7A 2G6QA 3RPGC 5B78A 2L43A 3O37A 3C5KA 1HYIA 1WE9A 4A4CA 1WEQA 4ZUXU 2YT5A 2LXPC 3FL2A 4A0CD 2L80A 4YBMA 4FIPA 4PPEA 2VJEA 1FP0A 2Y43A 1CHCA 2Y1MA 4R2YA 3L1ZB 2LGVA 2KU3A 4A4BA 5G0FA 2VPGA 5LKTA 5D1KB 3HTKC 2CT2A 3ZPVE 4XI1A 2LN0A 4WZ2A 4ZQLA 4LK9A 1VFYA 2VJEB 5TABA 4W4UA 2K1JA 3LRQA 2RI7A 2VPBA 1BORA 3ZYQA 3N9PA 1WEWA 2F42A 4CCGX 1IYMA 2L75A 1X4IA 4UP0A 4GNEA 2K16A 1DVPA 4X3GA 2KGGA 2MIQA 5FEYA 2L0BA 1T1HA 4ZDTA 4FK5A 2C2VS 1JM7B 3DPLR 3SHBA 4I7CA 4B86C 5FERA 1G25A 3U5OA 1WESA 3SOUA 2MT5A 4R8PK 2K17A 5G05B 2YU4A 1N87A 4C9ZA 4S3OB 3GL6A 1X4JA 1WIMA 1Z60A 2LQ6A 2VNFA 2LDRA 3GV4A 5TDWA
chains in the Genus database with same CATH superfamily
2G43A 2E6SA 2ECTA 2QIZA 5D1LB 2NAAA 4YABA 3SUBA 4PTBA 2AN6A 3LJUX 2VJFA 2M85A 1MM3A 1U6GB 2KWOA 2XB1A 5AIUA 4WZ3B 3VK6A 1K2FA 4R7EA 3O7AA 2QJ0A 2VPEA 2KR4A 4YC9A 2ECJA 2LGKA 1ZBDB 2EGPA 4L58A 1X4UA 3FAOA 3O34A 2E6RA 4GNDA 3SOXA 5H9MA 2JRJA 2YURA 2CSZA 2UZGA 4L7XA 2VJFB 3M7KA 1WEPA 2I50A 1WGMA 3MDBC 4BHWA 2HYED 2LAUA 4UP5A 4YATA 4QF3A 2ECVA 3NG2A 2MA6A 1JM7A 4AP4A 2YQLA 2MD8C 2H0DB 2IDAA 2ZETC 3EB5A 2K4DA 3IHPA 4YADA 3T6RA 3M63A 2Y1NA 2JMDA 5C13A 5KH9A 3L1XA 4AUQB 5B75A 1WEVA 3T7LA 5J3XA 2CKLA 3LQIA 5FB1A 5KH3A 3KNVA 4P5OB 4GNFA 3FEHA 4LJNA 2PNXA 5H1TA 1V87A 5SVIA 3N9MA 2YREA 2G45A 2PUYA 5LCWB 4AYCB 5DKAA 2YHOA 4H9DA 2C2LA 3ASLA 2JUNA 2RR4A 3ZNIA 5JG6A 1WENA 4N4FA 4Z0RA 1LDJB 1FBVA 3QZVA 5B77A 4MSXA 5B8DA 5D1MB 4GB0A 3FJUB 4FJCA 2CKLB 3PUQA 4S3OC 2YW8A 5LKXA 2KE1A 1MM2A 4Z0OA 2M13A 3DQVR 5TRBA 2F6NA 2LRIC 3MHSA 5EYAF 2YVRA 5SVIB 2YYRA 3N9LA 3M62A 3PURA 3L11A 2ECWA 3HCTA 2M3HA 2ECIA 2HDPA 2D8SA 3RPGB 1WEOA 2EODA 2RSDA 4BBQA 2KYUA 4YBTA 2MA5A 2H0DA 4A49A 1Z2QA 4OGCA 3EB6A 2CSYA 4GNGA 2CRWA 2FD4A 1WILA 2XEUA 2M1RA 3O35A 2ECGA 5DINA 2YSMA 2KGIA 1F62A 2XOCA 2KWJA 4FO9A 4B7YC 4I7DA 1HYJA 2JM3A 3M99A 2YSJA 2OXQC 2QICA 2YUCA 3Q1DA 2YQMA 1WFKA 4LADB 4OGEA 4CA1A 5TBNA 2DX8A 4MVTA 3PHDA 5H1VA 2M6MA 2VPDA 2JMIA 2LV9A 3O70A 3N9OA 2KWKA 3E2DA 3U5MA 4AYCA 3SOWA 2FFWA 2MKEA 3O33A 4F52B 4WA6A 5C11A 4LLBA 4YAXA 3I2DA 3V43A 4UI9B 3LDYA 2LXHC 3ZTGA 1WEUA 1RMDA 5H1UA 2VP7A 5B79A 1LDKC 2F6JA 3ZVYA 