4S3OB

Pcgf5-ring1b-ubch5c complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
105
Chain Sequence
b'TQPLSKTWELSLYELQRTPQEAITDLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSNKECPTCRKKLVSKRSLRPDPNFDALISKIYPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 D3
publication title BMI1-RING1B is an autoinhibited RING E3 ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/transcription
total genus 26
structure length 105
sequence length 107
chains with identical sequence E
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4s3oB01
3ZNIA 2MT5A 2Y1NA 4GNGA 3RPGB 4ZUXU 1E4UA 2LXPC 1G25A 2YYRA 2VNFA 3ZYQA 5TDRA 4CA1A 3ZPVE 2C2VS 2MD8C 3MHHA 4A0CD 4LKAA 2LGLA 2E6RA 2ECJA 1BORA 4WA6A 4UP0A 3N9QA 2ECIA 4LJNA 3U5MA 2DX8A 2JMJA 5G0FA 1Z2QA 2ZETC 4IC2A 3HTKC 2BAYA 5EYAF 2KU3A 2VP7A 1WIMA 4L58A 2CT2A 3V43A 2AN6A 2H0DB 2LQ6A 4PTBA 2F42A 1U6GB 4LK9A 1WEWA 5B8DA 3KV6A 1ZBDB 4XI1A 2EGPA 4V3KC 4GNDA 4FO9A 3DQVR 4TKPB 2L80A 1HYJA 4A49A 3ZVYA 2YHOA 2VJFB 2JMDA 2KWOA 5D1LB 4AUQB 1IYMA 4PPEA 5FEYA 2G6QA 5DINA 1WESA 1WGMA 2FUIA 3KV5A 2L5UA 2L43A 1VYXA 3RTRB 1MM3A 5JG6A 3PURA 2JRJA 1RMDA 4I7CA 3DPLR 2LV9A 3O37A 4MVTA 3LQIA 2D8SA 2ECNA 2IDAA 4WZ0A 5KH9A 2VPBA 4YBTA 3ZVZB 2L75A 1WEMA 2YT5A 4A4CA 2ECVA 2EA6A 4IC3A 2MA6A 1HYIA 2VJEB 2M85A 3HCTA 3L1ZB 4GNEA 2LRIC 1XWHA 4LADB 4X3GA 1K2FA 3IHPA 2YQLA 4A4BA 5AITA 3N9MA 3LQJA 2L0BA 5H1TA 5AIUA 1WFKA 3N9OA 2MA5A 2NAAA 3GV4A 2H0DA 2YW8A 4AYCB 4FK5A 3HCUA 5G05B 5H1UA 2I50A 3U5NA 2QIZA 4QF2A 3SHBA 2CKLB 4FIPA 4P5OB 2EODA 2KR4A 3T6RA 3O7AA 2FUUA 2QICA 4B86C 4YATA 3U5PA 2RSDA 3LQHA 1WILA 5TRBA 3C6WA 2RI7A 4YC9A 2KYUA 3O35A 5LCWB 4I7BA 2YUCA 4WZ2A 2G45A 5D1KB 3EB5A 4AP4A 3M99A 4ZQLA 1X4IA 2KFTA 2LGKA 3GL6A 3PUQA 3KQIA 2LXHC 2K17A 4FJCA 5B78A 5LKZA 4L7XA 2MD7B 2KE1A 2YURA 5C11A 4B7YC 5D1MB 4Q6FA 2VJEA 2LGVA 1LDJB 3N9PA 1FP0A 1WEVA 3L1XA 3L11A 2ECWA 1WE9A 5B76A 2M3HA 2F6NA 2MNZA 2XEUA 4C9ZA 5TDWA 4GB0A 4W4UA 3QZVA 2OXQC 2K1JA 4YADA 2Y43A 5B77A 2M1RA 3T7LA 2CKLA 5C13A 5LKUA 4GNFA 4ZDTA 4N4FA 4BHWA 3MHSA 4LLBA 5G04B 4YBMA 2YQMA 2M6MA 2UZGA 4WZ3B 1WEOA 2PUYA 1FBVA 2QJ0A 5H1VA 3VK6A 4F52B 2E6SA 3U5OA 2YSJA 1Z60A 1MM2A 2KGGA 5J3XA 2LGGA 3KNVA 3O33A 1JM7B 1LDKC 2KIZA 3EB6A 2CSZA 4YAXA 1VFYA 4S3OC 4AVXA 3SOWA 5KH3A 4UP5A 2MIQA 4O64A 3O34A 2VJFA 4N3WA 3O36A 3C5KA 2KREA 2KWNA 1VD4A 3NG2A 2VPEA 1WEQA 2CSYA 4I7DA 5H9MA 2KGIA 5FB1A 3M63A 5TBNA 3LRQA 2K16A 1CHCA 1X4UA 