4S3OB

Pcgf5-ring1b-ubch5c complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
105
Chain Sequence
TQPLSKTWELSLYELQRTPQEAITDLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSNKECPTCRKKLVSKRSLRPDPNFDALISKIYPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/transcription
molecule keywords Ubiquitin-conjugating enzyme E2 D3
publication title BMI1-RING1B is an autoinhibited RING E3 ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 105
sequence length 107
chains with identical sequence E
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4s3oB01
3HTKC 2LQ6A 3U5NA 4FJCA 3N9OA 3ZVZB 4R2YA 4FK5A 2ECNA 1WFKA 4AVXA 2LDRA 1CHCA 1WEOA 5C13A 1WE9A 4C9ZA 2MD7B 2FSAA 2VPGA 4A0CD 4WZ0A 2ECGA 4YATA 2KWJA 3PHDA 2C2LA 5TDWA 1Z60A 4I7BA 1WEVA 2C2VS 2K4DA 3ZPV1 2L75A 3LQJA 2VJFB 3N9NA 4I7DA 1WESA 4WA6A 4CA1A 5FB0A 4GB0A 2FUUA 2Y1NA 2YW8A 2M1RA 2ECIA 2L0BA 2KR4A 2JMIA 2LXPC 2YT5A 5LCWB 3O37A 3KQIA 3LQIA 2VNFA 4NN2A 3PURA 1T1HA 2MA5A 2RI7A 4N3WA 3LRQA 4TKPB 2YU4A 3SOWA 3RTRB 1JM7B 3SOXA 2HDPA 3DPLR 2VJEA 4S3OC 4MVTA 3PUQA 4BHWA 3ASLA 3GL6A 4O64A 4CCGX 1MM2A 2G45A 3ZTGA 1IYMA 2VJFA 4S3OB 4IC3A 4Q6FA 5H9MA 5AITA 1WEWA 2H0DA 5DINA 2M3HA 2FUIA 1HYJA 4LADB 4WZ3B 3VK6A 4ZQLA 2E6SA 4B7YC 3FL2A 1LDKC 2G6QA 4GNEA 1HYIA 2LGVA 4UP5A 5B78A 1V87A 2YYRA 2ECWA 4GNFA 4AP4A 3SOUA 5LKXA 5G05B 4ZDTA 2ECTA 3EB5A 2XEUA 2XB1A 4P5OB 5TDRA 2L80A 2MUMA 2KU3A 2LN0A 2MNZA 1JM7A 4GNGA 5B79A 4IC2A 3N9MA 2VPDA 2K1JA 3L11A 1VD4A 2YUCA 1ZBDB 2I50A 2KWNA 4FO9A 2ECJA 1WIMA 2F6NA 2VJEB 3C5KA 3QZVA 5TABA 1Z2QA 3MHSA 5LKTA 2KYUA 3T6RA 3KV5A 2OXQC 2JMJA 4LKAA 2EGPA 2H0DB 3O35A 4QF2A 2VP7A 1BORA 3O7AA 3ZPVE 2MA6A 1DVPA 1RMDA 4XI1A 4R7EA 1WEMA 1VYXA 3N9QA 5FEYA 2KE1A 2YSMA 5D1MB 3U5PA 3U5OA 2YHOA 3L1ZB 2KGGA 1WEPA 3IHPA 2E6RA 3KV6A 4YBMA 1E4UA 4UI9B 1FP0A 2F6JA 5FB1A 3GV4A 4FIPA 4L7XA 1X4IA 4PPEA 2KREA 5LKZA 3U5MA 2YQLA 2KFTA 4YAXA 2YREA 1WEEA 2YHNA 4X3GA 2EODA 3T7LA 4AYCB 5B77A 4QF3A 4YBSA 4UP0A 3O33A 5KH7A 4A49A 2MT5A 3ZNIA 2CSYA 2F42A 2KWOA 2QIZA 2AN6A 5FERA 2Y1MA 2ECVA 4LLBA 5KH9A 5TRBA 3KNVA 2MNYA 1WGMA 3HCUA 5LKUA 4L58A 2UZGA 5G04B 2LGGA 5B75A 1FBVA 4YABA 2YSJA 5H1UA 1N87A 2L5UA 2G43A 5H1VA 5KH3A 5D1LB 1VFYA 2HYED 2K17A 5EYAF 4AYCA 2LGLA 2LV9A 2PUYA 2D8SA 2CKLB 4PTBA 5H1TA 4A4CA 2YURA 1MM3A 2QJ0A 2BAYA 3HCSA 4R8PK 2IDAA 4N4FA 5B76A 4LK9A 2CT2A 1X4JA 3N9PA 3V43A 2VPBA 2MD8C 4F52B 1WENA 2LGKA 1XWHA 5B8DA 2LXHC 4B86C 3N9LA 