3N9NA 5FB0A 4IC2A 2BAYA 1VD4A 2EA6A 3HCSA 5AITA 3C6WA 2KREA 3MHHA 4LKAA 3ZPV1 4V3KC 4WZ0A 3LQJA 3KV5A 3KV6A 2EXUA 5LKZA 3N9QA 1E4UA 5TDRA 1Z6UA 1VYXA 2LGGA 4YBSA 4QF2A 2FUUA 2KIZA 2LGLA 5SVYA 4AVXA 4NN2A 2KWNA 1JOCA 3KQIA 2L5UA 1WEMA 2FUIA 3O36A 5B76A 2MNYA 3H7HA 3ZVZB 2DSMA 2ECNA 4O64A 4N3WA 4O62A 3RTRB 2MUMA 5LKUA 2FSAA 3U5PA 1XWHA 3HCUA 3LQHA 2CSVA 4V3LC 2IQJA 4I7BA 4Q6FA 4TKPB 2MNZA 2CONA 2KKXA 3FANA 5I3LA 2B0OE 2XOZA 2JMJA 2KKYA 2YHNA 5G04B 1WEEA 2KFTA 4IC3A 2CRRA 3U5NA 2MD7B 5KH7A 2G6QA 3RPGC 5B78A 2L43A 3KDEC 3O37A 5SVXA 3C5KA 1HYIA 1WE9A 4A4CA 1WEQA 4ZUXU 2YT5A 2LXPC 3FL2A 4A0CD 2L80A 3DDTA 4YBMA 4FIPA 4PPEA 2VJEA 2EGMA 3LVRE 1FP0A 2Y43A 1CHCA 2D8UA 5K3QA 2Y1MA 4R2YA 3L1ZB 1MBMA 2LGVA 2KU3A 4A4BA 5G0FA 2VPGA 5LKTA 5D1KB 3JUEA 3HTKC 2CT2A 3ZPVE 4XI1A 2LN0A 3O47A 2DJAA 4WZ2A 2L7PA 2E61A 4ZQLA 4LK9A 2P57A 3FM8C 1VFYA 2VJEB 4W4UA 5TABA 2K1JA 3T9KA 3LRQA 2RI7A 2VPBA 1BORA 3ZYQA 3N9PA 1WEWA 2F42A 4CCGX 1IYMA 2L75A 1X4IA 4UP0A 4QQ4A 4GNEA 2K16A 1DVPA 4X3GA 2KGGA 2MIQA 5FEYA 2L0BA 1T1HA 2XP0A 2OWAA 4ZDTA 4FK5A 2C2VS 1JM7B 3DPLR 3SHBA 3LVQE 4F1PA 4I7CA 4B86C 5FERA 1G25A 3DWDA 3U5OA 1WESA 3SOUA 2MT5A 4R8PK 2K17A 5G05B 2YU4A 1N87A 1DCQA 2XOYA 3PLWA 4C9ZA 4S3OB 3GL6A 1X4JA 1WIMA 1Z60A 2LQ6A 2VNFA 2LDRA 3GV4A 5TDWA
chains in the Genus database with same CATH topology
2G43A 2E6SA 2ECTA 2QIZA 5D1LB 2NAAA 4YABA 4PTBA 2AN6A 2VJFA 2M85A 1MM3A 1U6GB 2KWOA 2XB1A 5AIUA 4WZ3B 3VK6A 1K2FA 4R7EA 3O7AA 2QJ0A 2VPEA 2KR4A 4YC9A 2ECJA 2LGKA 1ZBDB 2EGPA 4L58A 1X4UA 3O34A 2E6RA 4GNDA 3SOXA 5H9MA 2JRJA 2YURA 2CSZA 2UZGA 4L7XA 2VJFB 1WEPA 2I50A 1WGMA 4BHWA 2HYED 4UP5A 4YATA 4QF3A 2ECVA 3NG2A 2MA6A 1JM7A 4AP4A 2YQLA 2MD8C 2H0DB 2IDAA 2ZETC 3EB5A 2K4DA 3IHPA 4YADA 3T6RA 3M63A 2Y1NA 2JMDA 5C13A 5KH9A 3L1XA 4AUQB 5B75A 1WEVA 3T7LA 5J3XA 2CKLA 3LQIA 5FB1A 5KH3A 3KNVA 4P5OB 4GNFA 4LJNA 2PNXA 5H1TA 1V87A 3N9MA 2YREA 2G45A 2PUYA 5LCWB 4AYCB 5DKAA 2YHOA 2C2LA 3ASLA 3ZNIA 5JG6A 1WENA 4N4FA 1LDJB 1FBVA 3QZVA 5B77A 4MSXA 5B8DA 5D1MB 4GB0A 4FJCA 2CKLB 3PUQA 4S3OC 2YW8A 5LKXA 2KE1A 1MM2A 3DQVR 5TRBA 2F6NA 2LRIC 3MHSA 5EYAF 2YYRA 3N9LA 3M62A 3PURA 3L11A 