2PNXA 4S3OB 2KWJA 4R7EA 3FL2A 4MSXA 3ZTGA 5FERA 5B75A 5TABA 2G43A 5KH7A 1N87A 1V87A 3N9NA 1X4JA 2HYED 4NN2A 2ECGA 5LKXA 3SOXA 1DVPA 1WEEA 2YU4A 4BBQA 3N9LA 2C2LA 1Z6UA 2KWKA 4R2YA 1WENA 2LDRA 3I2DA 5LKTA 3SOUA 4YBSA 4R8PK 2FSAA 1JM7A 4AYCA 2XB1A 4CCGX 2YHNA 2VPDA 2ECTA 2JMIA 2YSMA 5I3LA 2YREA 3M62A 3O70A 4V3LC 3RPGC 2K4DA 2HDPA 1JOCA 5FB0A 1F62A 4UI9B 2MNYA 2VPGA 3ASLA 5DKAA 2F6JA 3HCSA 3ZPV1 3PHDA 5B79A 4QF3A 2MUMA 1WEUA 4YABA 1T1HA 2LN0A 1WEPA 2Y1MA
chains in the Genus database with same CATH superfamily
3ZNIA 2MT5A 2Y1NA 4GNGA 2CONA 4Z0OA 3RPGB 4ZUXU 1E4UA 2LXPC 2CSVA 1G25A 2YYRA 2VNFA 3ZYQA 5TDRA 4CA1A 3ZPVE 2C2VS 2MD8C 4F1PA 3MHHA 4H9DA 4A0CD 4LKAA 2LGLA 2E6RA 2ECJA 1BORA 4WA6A 4UP0A 3N9QA 2ECIA 2EGMA 4LJNA 3U5MA 2DX8A 3FAOA 2JMJA 5G0FA 1Z2QA 3M7KA 2ZETC 4IC2A 3HTKC 2BAYA 5EYAF 2KU3A 2VP7A 5SVIB 1WIMA 4L58A 2CT2A 3V43A 4O62A 3DWDA 2AN6A 2H0DB 2LQ6A 4PTBA 2F42A 1U6GB 3KDEC 4LK9A 1WEWA 5B8DA 3KV6A 5SVYA 1ZBDB 4XI1A 2P57A 2EGPA 4V3KC 4GNDA 4FO9A 3DQVR 4TKPB 2L80A 1HYJA 4A49A 3ZVYA 2YHOA 2VJFB 2JMDA 3PLWA 3JUEA 2L7PA 2KWOA 5D1LB 4AUQB 1IYMA 4PPEA 5FEYA 2G6QA 5DINA 1WESA 1WGMA 2FUIA 3KV5A 2L5UA 2L43A 1VYXA 3RTRB 1MM3A 5JG6A 3LVRE 3PURA 2JRJA 1RMDA 4I7CA 4MVTA 3DPLR 2LV9A 3O37A 2DJAA 2D8SA 2ECNA 2IDAA 2YVRA 3LQIA 4WZ0A 5KH9A 2VPBA 4YBTA 3ZVZB 2L75A 1WEMA 2YT5A 4A4CA 2ECVA 2EA6A 4IC3A 2MA6A 1HYIA 2VJEB 2M85A 3HCTA 3L1ZB 3FEHA 4GNEA 2LRIC 1XWHA 4LADB 5K3QA 4X3GA 1K2FA 3IHPA 2JM3A 2YQLA 4A4BA 5AITA 3N9MA 3LQJA 2L0BA 5H1TA 5AIUA 1WFKA 3N9OA 2MA5A 2NAAA 3GV4A 2H0DA 2YW8A 3FANA 4AYCB 4FK5A 3HCUA 5G05B 1MBMA 2I50A 3FM8C 5H1UA 3U5NA 2QIZA 2XOYA 4QF2A 3SHBA 2CKLB 4FIPA 4P5OB 2EODA 2KR4A 3T6RA 2CRRA 3O7AA 2FUUA 2M13A 2QICA 4B86C 4YATA 2CRWA 2RSDA 3U5PA 2FFWA 3LQHA 3LJUX 1WILA 5TRBA 3C6WA 2RI7A 4YC9A 2KYUA 3O35A 5LCWB 4I7BA 2YUCA 4WZ2A 2G45A 5D1KB 2XOCA 3EB5A 4AP4A 3M99A 4ZQLA 3T9KA 1X4IA 2KFTA 2LGKA 3GL6A 3PUQA 5SVXA 3KQIA 2LXHC 2K17A 3LDYA 4FJCA 5B78A 5LKZA 4L7XA 2MD7B 2KE1A 1DCQA 2YURA 2JUNA 4B7YC 5C11A 5D1MB 4Q6FA 2VJEA 2LGVA 2KKXA 1LDJB 3N9PA 1FP0A 1WEVA 3L1XA 3L11A 2ECWA 1WE9A 5B76A 2M3HA 2RR4A 2F6NA 2MNZA 4OGEA 2XEUA 4C9ZA 5TDWA 4GB0A 4W4UA 3QZVA 2OXQC 3SUBA 2K1JA 4YADA 2XP0A 2Y43A 5B77A 2EXUA 2M1RA 3T7LA 2CKLA 5C13A 5LKUA 4GNFA 4ZDTA 4N4FA 4BHWA 3MHSA 4LLBA 3E2DA 5G04B 4YBMA 2YQMA 5SVIA 2M6MA 2UZGA 4WZ3B 2B0OE 1WEOA 2KKYA 2PUYA 1FBVA 2QJ0A 5H1VA 3VK6A 4F52B 2E6SA 3U5OA 2YSJA 1Z60A 