2ZETC 2CSZA 3M62A 4YBTA 3HCTA 3L1XA 2L43A 2Y43A 2JMDA 4MSXA 2LRIC 4AUQB 1WEUA 4YC9A 1K2FA 4YADA 5D1KB 4BBQA 2DX8A 3C6WA 2K16A 3EB6A 4WZ2A 1WEQA 4ZUXU 1WILA 3DQVR 1U6GB 2M85A 4W4UA 4A4BA 3RPGC 3ZYQA 2CKLA 5DKAA 5I3LA 1JOCA 3M63A 2RSDA 3RPGB 2KIZA 5C11A 2M6MA 3M99A 5AIUA 1G25A 1LDJB 2JRJA 3NG2A 3I2DA 4LJNA 4I7CA 4V3LC 5G0FA 5JG6A 1F62A 2QICA 3O70A 5J3XA 2VPEA 3O36A 1Z6UA 3ZVYA 5TBNA 3MHHA 2KGIA 2EA6A 3O34A 2YQMA 3LQHA 1X4UA 4GNDA 2KWKA 2NAAA 2MIQA 2PNXA 4V3KC 3SHBA
chains in the Genus database with same CATH superfamily
3HTKC 2LQ6A 3U5NA 2JM3A 4FJCA 2FFWA 3N9OA 4R2YA 3ZVZB 4FK5A 2ECNA 1WFKA 4AVXA 2LDRA 1CHCA 1WEOA 5C13A 2YVRA 1WE9A 4C9ZA 2MD7B 2FSAA 2VPGA 4A0CD 4WZ0A 2ECGA 4YATA 2KWJA 3PHDA 2C2LA 5TDWA 1Z60A 4I7BA 1WEVA 2C2VS 2K4DA 3ZPV1 2L75A 3LQJA 2VJFB 3N9NA 4I7DA 1WESA 4WA6A 4CA1A 5FB0A 4F1PA 3Q1DA 2EXUA 4GB0A 2FUUA 4OGCA 4Z0OA 2Y1NA 2B0OE 2EGMA 2YW8A 2M1RA 2ECIA 2L0BA 2KR4A 2JMIA 2LXPC 2YT5A 5LCWB 3O37A 3KQIA 3LQIA 2VNFA 4NN2A 3PURA 1T1HA 2MA5A 2RI7A 4N3WA 3LRQA 4TKPB 2YU4A 3SOWA 3RTRB 3O47A 1JM7B 3SOXA 2HDPA 3DPLR 2VJEA 4S3OC 4MVTA 2D8UA 3PUQA 4BHWA 3ASLA 3GL6A 4O64A 4CCGX 5K3QA 1MM2A 2G45A 3ZTGA 1IYMA 2VJFA 4S3OB 4IC3A 4Q6FA 5H9MA 5AITA 1WEWA 2H0DA 4QQ4A 5DINA 2M3HA 2FUIA 1HYJA 4H9DA 4LADB 4WZ3B 3VK6A 4ZQLA 2E6SA 4B7YC 3SUBA 3FL2A 1LDKC 2G6QA 2XOYA 4GNEA 1HYIA 2LGVA 2E61A 4UP5A 5B78A 1V87A 2XOZA 2YYRA 2ECWA 4GNFA 4AP4A 3SOUA 5LKXA 5G05B 4ZDTA 5SVYA 2ECTA 3EB5A 2XEUA 2XB1A 2FD4A 4P5OB 5TDRA 2L80A 3DDTA 2MUMA 2KU3A 2LN0A 3LDYA 2MNZA 1JM7A 4GNGA 5B79A 4IC2A 3N9MA 2VPDA 2LAUA 2K1JA 3L11A 1VD4A 2YUCA 1ZBDB 2I50A 2KWNA 4FO9A 2ECJA 3FAOA 1WIMA 2F6NA 2VJEB 3C5KA 3QZVA 5TABA 1Z2QA 3LVQE 4OGEA 3JUEA 3MHSA 5LKTA 2KYUA 2MKEA 3T6RA 3KV5A 2OXQC 2JMJA 4LKAA 2EGPA 2H0DB 3O35A 4QF2A 2VP7A 1BORA 3O7AA 3ZPVE 2MA6A 2JUNA 2DJAA 1DVPA 1RMDA 4XI1A 1DCQA 4R7EA 1WEMA 1VYXA 3N9QA 5FEYA 2KE1A 2YSMA 5D1MB 3U5PA 3U5OA 2YHOA 3L1ZB 2KGGA 1WEPA 3IHPA 2E6RA 3KV6A 4YBMA 1E4UA 4UI9B 2CONA 1FP0A 2F6JA 2DSMA 5FB1A 2IQJA 2P57A 3GV4A 4FIPA 4L7XA 1X4IA 3KDEC 4PPEA 2KREA 5LKZA 3U5MA 2YQLA 2KFTA 4YAXA 2YREA 1WEEA 2KKYA 2YHNA 4X3GA 2EODA 3T7LA 5SVIA 4AYCB 5B77A 2XOCA 4QF3A 4YBSA 4UP0A 3O33A 5KH7A 4A49A 2MT5A 3ZNIA 3PLWA 2CSYA 2F42A 2KWOA 2QIZA 2AN6A 2CRWA 4O62A 5FERA 2M13A 2ECVA 2Y1MA 4LLBA 5KH9A 5TRBA 3KNVA 3M7KA 2MNYA 1WGMA 3HCUA 5LKUA 4L58A 2UZGA 5G04B 2LGGA 5B75A 1FBVA 4YABA 2YSJA 5H1UA 1N87A 2RR4A 3T9KA 2L5UA 