2ECWA 3HCTA 2M3HA 2ECIA 2HDPA 2D8SA 3RPGB 1WEOA 2EODA 2RSDA 4BBQA 2KYUA 4YBTA 2MA5A 2H0DA 4A49A 1Z2QA 3EB6A 2CSYA 4GNGA 1WILA 2XEUA 2M1RA 3O35A 2ECGA 5DINA 2YSMA 2KGIA 1F62A 2KWJA 4FO9A 4B7YC 4I7DA 1HYJA 3M99A 2YSJA 2OXQC 2QICA 2YUCA 2YQMA 1WFKA 4LADB 4CA1A 5TBNA 2DX8A 4MVTA 3PHDA 5H1VA 2M6MA 2VPDA 2JMIA 2LV9A 3O70A 3N9OA 2KWKA 3U5MA 4AYCA 3SOWA 3O33A 4F52B 4WA6A 5C11A 4LLBA 4YAXA 3I2DA 3V43A 4UI9B 2LXHC 3ZTGA 1WEUA 1RMDA 5H1UA 2VP7A 5B79A 1LDKC 2F6JA 3ZVYA 3N9NA 5FB0A 4IC2A 2BAYA 1VD4A 2EA6A 3HCSA 5AITA 3C6WA 2KREA 3MHHA 4LKAA 3ZPV1 4V3KC 4WZ0A 3LQJA 3KV5A 3KV6A 5LKZA 3N9QA 1E4UA 5TDRA 1Z6UA 1VYXA 2LGGA 4YBSA 4QF2A 2FUUA 2KIZA 2LGLA 4AVXA 4NN2A 2KWNA 1JOCA 3KQIA 2L5UA 2FUIA 1WEMA 3O36A 5B76A 2MNYA 3ZVZB 2ECNA 4O64A 4N3WA 3RTRB 2MUMA 5LKUA 2FSAA 3U5PA 1XWHA 3HCUA 3LQHA 4V3LC 4I7BA 4Q6FA 4TKPB 2MNZA 5I3LA 2JMJA 2YHNA 5G04B 1WEEA 2KFTA 4IC3A 3U5NA 2MD7B 5KH7A 2G6QA 3RPGC 5B78A 2L43A 3O37A 3C5KA 1HYIA 1WE9A 4A4CA 1WEQA 4ZUXU 2YT5A 2LXPC 3FL2A 4A0CD 2L80A 4YBMA 4FIPA 4PPEA 2VJEA 1FP0A 2Y43A 1CHCA 2Y1MA 4R2YA 3L1ZB 2LGVA 2KU3A 4A4BA 5G0FA 2VPGA 5LKTA 5D1KB 3HTKC 2CT2A 3ZPVE 4XI1A 2LN0A 4WZ2A 4ZQLA 4LK9A 1VFYA 2VJEB 5TABA 4W4UA 2K1JA 3LRQA 2RI7A 2VPBA 1BORA 3ZYQA 3N9PA 1WEWA 2F42A 4CCGX 1IYMA 2L75A 1X4IA 4UP0A 4GNEA 2K16A 1DVPA 4X3GA 2KGGA 2MIQA 5FEYA 2L0BA 1T1HA 4ZDTA 4FK5A 2C2VS 1JM7B 3DPLR 3SHBA 4I7CA 4B86C 5FERA 1G25A 3U5OA 1WESA 3SOUA 2MT5A 4R8PK 2K17A 5G05B 2YU4A 1N87A 4C9ZA 4S3OB 3GL6A 1X4JA 1WIMA 1Z60A 2LQ6A 2VNFA 2LDRA 3GV4A 5TDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G43 A;  2E6S A;  2ECT A;  2QIZ A;  5D1L B;  2NAA A;  4YAB A;  4PTB A;  2AN6 A;  2VJF A;  2M85 A;  1MM3 A;  1U6G B;  2KWO A;  2XB1 A;  5AIU A;  4WZ3 B;  3VK6 A;  1K2F A;  4R7E A;  3O7A A;  2QJ0 A;  2VPE A;  2KR4 A;  4YC9 A;  2ECJ A;  2LGK A;  1ZBD B;  2EGP A;  4L58 A;  1X4U A;  3O34 A;  2E6R A;  4GND A;  3SOX A;  5H9M A;  2JRJ A;  2YUR A;  2CSZ A;  2UZG A;  4L7X A;  2VJF B;  1WEP A;  2I50 A;  1WGM A;  4BHW A;  2HYE D;  4UP5 A;  4YAT A;  4QF3 A;  2ECV A;  3NG2 A;  2MA6 A;  1JM7 A;  4AP4 A;  2YQL A;  2MD8 C;  2H0D B;  2IDA A;  2ZET C;  