1MM2A 2KGGA 2DSMA 3LVQE 5J3XA 2LGGA 2LAUA 3KNVA 3O33A 1JM7B 1LDKC 2KIZA 3EB6A 3DDTA 2CSZA 3H7HA 4YAXA 1VFYA 4S3OC 3MDBC 4AVXA 3SOWA 5KH3A 2XOZA 4UP5A 2MIQA 4O64A 3O34A 2D8UA 2VJFA 4N3WA 3O36A 3C5KA 2KREA 2KWNA 1VD4A 3NG2A 4OGCA 2VPEA 1WEQA 2CSYA 4I7DA 5H9MA 2KGIA 5FB1A 4Z0RA 3M63A 5TBNA 3LRQA 2K16A 1CHCA 1X4UA 2PNXA 4S3OB 2KWJA 4R7EA 3FL2A 4MSXA 3ZTGA 5FERA 5B75A 5TABA 2G43A 5KH7A 1N87A 1V87A 2OWAA 3N9NA 1X4JA 2HYED 4NN2A 2ECGA 5LKXA 3SOXA 1DVPA 1WEEA 2YU4A 4BBQA 3N9LA 2C2LA 3O47A 1Z6UA 2KWKA 4R2YA 1WENA 2LDRA 3I2DA 5LKTA 3SOUA 4YBSA 4R8PK 2FSAA 1JM7A 4AYCA 2XB1A 3Q1DA 4CCGX 4QQ4A 2YHNA 2VPDA 2ECTA 2JMIA 2YSMA 5I3LA 2MKEA 2YREA 3M62A 3O70A 4V3LC 2E61A 3RPGC 2FD4A 2K4DA 2HDPA 2IQJA 1JOCA 5FB0A 1F62A 4UI9B 3FJUB 2MNYA 2VPGA 3ASLA 5DKAA 2F6JA 3HCSA 3ZPV1 3PHDA 5B79A 4QF3A 2MUMA 1WEUA 4YABA 1T1HA 2LN0A 1WEPA 2Y1MA
chains in the Genus database with same CATH topology
3ZNIA 2MT5A 2Y1NA 4GNGA 3RPGB 4ZUXU 1E4UA 2LXPC 1G25A 2YYRA 2VNFA 3ZYQA 5TDRA 4CA1A 3ZPVE 2C2VS 2MD8C 3MHHA 4A0CD 4LKAA 2LGLA 2E6RA 2ECJA 1BORA 4WA6A 4UP0A 3N9QA 2ECIA 4LJNA 3U5MA 2DX8A 2JMJA 5G0FA 1Z2QA 2ZETC 4IC2A 3HTKC 2BAYA 5EYAF 2KU3A 2VP7A 1WIMA 4L58A 2CT2A 3V43A 2AN6A 2H0DB 2LQ6A 4PTBA 2F42A 1U6GB 4LK9A 1WEWA 5B8DA 3KV6A 1ZBDB 4XI1A 2EGPA 4V3KC 4GNDA 4FO9A 3DQVR 4TKPB 2L80A 1HYJA 4A49A 3ZVYA 2YHOA 2VJFB 2JMDA 2KWOA 5D1LB 4AUQB 1IYMA 4PPEA 5FEYA 2G6QA 5DINA 1WESA 1WGMA 2FUIA 3KV5A 2L5UA 2L43A 1VYXA 3RTRB 1MM3A 5JG6A 3PURA 2JRJA 1RMDA 4I7CA 3DPLR 2LV9A 3O37A 4MVTA 3LQIA 2D8SA 2ECNA 2IDAA 4WZ0A 5KH9A 2VPBA 4YBTA 3ZVZB 2L75A 1WEMA 2YT5A 4A4CA 2ECVA 2EA6A 4IC3A 2MA6A 1HYIA 2VJEB 2M85A 3HCTA 3L1ZB 4GNEA 2LRIC 1XWHA 4LADB 4X3GA 1K2FA 3IHPA 2YQLA 4A4BA 5AITA 3N9MA 3LQJA 2L0BA 5H1TA 5AIUA 1WFKA 3N9OA 2MA5A 2NAAA 3GV4A 2H0DA 2YW8A 4AYCB 4FK5A 3HCUA 5G05B 5H1UA 2I50A 3U5NA 2QIZA 4QF2A 3SHBA 2CKLB 4FIPA 4P5OB 2EODA 2KR4A 3T6RA 3O7AA 2FUUA 2QICA 4B86C 4YATA 3U5PA 2RSDA 3LQHA 1WILA 5TRBA 3C6WA 2RI7A 4YC9A 2KYUA 3O35A 5LCWB 4I7BA 2YUCA 4WZ2A 2G45A 5D1KB 3EB5A 4AP4A 3M99A 4ZQLA 1X4IA 2KFTA 2LGKA 3GL6A 3PUQA 3KQIA 2LXHC 2K17A 4FJCA 5B78A 5LKZA 4L7XA 2MD7B 2KE1A 2YURA 5C11A 4B7YC 5D1MB 4Q6FA 2VJEA 2LGVA 1LDJB 3N9PA 1FP0A 1WEVA 3L1XA 3L11A 2ECWA 1WE9A 5B76A 2M3HA 2F6NA 2MNZA 2XEUA 4C9ZA 5TDWA 4GB0A 4W4UA 3QZVA 2OXQC 2K1JA 4YADA 2Y43A 5B77A 2M1RA 3T7LA 2CKLA 5C13A 5LKUA 4GNFA 4ZDTA 4N4FA 4BHWA 3MHSA 4LLBA 5G04B 4YBMA 2YQMA 2M6MA 2UZGA 