2G43A 5H1VA 5KH3A 3LJUX 5D1LB 1VFYA 2HYED 2K17A 5EYAF 4AYCA 2LGLA 2LV9A 5SVXA 2PUYA 2D8SA 2CRRA 2CKLB 4PTBA 5H1TA 4A4CA 2YURA 5SVIB 1MM3A 2QJ0A 2BAYA 3HCSA 4R8PK 2IDAA 4N4FA 5B76A 4LK9A 2CT2A 1X4JA 3N9PA 3V43A 2VPBA 3FEHA 2MD8C 2CSVA 4F52B 3FJUB 1WENA 2LGKA 1XWHA 5B8DA 3E2DA 2LXHC 4B86C 3N9LA 2ZETC 2CSZA 3M62A 4YBTA 3HCTA 3L1XA 2L43A 2Y43A 2JMDA 4MSXA 2LRIC 4AUQB 1WEUA 4YC9A 1K2FA 4YADA 5D1KB 4BBQA 2DX8A 3C6WA 2K16A 3EB6A 4WZ2A 1WEQA 2L7PA 4ZUXU 1WILA 3FM8C 3DQVR 1U6GB 2M85A 4W4UA 4A4BA 3RPGC 4Z0RA 3ZYQA 2CKLA 5DKAA 5I3LA 1JOCA 3M63A 2RSDA 2KKXA 3RPGB 2KIZA 5C11A 2M6MA 3M99A 5AIUA 1G25A 1LDJB 2JRJA 3NG2A 3I2DA 4LJNA 3H7HA 4I7CA 4V3LC 5G0FA 5JG6A 1F62A 2QICA 3O70A 5J3XA 2VPEA 3O36A 1Z6UA 3DWDA 3ZVYA 5TBNA 3MDBC 3MHHA 2KGIA 2XP0A 2EA6A 3O34A 2YQMA 3LQHA 1X4UA 3FANA 4GNDA 2KWKA 2NAAA 2MIQA 2PNXA 4V3KC 3SHBA 1MBMA 3LVRE 2OWAA
chains in the Genus database with same CATH topology
3HTKC 2LQ6A 3U5NA 4FJCA 3N9OA 3ZVZB 4R2YA 4FK5A 2ECNA 1WFKA 4AVXA 2LDRA 1CHCA 1WEOA 5C13A 1WE9A 4C9ZA 2MD7B 2FSAA 2VPGA 4A0CD 4WZ0A 2ECGA 4YATA 2KWJA 3PHDA 2C2LA 5TDWA 1Z60A 4I7BA 1WEVA 2C2VS 2K4DA 3ZPV1 2L75A 3LQJA 2VJFB 3N9NA 4I7DA 1WESA 4WA6A 4CA1A 5FB0A 4GB0A 2FUUA 2Y1NA 2YW8A 2M1RA 2ECIA 2L0BA 2KR4A 2JMIA 2LXPC 2YT5A 5LCWB 3O37A 3KQIA 3LQIA 2VNFA 4NN2A 3PURA 1T1HA 2MA5A 2RI7A 4N3WA 3LRQA 4TKPB 2YU4A 3SOWA 3RTRB 1JM7B 3SOXA 2HDPA 3DPLR 2VJEA 4S3OC 4MVTA 3PUQA 4BHWA 3ASLA 3GL6A 4O64A 4CCGX 1MM2A 2G45A 3ZTGA 1IYMA 2VJFA 4S3OB 4IC3A 4Q6FA 5H9MA 5AITA 1WEWA 2H0DA 5DINA 2M3HA 2FUIA 1HYJA 4LADB 4WZ3B 3VK6A 4ZQLA 2E6SA 4B7YC 3FL2A 1LDKC 2G6QA 4GNEA 1HYIA 2LGVA 4UP5A 5B78A 1V87A 2YYRA 2ECWA 4GNFA 4AP4A 3SOUA 5LKXA 5G05B 4ZDTA 2ECTA 3EB5A 2XEUA 2XB1A 4P5OB 5TDRA 2L80A 2MUMA 2KU3A 2LN0A 2MNZA 1JM7A 4GNGA 5B79A 4IC2A 3N9MA 2VPDA 2K1JA 3L11A 1VD4A 2YUCA 1ZBDB 2I50A 2KWNA 4FO9A 2ECJA 1WIMA 2F6NA 2VJEB 3C5KA 3QZVA 5TABA 1Z2QA 3MHSA 5LKTA 2KYUA 3T6RA 3KV5A 2OXQC 2JMJA 4LKAA 2EGPA 2H0DB 3O35A 4QF2A 2VP7A 1BORA 3O7AA 3ZPVE 2MA6A 1DVPA 1RMDA 4XI1A 4R7EA 1WEMA 1VYXA 3N9QA 5FEYA 2KE1A 2YSMA 5D1MB 3U5PA 3U5OA 2YHOA 3L1ZB 2KGGA 1WEPA 3IHPA 2E6RA 3KV6A 4YBMA 1E4UA 4UI9B 1FP0A 2F6JA 5FB1A 3GV4A 4FIPA 4L7XA 1X4IA 4PPEA 2KREA 5LKZA 3U5MA 2YQLA 2KFTA 4YAXA 2YREA 1WEEA 2YHNA 4X3GA 2EODA 3T7LA 4AYCB 5B77A 4QF3A 4YBSA 4UP0A 3O33A 5KH7A 4A49A 2MT5A 3ZNIA 2CSYA 2F42A 2KWOA 2QIZA 2AN6A 5FERA 2Y1MA 2ECVA 4LLBA 5KH9A 5TRBA 3KNVA 2MNYA 1WGMA 3HCUA 