3EB5 A;  2K4D A;  3IHP A;  4YAD A;  3T6R A;  3M63 A;  2Y1N A;  2JMD A;  5C13 A;  5KH9 A;  3L1X A;  4AUQ B;  5B75 A;  1WEV A;  3T7L A;  5J3X A;  2CKL A;  3LQI A;  5FB1 A;  5KH3 A;  3KNV A;  4P5O B;  4GNF A;  4LJN A;  2PNX A;  5H1T A;  1V87 A;  3N9M A;  2YRE A;  2G45 A;  2PUY A;  5LCW B;  4AYC B;  5DKA A;  2YHO A;  2C2L A;  3ASL A;  3ZNI A;  5JG6 A;  1WEN A;  4N4F A;  1LDJ B;  1FBV A;  3QZV A;  5B77 A;  4MSX A;  5B8D A;  5D1M B;  4GB0 A;  4FJC A;  2CKL B;  3PUQ A;  4S3O C;  2YW8 A;  5LKX A;  2KE1 A;  1MM2 A;  3DQV R;  5TRB A;  2F6N A;  2LRI C;  3MHS A;  5EYA F;  2YYR A;  3N9L A;  3M62 A;  3PUR A;  3L11 A;  2ECW A;  3HCT A;  2M3H A;  2ECI A;  2HDP A;  2D8S A;  3RPG B;  1WEO A;  2EOD A;  2RSD A;  4BBQ A;  2KYU A;  4YBT A;  2MA5 A;  2H0D A;  4A49 A;  1Z2Q A;  3EB6 A;  2CSY A;  4GNG A;  1WIL A;  2XEU A;  2M1R A;  3O35 A;  2ECG A;  5DIN A;  2YSM A;  2KGI A;  1F62 A;  2KWJ A;  4FO9 A;  4B7Y C;  4I7D A;  1HYJ A;  3M99 A;  2YSJ A;  2OXQ C;  2QIC A;  2YUC A;  2YQM A;  1WFK A;  4LAD B;  4CA1 A;  5TBN A;  2DX8 A;  4MVT A;  3PHD A;  5H1V A;  2M6M A;  2VPD A;  2JMI A;  2LV9 A;  3O70 A;  3N9O A;  2KWK A;  3U5M A;  4AYC A;  3SOW A;  3O33 A;  4F52 B;  4WA6 A;  5C11 A;  4LLB A;  4YAX A;  3I2D A;  3V43 A;  4UI9 B;  2LXH C;  3ZTG A;  1WEU A;  1RMD A;  5H1U A;  2VP7 A;  5B79 A;  1LDK C;  2F6J A;  3ZVY A;  3N9N A;  5FB0 A;  4IC2 A;  2BAY A;  1VD4 A;  2EA6 A;  3HCS A;  5AIT A;  3C6W A;  2KRE A;  3MHH A;  4LKA A;  3ZPV 1;  4V3K C;  4WZ0 A;  3LQJ A;  3KV5 A;  3KV6 A;  5LKZ A;  3N9Q A;  1E4U A;  5TDR A;  1Z6U A;  1VYX A;  2LGG A;  4YBS A;  4QF2 A;  2FUU A;  2KIZ A;  2LGL A;  4AVX A;  4NN2 A;  2KWN A;  1JOC A;  3KQI A;  2L5U A;  2FUI A;  1WEM A;  3O36 A;  5B76 A;  2MNY A;  3ZVZ B;  2ECN A;  4O64 A;  4N3W A;  3RTR B;  2MUM A;  5LKU A;  2FSA A;  3U5P A;  1XWH A;  3HCU A;  3LQH A;  4V3L C;  4I7B A;  4Q6F A;  4TKP B;  2MNZ A;  5I3L A;  2JMJ A;  2YHN A;  5G04 B;  1WEE A;  2KFT A;  4IC3 A;  3U5N A;  2MD7 B;  5KH7 A;  2G6Q A;  3RPG C;  5B78 A;  2L43 A;  3O37 A;  3C5K A;  1HYI A;  1WE9 A;  4A4C A;  1WEQ A;  4ZUX U;  2YT5 A;  2LXP C;  3FL2 A;  4A0C