4WZ3B 1WEOA 2PUYA 1FBVA 2QJ0A 5H1VA 3VK6A 4F52B 2E6SA 3U5OA 2YSJA 1Z60A 1MM2A 2KGGA 5J3XA 2LGGA 3KNVA 3O33A 1JM7B 1LDKC 2KIZA 3EB6A 2CSZA 4YAXA 1VFYA 4S3OC 4AVXA 3SOWA 5KH3A 4UP5A 2MIQA 4O64A 3O34A 2VJFA 4N3WA 3O36A 3C5KA 2KREA 2KWNA 1VD4A 3NG2A 2VPEA 1WEQA 2CSYA 4I7DA 5H9MA 2KGIA 5FB1A 3M63A 5TBNA 3LRQA 2K16A 1CHCA 1X4UA 2PNXA 4S3OB 2KWJA 4R7EA 3FL2A 4MSXA 3ZTGA 5FERA 5B75A 5TABA 2G43A 5KH7A 1N87A 1V87A 3N9NA 1X4JA 2HYED 4NN2A 2ECGA 5LKXA 3SOXA 1DVPA 1WEEA 2YU4A 4BBQA 3N9LA 2C2LA 1Z6UA 2KWKA 4R2YA 1WENA 2LDRA 3I2DA 5LKTA 3SOUA 4YBSA 4R8PK 2FSAA 1JM7A 4AYCA 2XB1A 4CCGX 2YHNA 2VPDA 2ECTA 2JMIA 2YSMA 5I3LA 2YREA 3M62A 3O70A 4V3LC 3RPGC 2K4DA 2HDPA 1JOCA 5FB0A 1F62A 4UI9B 2MNYA 2VPGA 3ASLA 5DKAA 2F6JA 3HCSA 3ZPV1 3PHDA 5B79A 4QF3A 2MUMA 1WEUA 4YABA 1T1HA 2LN0A 1WEPA 2Y1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNI A;  2MT5 A;  2Y1N A;  4GNG A;  3RPG B;  4ZUX U;  1E4U A;  2LXP C;  1G25 A;  2YYR A;  2VNF A;  3ZYQ A;  5TDR A;  4CA1 A;  3ZPV E;  2C2V S;  2MD8 C;  3MHH A;  4A0C D;  4LKA A;  2LGL A;  2E6R A;  2ECJ A;  1BOR A;  4WA6 A;  4UP0 A;  3N9Q A;  2ECI A;  4LJN A;  3U5M A;  2DX8 A;  2JMJ A;  5G0F A;  1Z2Q A;  2ZET C;  4IC2 A;  3HTK C;  2BAY A;  5EYA F;  2KU3 A;  2VP7 A;  1WIM A;  4L58 A;  2CT2 A;  3V43 A;  2AN6 A;  2H0D B;  2LQ6 A;  4PTB A;  2F42 A;  1U6G B;  4LK9 A;  1WEW A;  5B8D A;  3KV6 A;  1ZBD B;  4XI1 A;  2EGP A;  4V3K C;  4GND A;  4FO9 A;  3DQV R;  4TKP B;  2L80 A;  1HYJ A;  4A49 A;  3ZVY A;  2YHO A;  2VJF B;  2JMD A;  2KWO A;  5D1L B;  4AUQ B;  1IYM A;  4PPE A;  5FEY A;  2G6Q A;  5DIN A;  1WES A;  1WGM A;  2FUI A;  3KV5 A;  2L5U A;  2L43 A;  1VYX A;  3RTR B;  1MM3 A;  5JG6 A;  3PUR A;  2JRJ A;  1RMD A;  4I7C A;  3DPL R;  2LV9 A;  3O37 A;  4MVT A;  3LQI A;  2D8S A;  2ECN A;  2IDA A;  4WZ0 A;  5KH9 A;  2VPB A;  4YBT A;  3ZVZ B;  2L75 A;  1WEM A;  2YT5 A;  4A4C A;  2ECV A;  2EA6 A;  4IC3 A;  2MA6 A;  1HYI A;  2VJE B;  2M85 A;  3HCT A;  3L1Z B;  4GNE A;  2LRI C;  1XWH A;  4LAD B;  4X3G A;  1K2F A;  3IHP A;  2YQL A;  4A4B A;  5AIT A;  3N9M A;  3LQJ A;  2L0B A;  5H1T A;  5AIU A;  1WFK A;  3N9O A;  2MA5 A;  2NAA A;  3GV4 A;  2H0D A;  2YW8 A;  4AYC B;  4FK5 A;  3HCU A;  5G05 B;  5H1U A;  2I50 A;  3U5N A;  2QIZ A;  4QF2 A;  3SHB A;  2CKL B;  4FIP A;  4P5O B;  2EOD A;  2KR4 A;  3T6R A;  3O7A A;  2FUU A;  2QIC A;  4B86 C;  4YAT A;  3U5P A;  2RSD A;  3LQH A;  1WIL A;  5TRB A;  