5LKUA 4L58A 2UZGA 5G04B 2LGGA 5B75A 1FBVA 4YABA 2YSJA 5H1UA 1N87A 2L5UA 2G43A 5H1VA 5KH3A 5D1LB 1VFYA 2HYED 2K17A 5EYAF 4AYCA 2LGLA 2LV9A 2PUYA 2D8SA 2CKLB 4PTBA 5H1TA 4A4CA 2YURA 1MM3A 2QJ0A 2BAYA 3HCSA 4R8PK 2IDAA 4N4FA 5B76A 4LK9A 2CT2A 1X4JA 3N9PA 3V43A 2VPBA 2MD8C 4F52B 1WENA 2LGKA 1XWHA 5B8DA 2LXHC 4B86C 3N9LA 2ZETC 2CSZA 3M62A 4YBTA 3HCTA 3L1XA 2L43A 2Y43A 2JMDA 4MSXA 2LRIC 4AUQB 1WEUA 4YC9A 1K2FA 4YADA 5D1KB 4BBQA 2DX8A 3C6WA 2K16A 3EB6A 4WZ2A 1WEQA 4ZUXU 1WILA 3DQVR 1U6GB 2M85A 4W4UA 4A4BA 3RPGC 3ZYQA 2CKLA 5DKAA 5I3LA 1JOCA 3M63A 2RSDA 3RPGB 2KIZA 5C11A 2M6MA 3M99A 5AIUA 1G25A 1LDJB 2JRJA 3NG2A 3I2DA 4LJNA 4I7CA 4V3LC 5G0FA 5JG6A 1F62A 2QICA 3O70A 5J3XA 2VPEA 3O36A 1Z6UA 3ZVYA 5TBNA 3MHHA 2KGIA 2EA6A 3O34A 2YQMA 3LQHA 1X4UA 4GNDA 2KWKA 2NAAA 2MIQA 2PNXA 4V3KC 3SHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTK C;  2LQ6 A;  3U5N A;  4FJC A;  3N9O A;  3ZVZ B;  4R2Y A;  4FK5 A;  2ECN A;  1WFK A;  4AVX A;  2LDR A;  1CHC A;  1WEO A;  5C13 A;  1WE9 A;  4C9Z A;  2MD7 B;  2FSA A;  2VPG A;  4A0C D;  4WZ0 A;  2ECG A;  4YAT A;  2KWJ A;  3PHD A;  2C2L A;  5TDW A;  1Z60 A;  4I7B A;  1WEV A;  2C2V S;  2K4D A;  3ZPV 1;  2L75 A;  3LQJ A;  2VJF B;  3N9N A;  4I7D A;  1WES A;  4WA6 A;  4CA1 A;  5FB0 A;  4GB0 A;  2FUU A;  2Y1N A;  2YW8 A;  2M1R A;  2ECI A;  2L0B A;  2KR4 A;  2JMI A;  2LXP C;  2YT5 A;  5LCW B;  3O37 A;  3KQI A;  3LQI A;  2VNF A;  4NN2 A;  3PUR A;  1T1H A;  2MA5 A;  2RI7 A;  4N3W A;  3LRQ A;  4TKP B;  2YU4 A;  3SOW A;  3RTR B;  1JM7 B;  3SOX A;  2HDP A;  3DPL R;  2VJE A;  4S3O C;  4MVT A;  3PUQ A;  4BHW A;  3ASL A;  3GL6 A;  4O64 A;  4CCG X;  1MM2 A;  2G45 A;  3ZTG A;  1IYM A;  2VJF A;  4S3O B;  4IC3 A;  4Q6F A;  5H9M A;  5AIT A;  1WEW A;  2H0D A;  5DIN A;  2M3H A;  2FUI A;  1HYJ A;  4LAD B;  4WZ3 B;  3VK6 A;  4ZQL A;  2E6S A;  4B7Y C;  3FL2 A;  1LDK C;  2G6Q A;  4GNE A;  1HYI A;  2LGV A;  4UP5 A;  5B78 A;  1V87 A;  2YYR A;  2ECW A;  4GNF A;  4AP4 A;  3SOU A;  5LKX A;  5G05 B;  4ZDT A;  2ECT A;  3EB5 A;  2XEU A;  2XB1 A;  4P5O B;  5TDR A;  2L80 A;  2MUM A;  2KU3 A;  2LN0 A;  2MNZ A;  1JM7 A;  4GNG A;  5B79 A;  4IC2 A;  3N9M A;  2VPD A;  2K1J A;  3L11 A;  1VD4 A;  2YUC A;  1ZBD B;  2I50 A;  2KWN A;  4FO9 A;  2ECJ A;  1WIM A;  2F6N A;  2VJE B;  3C5K A;  3QZV A;  5TAB A;  1Z2Q A;  3MHS A;  5LKT A;  2KYU A;  3T6R A;  3KV5 A;  2OXQ C;  2JMJ A;  4LKA A;  2EGP A;  2H0D B;  