D;  2L80 A;  4YBM A;  4FIP A;  4PPE A;  2VJE A;  1FP0 A;  2Y43 A;  1CHC A;  2Y1M A;  4R2Y A;  3L1Z B;  2LGV A;  2KU3 A;  4A4B A;  5G0F A;  2VPG A;  5LKT A;  5D1K B;  3HTK C;  2CT2 A;  3ZPV E;  4XI1 A;  2LN0 A;  4WZ2 A;  4ZQL A;  4LK9 A;  1VFY A;  2VJE B;  5TAB A;  4W4U A;  2K1J A;  3LRQ A;  2RI7 A;  2VPB A;  1BOR A;  3ZYQ A;  3N9P A;  1WEW A;  2F42 A;  4CCG X;  1IYM A;  2L75 A;  1X4I A;  4UP0 A;  4GNE A;  2K16 A;  1DVP A;  4X3G A;  2KGG A;  2MIQ A;  5FEY A;  2L0B A;  1T1H A;  4ZDT A;  4FK5 A;  2C2V S;  1JM7 B;  3DPL R;  3SHB A;  4I7C A;  4B86 C;  5FER A;  1G25 A;  3U5O A;  1WES A;  3SOU A;  2MT5 A;  4R8P K;  2K17 A;  5G05 B;  2YU4 A;  1N87 A;  4C9Z A;  4S3O B;  3GL6 A;  1X4J A;  1WIM A;  1Z60 A;  2LQ6 A;  2VNF A;  2LDR A;  3GV4 A;  5TDW A; 
#chains in the Genus database with same CATH topology
 2G43 A;  2E6S A;  2ECT A;  2QIZ A;  5D1L B;  2NAA A;  4YAB A;  3SUB A;  4PTB A;  2AN6 A;  3LJU X;  2VJF A;  2M85 A;  1MM3 A;  1U6G B;  2KWO A;  2XB1 A;  5AIU A;  4WZ3 B;  3VK6 A;  1K2F A;  4R7E A;  3O7A A;  2QJ0 A;  2VPE A;  2KR4 A;  4YC9 A;  2ECJ A;  2LGK A;  1ZBD B;  2EGP A;  4L58 A;  1X4U A;  3FAO A;  3O34 A;  2E6R A;  4GND A;  3SOX A;  5H9M A;  2JRJ A;  2YUR A;  2CSZ A;  2UZG A;  4L7X A;  2VJF B;  3M7K A;  1WEP A;  2I50 A;  1WGM A;  3MDB C;  4BHW A;  2HYE D;  2LAU A;  4UP5 A;  4YAT A;  4QF3 A;  2ECV A;  3NG2 A;  2MA6 A;  1JM7 A;  4AP4 A;  2YQL A;  2MD8 C;  2H0D B;  2IDA A;  2ZET C;  3EB5 A;  2K4D A;  3IHP A;  4YAD A;  3T6R A;  3M63 A;  2Y1N A;  2JMD A;  5C13 A;  5KH9 A;  3L1X A;  4AUQ B;  5B75 A;  1WEV A;  3T7L A;  5J3X A;  2CKL A;  3LQI A;  5FB1 A;  5KH3 A;  3KNV A;  4P5O B;  4GNF A;  3FEH A;  4LJN A;  2PNX A;  5H1T A;  1V87 A;  5SVI A;  3N9M A;  2YRE A;  2G45 A;  2PUY A;  5LCW B;  4AYC B;  5DKA A;  2YHO A;  4H9D A;  2C2L A;  3ASL A;  2JUN A;  2RR4 A;  3ZNI A;  5JG6 A;  1WEN A;  4N4F A;  4Z0R A;  1LDJ B;  1FBV A;  3QZV A;  5B77 A;  4MSX A;  5B8D A;  5D1M B;  4GB0 A;  3FJU B;  4FJC A;  2CKL B;  3PUQ A;  4S3O C;  2YW8 A;  5LKX A;  2KE1 A;  1MM2 A;  4Z0O A;  2M13 A;  3DQV R;  5TRB A;  2F6N A;  2LRI C;  3MHS A;  5EYA F;  