3C6W A;  2RI7 A;  4YC9 A;  2KYU A;  3O35 A;  5LCW B;  4I7B A;  2YUC A;  4WZ2 A;  2G45 A;  5D1K B;  3EB5 A;  4AP4 A;  3M99 A;  4ZQL A;  1X4I A;  2KFT A;  2LGK A;  3GL6 A;  3PUQ A;  3KQI A;  2LXH C;  2K17 A;  4FJC A;  5B78 A;  5LKZ A;  4L7X A;  2MD7 B;  2KE1 A;  2YUR A;  5C11 A;  4B7Y C;  5D1M B;  4Q6F A;  2VJE A;  2LGV A;  1LDJ B;  3N9P A;  1FP0 A;  1WEV A;  3L1X A;  3L11 A;  2ECW A;  1WE9 A;  5B76 A;  2M3H A;  2F6N A;  2MNZ A;  2XEU A;  4C9Z A;  5TDW A;  4GB0 A;  4W4U A;  3QZV A;  2OXQ C;  2K1J A;  4YAD A;  2Y43 A;  5B77 A;  2M1R A;  3T7L A;  2CKL A;  5C13 A;  5LKU A;  4GNF A;  4ZDT A;  4N4F A;  4BHW A;  3MHS A;  4LLB A;  5G04 B;  4YBM A;  2YQM A;  2M6M A;  2UZG A;  4WZ3 B;  1WEO A;  2PUY A;  1FBV A;  2QJ0 A;  5H1V A;  3VK6 A;  4F52 B;  2E6S A;  3U5O A;  2YSJ A;  1Z60 A;  1MM2 A;  2KGG A;  5J3X A;  2LGG A;  3KNV A;  3O33 A;  1JM7 B;  1LDK C;  2KIZ A;  3EB6 A;  2CSZ A;  4YAX A;  1VFY A;  4S3O C;  4AVX A;  3SOW A;  5KH3 A;  4UP5 A;  2MIQ A;  4O64 A;  3O34 A;  2VJF A;  4N3W A;  3O36 A;  3C5K A;  2KRE A;  2KWN A;  1VD4 A;  3NG2 A;  2VPE A;  1WEQ A;  2CSY A;  4I7D A;  5H9M A;  2KGI A;  5FB1 A;  3M63 A;  5TBN A;  3LRQ A;  2K16 A;  1CHC A;  1X4U A;  2PNX A;  4S3O B;  2KWJ A;  4R7E A;  3FL2 A;  4MSX A;  3ZTG A;  5FER A;  5B75 A;  5TAB A;  2G43 A;  5KH7 A;  1N87 A;  1V87 A;  3N9N A;  1X4J A;  2HYE D;  4NN2 A;  2ECG A;  5LKX A;  3SOX A;  1DVP A;  1WEE A;  2YU4 A;  4BBQ A;  3N9L A;  2C2L A;  1Z6U A;  2KWK A;  4R2Y A;  1WEN A;  2LDR A;  3I2D A;  5LKT A;  3SOU A;  4YBS A;  4R8P K;  2FSA A;  1JM7 A;  4AYC A;  2XB1 A;  4CCG X;  2YHN A;  2VPD A;  2ECT A;  2JMI A;  2YSM A;  5I3L A;  2YRE A;  3M62 A;  3O70 A;  4V3L C;  3RPG C;  2K4D A;  2HDP A;  1JOC A;  5FB0 A;  1F62 A;  4UI9 B;  2MNY A;  2VPG A;  3ASL A;  5DKA A;  2F6J A;  3HCS A;  3ZPV 1;  3PHD A;  5B79 A;  4QF3 A;  2MUM A;  1WEU A;  4YAB A;  1T1H A;  2LN0 A;  1WEP A;  2Y1M A; 
#chains in the Genus database with same CATH topology
 3ZNI A;  2MT5 A;  2Y1N A;  4GNG A;  2CON A;  4Z0O A;  3RPG B;  4ZUX U;  1E4U A;  2LXP C;  2CSV A;  1G25 A;  2YYR A;  2VNF A;  3ZYQ A;  5TDR A;  4CA1 A;  3ZPV E;  2C2V S;  2MD8 C;  4F1P A;  3MHH A;  4H9D A;  4A0C D;  4LKA A;  2LGL A;  2E6R A;  2ECJ A;  1BOR A;  4WA6 A;  4UP0 A;  3N9Q A;  2ECI A;  2EGM A;  4LJN A;  3U5M A;  2DX8 A;  3FAO A;  2JMJ A;  5G0F A;  1Z2Q A;  3M7K A;  2ZET C;  4IC2 A;  3HTK C;  2BAY A;  5EYA F;  