3O35 A;  4QF2 A;  2VP7 A;  1BOR A;  3O7A A;  3ZPV E;  2MA6 A;  1DVP A;  1RMD A;  4XI1 A;  4R7E A;  1WEM A;  1VYX A;  3N9Q A;  5FEY A;  2KE1 A;  2YSM A;  5D1M B;  3U5P A;  3U5O A;  2YHO A;  3L1Z B;  2KGG A;  1WEP A;  3IHP A;  2E6R A;  3KV6 A;  4YBM A;  1E4U A;  4UI9 B;  1FP0 A;  2F6J A;  5FB1 A;  3GV4 A;  4FIP A;  4L7X A;  1X4I A;  4PPE A;  2KRE A;  5LKZ A;  3U5M A;  2YQL A;  2KFT A;  4YAX A;  2YRE A;  1WEE A;  2YHN A;  4X3G A;  2EOD A;  3T7L A;  4AYC B;  5B77 A;  4QF3 A;  4YBS A;  4UP0 A;  3O33 A;  5KH7 A;  4A49 A;  2MT5 A;  3ZNI A;  2CSY A;  2F42 A;  2KWO A;  2QIZ A;  2AN6 A;  5FER A;  2Y1M A;  2ECV A;  4LLB A;  5KH9 A;  5TRB A;  3KNV A;  2MNY A;  1WGM A;  3HCU A;  5LKU A;  4L58 A;  2UZG A;  5G04 B;  2LGG A;  5B75 A;  1FBV A;  4YAB A;  2YSJ A;  5H1U A;  1N87 A;  2L5U A;  2G43 A;  5H1V A;  5KH3 A;  5D1L B;  1VFY A;  2HYE D;  2K17 A;  5EYA F;  4AYC A;  2LGL A;  2LV9 A;  2PUY A;  2D8S A;  2CKL B;  4PTB A;  5H1T A;  4A4C A;  2YUR A;  1MM3 A;  2QJ0 A;  2BAY A;  3HCS A;  4R8P K;  2IDA A;  4N4F A;  5B76 A;  4LK9 A;  2CT2 A;  1X4J A;  3N9P A;  3V43 A;  2VPB A;  2MD8 C;  4F52 B;  1WEN A;  2LGK A;  1XWH A;  5B8D A;  2LXH C;  4B86 C;  3N9L A;  2ZET C;  2CSZ A;  3M62 A;  4YBT A;  3HCT A;  3L1X A;  2L43 A;  2Y43 A;  2JMD A;  4MSX A;  2LRI C;  4AUQ B;  1WEU A;  4YC9 A;  1K2F A;  4YAD A;  5D1K B;  4BBQ A;  2DX8 A;  3C6W A;  2K16 A;  3EB6 A;  4WZ2 A;  1WEQ A;  4ZUX U;  1WIL A;  3DQV R;  1U6G B;  2M85 A;  4W4U A;  4A4B A;  3RPG C;  3ZYQ A;  2CKL A;  5DKA A;  5I3L A;  1JOC A;  3M63 A;  2RSD A;  3RPG B;  2KIZ A;  5C11 A;  2M6M A;  3M99 A;  5AIU A;  1G25 A;  1LDJ B;  2JRJ A;  3NG2 A;  3I2D A;  4LJN A;  4I7C A;  4V3L C;  5G0F A;  5JG6 A;  1F62 A;  2QIC A;  3O70 A;  5J3X A;  2VPE A;  3O36 A;  1Z6U A;  3ZVY A;  5TBN A;  3MHH A;  2KGI A;  2EA6 A;  3O34 A;  2YQM A;  3LQH A;  1X4U A;  4GND A;  2KWK A;  2NAA A;  2MIQ A;  2PNX A;  4V3K C;  3SHB A; 
#chains in the Genus database with same CATH topology
 3HTK C;  2LQ6 A;  3U5N A;  2JM3 A;  4FJC A;  2FFW A;  3N9O A;  4R2Y A;  3ZVZ B;  4FK5 A;  2ECN A;  1WFK A;  4AVX A;  2LDR A;  1CHC A;  1WEO A;  5C13 A;  2YVR A;  1WE9 A;  4C9Z A;  2MD7 B;  2FSA A;  2VPG A;  4A0C D;  4WZ0 A;  2ECG A;  4YAT A;  2KWJ A;  3PHD A;  2C2L A;  5TDW A;  1Z60 A;  4I7B A;  1WEV A;  2C2V S;  2K4D A;  3ZPV 1;  2L75 A;  3LQJ A;  2VJF B;  3N9N A;  4I7D A;  1WES A;  4WA6 A;  4CA1 A;  5FB0 A;  4F1P