2YVR A;  5SVI B;  2YYR A;  3N9L A;  3M62 A;  3PUR A;  3L11 A;  2ECW A;  3HCT A;  2M3H A;  2ECI A;  2HDP A;  2D8S A;  3RPG B;  1WEO A;  2EOD A;  2RSD A;  4BBQ A;  2KYU A;  4YBT A;  2MA5 A;  2H0D A;  4A49 A;  1Z2Q A;  4OGC A;  3EB6 A;  2CSY A;  4GNG A;  2CRW A;  2FD4 A;  1WIL A;  2XEU A;  2M1R A;  3O35 A;  2ECG A;  5DIN A;  2YSM A;  2KGI A;  1F62 A;  2XOC A;  2KWJ A;  4FO9 A;  4B7Y C;  4I7D A;  1HYJ A;  2JM3 A;  3M99 A;  2YSJ A;  2OXQ C;  2QIC A;  2YUC A;  3Q1D A;  2YQM A;  1WFK A;  4LAD B;  4OGE A;  4CA1 A;  5TBN A;  2DX8 A;  4MVT A;  3PHD A;  5H1V A;  2M6M A;  2VPD A;  2JMI A;  2LV9 A;  3O70 A;  3N9O A;  2KWK A;  3E2D A;  3U5M A;  4AYC A;  3SOW A;  2FFW A;  2MKE A;  3O33 A;  4F52 B;  4WA6 A;  5C11 A;  4LLB A;  4YAX A;  3I2D A;  3V43 A;  4UI9 B;  3LDY A;  2LXH C;  3ZTG A;  1WEU A;  1RMD A;  5H1U A;  2VP7 A;  5B79 A;  1LDK C;  2F6J A;  3ZVY A;  3N9N A;  5FB0 A;  4IC2 A;  2BAY A;  1VD4 A;  2EA6 A;  3HCS A;  5AIT A;  3C6W A;  2KRE A;  3MHH A;  4LKA A;  3ZPV 1;  4V3K C;  4WZ0 A;  3LQJ A;  3KV5 A;  3KV6 A;  2EXU A;  5LKZ A;  3N9Q A;  1E4U A;  5TDR A;  1Z6U A;  1VYX A;  2LGG A;  4YBS A;  4QF2 A;  2FUU A;  2KIZ A;  2LGL A;  5SVY A;  4AVX A;  4NN2 A;  2KWN A;  1JOC A;  3KQI A;  2L5U A;  1WEM A;  2FUI A;  3O36 A;  5B76 A;  2MNY A;  3H7H A;  3ZVZ B;  2DSM A;  2ECN A;  4O64 A;  4N3W A;  4O62 A;  3RTR B;  2MUM A;  5LKU A;  2FSA A;  3U5P A;  1XWH A;  3HCU A;  3LQH A;  2CSV A;  4V3L C;  2IQJ A;  4I7B A;  4Q6F A;  4TKP B;  2MNZ A;  2CON A;  2KKX A;  3FAN A;  5I3L A;  2B0O E;  2XOZ A;  2JMJ A;  2KKY A;  2YHN A;  5G04 B;  1WEE A;  2KFT A;  4IC3 A;  2CRR A;  3U5N A;  2MD7 B;  5KH7 A;  2G6Q A;  3RPG C;  5B78 A;  2L43 A;  3KDE C;  3O37 A;  5SVX A;  3C5K A;  1HYI A;  1WE9 A;  4A4C A;  1WEQ A;  4ZUX U;  2YT5 A;  2LXP C;  3FL2 A;  4A0C D;  2L80 A;  3DDT A;  4YBM A;  4FIP A;  4PPE A;  2VJE A;  2EGM A;  3LVR E;  1FP0 A;  2Y43 A;  1CHC A;  2D8U A;  5K3Q A;  2Y1M A;  4R2Y A;  3L1Z B;  1MBM A;  2LGV A;  2KU3 A;  4A4B A;  5G0F A;  2VPG A;  5LKT A;  5D1K B;  3JUE A;  3HTK C;  2CT2 A;  3ZPV E;  4XI1 A;  2LN0 A;  3O47 A;  2DJA A;  4WZ2 A;  2L7P