2KU3 A;  2VP7 A;  5SVI B;  1WIM A;  4L58 A;  2CT2 A;  3V43 A;  4O62 A;  3DWD A;  2AN6 A;  2H0D B;  2LQ6 A;  4PTB A;  2F42 A;  1U6G B;  3KDE C;  4LK9 A;  1WEW A;  5B8D A;  3KV6 A;  5SVY A;  1ZBD B;  4XI1 A;  2P57 A;  2EGP A;  4V3K C;  4GND A;  4FO9 A;  3DQV R;  4TKP B;  2L80 A;  1HYJ A;  4A49 A;  3ZVY A;  2YHO A;  2VJF B;  2JMD A;  3PLW A;  3JUE A;  2L7P A;  2KWO A;  5D1L B;  4AUQ B;  1IYM A;  4PPE A;  5FEY A;  2G6Q A;  5DIN A;  1WES A;  1WGM A;  2FUI A;  3KV5 A;  2L5U A;  2L43 A;  1VYX A;  3RTR B;  1MM3 A;  5JG6 A;  3LVR E;  3PUR A;  2JRJ A;  1RMD A;  4I7C A;  4MVT A;  3DPL R;  2LV9 A;  3O37 A;  2DJA A;  2D8S A;  2ECN A;  2IDA A;  2YVR A;  3LQI A;  4WZ0 A;  5KH9 A;  2VPB A;  4YBT A;  3ZVZ B;  2L75 A;  1WEM A;  2YT5 A;  4A4C A;  2ECV A;  2EA6 A;  4IC3 A;  2MA6 A;  1HYI A;  2VJE B;  2M85 A;  3HCT A;  3L1Z B;  3FEH A;  4GNE A;  2LRI C;  1XWH A;  4LAD B;  5K3Q A;  4X3G A;  1K2F A;  3IHP A;  2JM3 A;  2YQL A;  4A4B A;  5AIT A;  3N9M A;  3LQJ A;  2L0B A;  5H1T A;  5AIU A;  1WFK A;  3N9O A;  2MA5 A;  2NAA A;  3GV4 A;  2H0D A;  2YW8 A;  3FAN A;  4AYC B;  4FK5 A;  3HCU A;  5G05 B;  1MBM A;  2I50 A;  3FM8 C;  5H1U A;  3U5N A;  2QIZ A;  2XOY A;  4QF2 A;  3SHB A;  2CKL B;  4FIP A;  4P5O B;  2EOD A;  2KR4 A;  3T6R A;  2CRR A;  3O7A A;  2FUU A;  2M13 A;  2QIC A;  4B86 C;  4YAT A;  2CRW A;  2RSD A;  3U5P A;  2FFW A;  3LQH A;  3LJU X;  1WIL A;  5TRB A;  3C6W A;  2RI7 A;  4YC9 A;  2KYU A;  3O35 A;  5LCW B;  4I7B A;  2YUC A;  4WZ2 A;  2G45 A;  5D1K B;  2XOC A;  3EB5 A;  4AP4 A;  3M99 A;  4ZQL A;  3T9K A;  1X4I A;  2KFT A;  2LGK A;  3GL6 A;  3PUQ A;  5SVX A;  3KQI A;  2LXH C;  2K17 A;  3LDY A;  4FJC A;  5B78 A;  5LKZ A;  4L7X A;  2MD7 B;  2KE1 A;  1DCQ A;  2YUR A;  2JUN A;  4B7Y C;  5C11 A;  5D1M B;  4Q6F A;  2VJE A;  2LGV A;  2KKX A;  1LDJ B;  3N9P A;  1FP0 A;  1WEV A;  3L1X A;  3L11 A;  2ECW A;  1WE9 A;  5B76 A;  2M3H A;  2RR4 A;  2F6N A;  2MNZ A;  4OGE A;  2XEU A;  4C9Z A;  5TDW A;  4GB0 A;  4W4U A;  3QZV A;  2OXQ C;  3SUB A;  2K1J A;  4YAD A;  2XP0 A;  2Y43 A;  5B77 A;  2EXU A;  2M1R A;  3T7L A;  2CKL A;  5C13 A;  5LKU A;  4GNF A;  4ZDT A;  4N4F A;  4BHW A;  3MHS A;  4LLB A;  3E2D A;  5G04 B;  4YBM A;  2YQM A;  5SVI A;  2M6M A;  2UZG A;  4WZ3 B;  2B0O E;  1WEO A;  2KKY A;  2PUY A;  1FBV A;  2QJ0 A;  5H1V A;  3VK6 A;  4F52 B;  2E6S A;  3U5O A;  2YSJ A;  1Z60 A;  1MM2 A;  2KGG A;  2DSM A;  3LVQ E;  