A;  3Q1D A;  2EXU A;  4GB0 A;  2FUU A;  4OGC A;  4Z0O A;  2Y1N A;  2B0O E;  2EGM A;  2YW8 A;  2M1R A;  2ECI A;  2L0B A;  2KR4 A;  2JMI A;  2LXP C;  2YT5 A;  5LCW B;  3O37 A;  3KQI A;  3LQI A;  2VNF A;  4NN2 A;  3PUR A;  1T1H A;  2MA5 A;  2RI7 A;  4N3W A;  3LRQ A;  4TKP B;  2YU4 A;  3SOW A;  3RTR B;  3O47 A;  1JM7 B;  3SOX A;  2HDP A;  3DPL R;  2VJE A;  4S3O C;  4MVT A;  2D8U A;  3PUQ A;  4BHW A;  3ASL A;  3GL6 A;  4O64 A;  4CCG X;  5K3Q A;  1MM2 A;  2G45 A;  3ZTG A;  1IYM A;  2VJF A;  4S3O B;  4IC3 A;  4Q6F A;  5H9M A;  5AIT A;  1WEW A;  2H0D A;  4QQ4 A;  5DIN A;  2M3H A;  2FUI A;  1HYJ A;  4H9D A;  4LAD B;  4WZ3 B;  3VK6 A;  4ZQL A;  2E6S A;  4B7Y C;  3SUB A;  3FL2 A;  1LDK C;  2G6Q A;  2XOY A;  4GNE A;  1HYI A;  2LGV A;  2E61 A;  4UP5 A;  5B78 A;  1V87 A;  2XOZ A;  2YYR A;  2ECW A;  4GNF A;  4AP4 A;  3SOU A;  5LKX A;  5G05 B;  4ZDT A;  5SVY A;  2ECT A;  3EB5 A;  2XEU A;  2XB1 A;  2FD4 A;  4P5O B;  5TDR A;  2L80 A;  3DDT A;  2MUM A;  2KU3 A;  2LN0 A;  3LDY A;  2MNZ A;  1JM7 A;  4GNG A;  5B79 A;  4IC2 A;  3N9M A;  2VPD A;  2LAU A;  2K1J A;  3L11 A;  1VD4 A;  2YUC A;  1ZBD B;  2I50 A;  2KWN A;  4FO9 A;  2ECJ A;  3FAO A;  1WIM A;  2F6N A;  2VJE B;  3C5K A;  3QZV A;  5TAB A;  1Z2Q A;  3LVQ E;  4OGE A;  3JUE A;  3MHS A;  5LKT A;  2KYU A;  2MKE A;  3T6R A;  3KV5 A;  2OXQ C;  2JMJ A;  4LKA A;  2EGP A;  2H0D B;  3O35 A;  4QF2 A;  2VP7 A;  1BOR A;  3O7A A;  3ZPV E;  2MA6 A;  2JUN A;  2DJA A;  1DVP A;  1RMD A;  4XI1 A;  1DCQ A;  4R7E A;  1WEM A;  1VYX A;  3N9Q A;  5FEY A;  2KE1 A;  2YSM A;  5D1M B;  3U5P A;  3U5O A;  2YHO A;  3L1Z B;  2KGG A;  1WEP A;  3IHP A;  2E6R A;  3KV6 A;  4YBM A;  1E4U A;  4UI9 B;  2CON A;  1FP0 A;  2F6J A;  2DSM A;  5FB1 A;  2IQJ A;  2P57 A;  3GV4 A;  4FIP A;  4L7X A;  1X4I A;  3KDE C;  4PPE A;  2KRE A;  5LKZ A;  3U5M A;  2YQL A;  2KFT A;  4YAX A;  2YRE A;  1WEE A;  2KKY A;  2YHN A;  4X3G A;  2EOD A;  3T7L A;  5SVI A;  4AYC B;  5B77 A;  2XOC A;  4QF3 A;  4YBS A;  4UP0 A;  3O33 A;  5KH7 A;  4A49 A;  2MT5 A;  3ZNI A;  3PLW A;  2CSY A;  2F42 A;  2KWO A;  2QIZ A;  2AN6 A;  2CRW A;  4O62 A;  5FER A;  2M13 A;  2ECV A;  2Y1M A;  4LLB A;  5KH9 A;  5TRB A;  3KNV A;  3M7K A;  2MNY A;  1WGM A;  3HCU A;  5LKU A;  4L58 A;  2UZG A;  5G04 B;  2LGG A;  5B75 A;  1FBV A;  4YAB A;  2YSJ A;  5H1U A;  1N87 A;  2RR4 A;  3T9K A;  2L5U A;  2G43 A;  5H1V A;  5KH3 A;  3LJU X;  5D1L B;  1VFY