A;  2E61 A;  4ZQL A;  4LK9 A;  2P57 A;  3FM8 C;  1VFY A;  2VJE B;  4W4U A;  5TAB A;  2K1J A;  3T9K A;  3LRQ A;  2RI7 A;  2VPB A;  1BOR A;  3ZYQ A;  3N9P A;  1WEW A;  2F42 A;  4CCG X;  1IYM A;  2L75 A;  1X4I A;  4UP0 A;  4QQ4 A;  4GNE A;  2K16 A;  1DVP A;  4X3G A;  2KGG A;  2MIQ A;  5FEY A;  2L0B A;  1T1H A;  2XP0 A;  2OWA A;  4ZDT A;  4FK5 A;  2C2V S;  1JM7 B;  3DPL R;  3SHB A;  3LVQ E;  4F1P A;  4I7C A;  4B86 C;  5FER A;  1G25 A;  3DWD A;  3U5O A;  1WES A;  3SOU A;  2MT5 A;  4R8P K;  2K17 A;  5G05 B;  2YU4 A;  1N87 A;  1DCQ A;  2XOY A;  3PLW A;  4C9Z A;  4S3O B;  3GL6 A;  1X4J A;  1WIM A;  1Z60 A;  2LQ6 A;  2VNF A;  2LDR A;  3GV4 A;  5TDW A; 
#chains in the Genus database with same CATH homology
 2G43 A;  2E6S A;  2ECT A;  2QIZ A;  5D1L B;  2NAA A;  4YAB A;  4PTB A;  2AN6 A;  2VJF A;  2M85 A;  1MM3 A;  1U6G B;  2KWO A;  2XB1 A;  5AIU A;  4WZ3 B;  3VK6 A;  1K2F A;  4R7E A;  3O7A A;  2QJ0 A;  2VPE A;  2KR4 A;  4YC9 A;  2ECJ A;  2LGK A;  1ZBD B;  2EGP A;  4L58 A;  1X4U A;  3O34 A;  2E6R A;  4GND A;  3SOX A;  5H9M A;  2JRJ A;  2YUR A;  2CSZ A;  2UZG A;  4L7X A;  2VJF B;  1WEP A;  2I50 A;  1WGM A;  4BHW A;  2HYE D;  4UP5 A;  4YAT A;  4QF3 A;  2ECV A;  3NG2 A;  2MA6 A;  1JM7 A;  4AP4 A;  2YQL A;  2MD8 C;  2H0D B;  2IDA A;  2ZET C;  3EB5 A;  2K4D A;  3IHP A;  4YAD A;  3T6R A;  3M63 A;  2Y1N A;  2JMD A;  5C13 A;  5KH9 A;  3L1X A;  4AUQ B;  5B75 A;  1WEV A;  3T7L A;  5J3X A;  2CKL A;  3LQI A;  5FB1 A;  5KH3 A;  3KNV A;  4P5O B;  4GNF A;  4LJN A;  2PNX A;  5H1T A;  1V87 A;  3N9M A;  2YRE A;  2G45 A;  2PUY A;  5LCW B;  4AYC B;  5DKA A;  2YHO A;  2C2L A;  3ASL A;  3ZNI A;  5JG6 A;  1WEN A;  4N4F A;  1LDJ B;  1FBV A;  3QZV A;  5B77 A;  4MSX A;  5B8D A;  5D1M B;  4GB0 A;  4FJC A;  2CKL B;  3PUQ A;  4S3O C;  2YW8 A;  5LKX A;  2KE1 A;  1MM2 A;  3DQV R;  5TRB A;  2F6N A;  2LRI C;  3MHS A;  5EYA F;  2YYR A;  3N9L A;  3M62 A;  3PUR A;  3L11 A;  2ECW A;  3HCT A;  2M3H A;  2ECI A;  2HDP A;  2D8S A;  3RPG B;  1WEO A;  2EOD A;  2RSD A;  4BBQ A;  2KYU A;  4YBT A;  2MA5 A;  2H0D A;  4A49 A;  1Z2Q A;  3EB6 A;  2CSY A;  4GNG A;  1WIL A;  