5J3X A;  2LGG A;  2LAU A;  3KNV A;  3O33 A;  1JM7 B;  1LDK C;  2KIZ A;  3EB6 A;  3DDT A;  2CSZ A;  3H7H A;  4YAX A;  1VFY A;  4S3O C;  3MDB C;  4AVX A;  3SOW A;  5KH3 A;  2XOZ A;  4UP5 A;  2MIQ A;  4O64 A;  3O34 A;  2D8U A;  2VJF A;  4N3W A;  3O36 A;  3C5K A;  2KRE A;  2KWN A;  1VD4 A;  3NG2 A;  4OGC A;  2VPE A;  1WEQ A;  2CSY A;  4I7D A;  5H9M A;  2KGI A;  5FB1 A;  4Z0R A;  3M63 A;  5TBN A;  3LRQ A;  2K16 A;  1CHC A;  1X4U A;  2PNX A;  4S3O B;  2KWJ A;  4R7E A;  3FL2 A;  4MSX A;  3ZTG A;  5FER A;  5B75 A;  5TAB A;  2G43 A;  5KH7 A;  1N87 A;  1V87 A;  2OWA A;  3N9N A;  1X4J A;  2HYE D;  4NN2 A;  2ECG A;  5LKX A;  3SOX A;  1DVP A;  1WEE A;  2YU4 A;  4BBQ A;  3N9L A;  2C2L A;  3O47 A;  1Z6U A;  2KWK A;  4R2Y A;  1WEN A;  2LDR A;  3I2D A;  5LKT A;  3SOU A;  4YBS A;  4R8P K;  2FSA A;  1JM7 A;  4AYC A;  2XB1 A;  3Q1D A;  4CCG X;  4QQ4 A;  2YHN A;  2VPD A;  2ECT A;  2JMI A;  2YSM A;  5I3L A;  2MKE A;  2YRE A;  3M62 A;  3O70 A;  4V3L C;  2E61 A;  3RPG C;  2FD4 A;  2K4D A;  2HDP A;  2IQJ A;  1JOC A;  5FB0 A;  1F62 A;  4UI9 B;  3FJU B;  2MNY A;  2VPG A;  3ASL A;  5DKA A;  2F6J A;  3HCS A;  3ZPV 1;  3PHD A;  5B79 A;  4QF3 A;  2MUM A;  1WEU A;  4YAB A;  1T1H A;  2LN0 A;  1WEP A;  2Y1M A; 
#chains in the Genus database with same CATH homology
 3ZNI A;  2MT5 A;  2Y1N A;  4GNG A;  3RPG B;  4ZUX U;  1E4U A;  2LXP C;  1G25 A;  2YYR A;  2VNF A;  3ZYQ A;  5TDR A;  4CA1 A;  3ZPV E;  2C2V S;  2MD8 C;  3MHH A;  4A0C D;  4LKA A;  2LGL A;  2E6R A;  2ECJ A;  1BOR A;  4WA6 A;  4UP0 A;  3N9Q A;  2ECI A;  4LJN A;  3U5M A;  2DX8 A;  2JMJ A;  5G0F A;  1Z2Q A;  2ZET C;  4IC2 A;  3HTK C;  2BAY A;  5EYA F;  2KU3 A;  2VP7 A;  1WIM A;  4L58 A;  2CT2 A;  3V43 A;  2AN6 A;  2H0D B;  2LQ6 A;  4PTB A;  2F42 A;  1U6G B;  4LK9 A;  1WEW A;  5B8D A;  3KV6 A;  1ZBD B;  4XI1 A;  2EGP A;  4V3K C;  4GND A;  4FO9 A;  3DQV R;  4TKP B;  2L80 A;  1HYJ A;  4A49 A;  3ZVY A;  2YHO A;  2VJF B;  2JMD A;  2KWO A;  5D1L B;  4AUQ B;  1IYM A;  4PPE A;  5FEY A;  2G6Q A;  5DIN A;  1WES A;  1WGM A;  2FUI A;  3KV5 A;  2L5U A;  2L43 A;  1VYX A;  3RTR B;  1MM3 A;  5JG6 A;  3PUR A;  2JRJ A;  1RMD A;  4I7C A;  3DPL R;  2LV9 A;  3O37 A;  4MVT A;  3LQI A;  2D8S A;  2ECN A;  2IDA A;  4WZ0 A;  5KH9 A;  2VPB A;  4YBT A;  3ZVZ B;  2L75 A;  1WEM A;  2YT5 A;  4A4C A;  2ECV A;  2EA6 A;  4IC3 A;  2MA6 A;  1HYI A;  2VJE B;  2M85 A;  3HCT A;  3L1Z B;  4GNE