A;  2HYE D;  2K17 A;  5EYA F;  4AYC A;  2LGL A;  2LV9 A;  5SVX A;  2PUY A;  2D8S A;  2CRR A;  2CKL B;  4PTB A;  5H1T A;  4A4C A;  2YUR A;  5SVI B;  1MM3 A;  2QJ0 A;  2BAY A;  3HCS A;  4R8P K;  2IDA A;  4N4F A;  5B76 A;  4LK9 A;  2CT2 A;  1X4J A;  3N9P A;  3V43 A;  2VPB A;  3FEH A;  2MD8 C;  2CSV A;  4F52 B;  3FJU B;  1WEN A;  2LGK A;  1XWH A;  5B8D A;  3E2D A;  2LXH C;  4B86 C;  3N9L A;  2ZET C;  2CSZ A;  3M62 A;  4YBT A;  3HCT A;  3L1X A;  2L43 A;  2Y43 A;  2JMD A;  4MSX A;  2LRI C;  4AUQ B;  1WEU A;  4YC9 A;  1K2F A;  4YAD A;  5D1K B;  4BBQ A;  2DX8 A;  3C6W A;  2K16 A;  3EB6 A;  4WZ2 A;  1WEQ A;  2L7P A;  4ZUX U;  1WIL A;  3FM8 C;  3DQV R;  1U6G B;  2M85 A;  4W4U A;  4A4B A;  3RPG C;  4Z0R A;  3ZYQ A;  2CKL A;  5DKA A;  5I3L A;  1JOC A;  3M63 A;  2RSD A;  2KKX A;  3RPG B;  2KIZ A;  5C11 A;  2M6M A;  3M99 A;  5AIU A;  1G25 A;  1LDJ B;  2JRJ A;  3NG2 A;  3I2D A;  4LJN A;  3H7H A;  4I7C A;  4V3L C;  5G0F A;  5JG6 A;  1F62 A;  2QIC A;  3O70 A;  5J3X A;  2VPE A;  3O36 A;  1Z6U A;  3DWD A;  3ZVY A;  5TBN A;  3MDB C;  3MHH A;  2KGI A;  2XP0 A;  2EA6 A;  3O34 A;  2YQM A;  3LQH A;  1X4U A;  3FAN A;  4GND A;  2KWK A;  2NAA A;  2MIQ A;  2PNX A;  4V3K C;  3SHB A;  1MBM A;  3LVR E;  2OWA A; 
#chains in the Genus database with same CATH homology
 3HTK C;  2LQ6 A;  3U5N A;  4FJC A;  3N9O A;  3ZVZ B;  4R2Y A;  4FK5 A;  2ECN A;  1WFK A;  4AVX A;  2LDR A;  1CHC A;  1WEO A;  5C13 A;  1WE9 A;  4C9Z A;  2MD7 B;  2FSA A;  2VPG A;  4A0C D;  4WZ0 A;  2ECG A;  4YAT A;  2KWJ A;  3PHD A;  2C2L A;  5TDW A;  1Z60 A;  4I7B A;  1WEV A;  2C2V S;  2K4D A;  3ZPV 1;  2L75 A;  3LQJ A;  2VJF B;  3N9N A;  4I7D A;  1WES A;  4WA6 A;  4CA1 A;  5FB0 A;  4GB0 A;  2FUU A;  2Y1N A;  2YW8 A;  2M1R A;  2ECI A;  2L0B A;  2KR4 A;  2JMI A;  2LXP C;  2YT5 A;  5LCW B;  3O37 A;  3KQI A;  3LQI A;  2VNF A;  4NN2 A;  3PUR A;  1T1H A;  2MA5 A;  2RI7 A;  4N3W A;  3LRQ A;  4TKP B;  2YU4 A;  3SOW A;  3RTR B;  1JM7 B;  3SOX A;  2HDP A;  3DPL R;  2VJE A;  4S3O C;  4MVT A;  3PUQ A;  4BHW A;  3ASL A;  3GL6 A;  4O64 A;  4CCG X;  1MM2 A;  2G45 A;  3ZTG A;  1IYM A;  2VJF A;  4S3O B;  4IC3 A;  4Q6F A;  5H9M A;  5AIT A;  1WEW A;  2H0D A;  5DIN A;  2M3H A;  2FUI A;  1HYJ A;  4LAD B;  4WZ3 B;  3VK6 A;  4ZQL A;  2E6S A;  4B7Y C;  3FL2 A;  1LDK C;  2G6Q A;  4GNE A;  1HYI A;  2LGV A;  4UP5 A;  5B78 A;  1V87 A;  2YYR A;  2ECW A;  4GNF A;  4AP4 A;  3SOU