2XEU A;  2M1R A;  3O35 A;  2ECG A;  5DIN A;  2YSM A;  2KGI A;  1F62 A;  2KWJ A;  4FO9 A;  4B7Y C;  4I7D A;  1HYJ A;  3M99 A;  2YSJ A;  2OXQ C;  2QIC A;  2YUC A;  2YQM A;  1WFK A;  4LAD B;  4CA1 A;  5TBN A;  2DX8 A;  4MVT A;  3PHD A;  5H1V A;  2M6M A;  2VPD A;  2JMI A;  2LV9 A;  3O70 A;  3N9O A;  2KWK A;  3U5M A;  4AYC A;  3SOW A;  3O33 A;  4F52 B;  4WA6 A;  5C11 A;  4LLB A;  4YAX A;  3I2D A;  3V43 A;  4UI9 B;  2LXH C;  3ZTG A;  1WEU A;  1RMD A;  5H1U A;  2VP7 A;  5B79 A;  1LDK C;  2F6J A;  3ZVY A;  3N9N A;  5FB0 A;  4IC2 A;  2BAY A;  1VD4 A;  2EA6 A;  3HCS A;  5AIT A;  3C6W A;  2KRE A;  3MHH A;  4LKA A;  3ZPV 1;  4V3K C;  4WZ0 A;  3LQJ A;  3KV5 A;  3KV6 A;  5LKZ A;  3N9Q A;  1E4U A;  5TDR A;  1Z6U A;  1VYX A;  2LGG A;  4YBS A;  4QF2 A;  2FUU A;  2KIZ A;  2LGL A;  4AVX A;  4NN2 A;  2KWN A;  1JOC A;  3KQI A;  2L5U A;  2FUI A;  1WEM A;  3O36 A;  5B76 A;  2MNY A;  3ZVZ B;  2ECN A;  4O64 A;  4N3W A;  3RTR B;  2MUM A;  5LKU A;  2FSA A;  3U5P A;  1XWH A;  3HCU A;  3LQH A;  4V3L C;  4I7B A;  4Q6F A;  4TKP B;  2MNZ A;  5I3L A;  2JMJ A;  2YHN A;  5G04 B;  1WEE A;  2KFT A;  4IC3 A;  3U5N A;  2MD7 B;  5KH7 A;  2G6Q A;  3RPG C;  5B78 A;  2L43 A;  3O37 A;  3C5K A;  1HYI A;  1WE9 A;  4A4C A;  1WEQ A;  4ZUX U;  2YT5 A;  2LXP C;  3FL2 A;  4A0C D;  2L80 A;  4YBM A;  4FIP A;  4PPE A;  2VJE A;  1FP0 A;  2Y43 A;  1CHC A;  2Y1M A;  4R2Y A;  3L1Z B;  2LGV A;  2KU3 A;  4A4B A;  5G0F A;  2VPG A;  5LKT A;  5D1K B;  3HTK C;  2CT2 A;  3ZPV E;  4XI1 A;  2LN0 A;  4WZ2 A;  4ZQL A;  4LK9 A;  1VFY A;  2VJE B;  5TAB A;  4W4U A;  2K1J A;  3LRQ A;  2RI7 A;  2VPB A;  1BOR A;  3ZYQ A;  3N9P A;  1WEW A;  2F42 A;  4CCG X;  1IYM A;  2L75 A;  1X4I A;  4UP0 A;  4GNE A;  2K16 A;  1DVP A;  4X3G A;  2KGG A;  2MIQ A;  5FEY A;  2L0B A;  1T1H A;  4ZDT A;  4FK5 A;  2C2V S;  1JM7 B;  3DPL R;  3SHB A;  4I7C A;  4B86 C;  5FER A;  1G25 A;  3U5O A;  1WES A;  3SOU A;  2MT5 A;  4R8P K;  2K17 A;  5G05 B;  2YU4 A;  1N87 A;  4C9Z A;  4S3O B;  3GL6 A;  1X4J A;  1WIM A;  1Z60 A;  2LQ6 A;  2VNF A;  2LDR A;  3GV4 A;  5TDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...