A;  2LRI C;  1XWH A;  4LAD B;  4X3G A;  1K2F A;  3IHP A;  2YQL A;  4A4B A;  5AIT A;  3N9M A;  3LQJ A;  2L0B A;  5H1T A;  5AIU A;  1WFK A;  3N9O A;  2MA5 A;  2NAA A;  3GV4 A;  2H0D A;  2YW8 A;  4AYC B;  4FK5 A;  3HCU A;  5G05 B;  5H1U A;  2I50 A;  3U5N A;  2QIZ A;  4QF2 A;  3SHB A;  2CKL B;  4FIP A;  4P5O B;  2EOD A;  2KR4 A;  3T6R A;  3O7A A;  2FUU A;  2QIC A;  4B86 C;  4YAT A;  3U5P A;  2RSD A;  3LQH A;  1WIL A;  5TRB A;  3C6W A;  2RI7 A;  4YC9 A;  2KYU A;  3O35 A;  5LCW B;  4I7B A;  2YUC A;  4WZ2 A;  2G45 A;  5D1K B;  3EB5 A;  4AP4 A;  3M99 A;  4ZQL A;  1X4I A;  2KFT A;  2LGK A;  3GL6 A;  3PUQ A;  3KQI A;  2LXH C;  2K17 A;  4FJC A;  5B78 A;  5LKZ A;  4L7X A;  2MD7 B;  2KE1 A;  2YUR A;  5C11 A;  4B7Y C;  5D1M B;  4Q6F A;  2VJE A;  2LGV A;  1LDJ B;  3N9P A;  1FP0 A;  1WEV A;  3L1X A;  3L11 A;  2ECW A;  1WE9 A;  5B76 A;  2M3H A;  2F6N A;  2MNZ A;  2XEU A;  4C9Z A;  5TDW A;  4GB0 A;  4W4U A;  3QZV A;  2OXQ C;  2K1J A;  4YAD A;  2Y43 A;  5B77 A;  2M1R A;  3T7L A;  2CKL A;  5C13 A;  5LKU A;  4GNF A;  4ZDT A;  4N4F A;  4BHW A;  3MHS A;  4LLB A;  5G04 B;  4YBM A;  2YQM A;  2M6M A;  2UZG A;  4WZ3 B;  1WEO A;  2PUY A;  1FBV A;  2QJ0 A;  5H1V A;  3VK6 A;  4F52 B;  2E6S A;  3U5O A;  2YSJ A;  1Z60 A;  1MM2 A;  2KGG A;  5J3X A;  2LGG A;  3KNV A;  3O33 A;  1JM7 B;  1LDK C;  2KIZ A;  3EB6 A;  2CSZ A;  4YAX A;  1VFY A;  4S3O C;  4AVX A;  3SOW A;  5KH3 A;  4UP5 A;  2MIQ A;  4O64 A;  3O34 A;  2VJF A;  4N3W A;  3O36 A;  3C5K A;  2KRE A;  2KWN A;  1VD4 A;  3NG2 A;  2VPE A;  1WEQ A;  2CSY A;  4I7D A;  5H9M A;  2KGI A;  5FB1 A;  3M63 A;  5TBN A;  3LRQ A;  2K16 A;  1CHC A;  1X4U A;  2PNX A;  4S3O B;  2KWJ A;  4R7E A;  3FL2 A;  4MSX A;  3ZTG A;  5FER A;  5B75 A;  5TAB A;  2G43 A;  5KH7 A;  1N87 A;  1V87 A;  3N9N A;  1X4J A;  2HYE D;  4NN2 A;  2ECG A;  5LKX A;  3SOX A;  1DVP A;  1WEE A;  2YU4 A;  4BBQ A;  3N9L A;  2C2L A;  1Z6U A;  2KWK A;  4R2Y A;  1WEN A;  2LDR A;  3I2D A;  5LKT A;  3SOU A;  4YBS A;  4R8P K;  2FSA A;  1JM7 A;  4AYC A;  2XB1 A;  4CCG X;  2YHN A;  2VPD A;  2ECT A;  2JMI A;  2YSM A;  5I3L A;  2YRE A;  3M62 A;  3O70 A;  4V3L C;  3RPG C;  2K4D A;  2HDP A;  1JOC A;  5FB0 A;  1F62 A;  4UI9 B;  2MNY A;  2VPG A;  3ASL A;  5DKA A;  2F6J A;  3HCS A;  3ZPV 1;  3PHD A;  5B79 A;  4QF3 A;  2MUM A;  1WEU A;  4YAB A;  1T1H A;  2LN0 A;  1WEP A;  2Y1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...