A;  5LKX A;  5G05 B;  4ZDT A;  2ECT A;  3EB5 A;  2XEU A;  2XB1 A;  4P5O B;  5TDR A;  2L80 A;  2MUM A;  2KU3 A;  2LN0 A;  2MNZ A;  1JM7 A;  4GNG A;  5B79 A;  4IC2 A;  3N9M A;  2VPD A;  2K1J A;  3L11 A;  1VD4 A;  2YUC A;  1ZBD B;  2I50 A;  2KWN A;  4FO9 A;  2ECJ A;  1WIM A;  2F6N A;  2VJE B;  3C5K A;  3QZV A;  5TAB A;  1Z2Q A;  3MHS A;  5LKT A;  2KYU A;  3T6R A;  3KV5 A;  2OXQ C;  2JMJ A;  4LKA A;  2EGP A;  2H0D B;  3O35 A;  4QF2 A;  2VP7 A;  1BOR A;  3O7A A;  3ZPV E;  2MA6 A;  1DVP A;  1RMD A;  4XI1 A;  4R7E A;  1WEM A;  1VYX A;  3N9Q A;  5FEY A;  2KE1 A;  2YSM A;  5D1M B;  3U5P A;  3U5O A;  2YHO A;  3L1Z B;  2KGG A;  1WEP A;  3IHP A;  2E6R A;  3KV6 A;  4YBM A;  1E4U A;  4UI9 B;  1FP0 A;  2F6J A;  5FB1 A;  3GV4 A;  4FIP A;  4L7X A;  1X4I A;  4PPE A;  2KRE A;  5LKZ A;  3U5M A;  2YQL A;  2KFT A;  4YAX A;  2YRE A;  1WEE A;  2YHN A;  4X3G A;  2EOD A;  3T7L A;  4AYC B;  5B77 A;  4QF3 A;  4YBS A;  4UP0 A;  3O33 A;  5KH7 A;  4A49 A;  2MT5 A;  3ZNI A;  2CSY A;  2F42 A;  2KWO A;  2QIZ A;  2AN6 A;  5FER A;  2Y1M A;  2ECV A;  4LLB A;  5KH9 A;  5TRB A;  3KNV A;  2MNY A;  1WGM A;  3HCU A;  5LKU A;  4L58 A;  2UZG A;  5G04 B;  2LGG A;  5B75 A;  1FBV A;  4YAB A;  2YSJ A;  5H1U A;  1N87 A;  2L5U A;  2G43 A;  5H1V A;  5KH3 A;  5D1L B;  1VFY A;  2HYE D;  2K17 A;  5EYA F;  4AYC A;  2LGL A;  2LV9 A;  2PUY A;  2D8S A;  2CKL B;  4PTB A;  5H1T A;  4A4C A;  2YUR A;  1MM3 A;  2QJ0 A;  2BAY A;  3HCS A;  4R8P K;  2IDA A;  4N4F A;  5B76 A;  4LK9 A;  2CT2 A;  1X4J A;  3N9P A;  3V43 A;  2VPB A;  2MD8 C;  4F52 B;  1WEN A;  2LGK A;  1XWH A;  5B8D A;  2LXH C;  4B86 C;  3N9L A;  2ZET C;  2CSZ A;  3M62 A;  4YBT A;  3HCT A;  3L1X A;  2L43 A;  2Y43 A;  2JMD A;  4MSX A;  2LRI C;  4AUQ B;  1WEU A;  4YC9 A;  1K2F A;  4YAD A;  5D1K B;  4BBQ A;  2DX8 A;  3C6W A;  2K16 A;  3EB6 A;  4WZ2 A;  1WEQ A;  4ZUX U;  1WIL A;  3DQV R;  1U6G B;  2M85 A;  4W4U A;  4A4B A;  3RPG C;  3ZYQ A;  2CKL A;  5DKA A;  5I3L A;  1JOC A;  3M63 A;  2RSD A;  3RPG B;  2KIZ A;  5C11 A;  2M6M A;  3M99 A;  5AIU A;  1G25 A;  1LDJ B;  2JRJ A;  3NG2 A;  3I2D A;  4LJN A;  4I7C A;  4V3L C;  5G0F A;  5JG6 A;  1F62 A;  2QIC A;  3O70 A;  5J3X A;  2VPE A;  3O36 A;  1Z6U A;  3ZVY A;  5TBN A;  3MHH A;  2KGI A;  2EA6 A;  3O34 A;  2YQM A;  3LQH A;  1X4U A;  4GND A;  2KWK A;  2NAA A;  2MIQ A;  2PNX A;  4V3K C;  3SHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...