4S3OB

Pcgf5-ring1b-ubch5c complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
105
Chain Sequence
TQPLSKTWELSLYELQRTPQEAITDLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSNKECPTCRKKLVSKRSLRPDPNFDALISKIYPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 D3
publication title BMI1-RING1B is an autoinhibited RING E3 ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/transcription
total genus 26
structure length 105
sequence length 107
chains with identical sequence E
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4s3oB01
3HCSA 2FUUA 2K17A 2YUCA 4PPEA 1BORA 2F6NA 5TRBA 3U5OA 2LV9A 2YHOA 2XB1A 3L11A 2ECIA 2LGLA 2VJEB 5B8DA 4BBQA 3HCTA 2C2VS 1N87A 2LQ6A 4FO9A 1MM3A 3C5KA 2C2LA 4AP4A 4LADB 4WZ2A 1VD4A 1WE9A 4LKAA 2MUMA 5FB0A 4WZ0A 4R2YA 2CSZA 2VJEA 1LDKC 4S3OC 1G25A 2I50A 2RI7A 2JMJA 5LKUA 2L5UA 3O70A 4ZQLA 2KWNA 5B75A 2KREA 2F42A 3NG2A 2M3HA 4YC9A 4P5OB 2PUYA 2EGPA 3O34A 4O64A 5TBNA 1LDJB 3GL6A 4X3GA 3ZPV1 1WILA 2E6SA 2VJFB 4F52B 3ZNIA 5TDRA 2G6QA 4L58A 5D1MB 1IYMA 5KH7A 5KH3A 2CKLB 4L7XA 2EODA 3KNVA 2G45A 2L0BA 2MIQA 3LQJA 2JMIA 4N3WA 3LQIA 2LXPC 3ZVYA 1WEWA 5H1UA 4CCGX 3RPGB 1X4IA 4FK5A 5I3LA 2VJFA 3PHDA 1XWHA 4WZ3B 2NAAA 2KYUA 2LGKA 4I7BA 5J3XA 3IHPA 5B77A 2KWJA 3N9LA 1VFYA 2CKLA 3M62A 3M63A 2L75A 4YATA 2ECNA 3ZVZB 3EB5A 3SHBA 4IC3A 4YAXA 5TABA 1WEQA 3U5MA 3RTRB 2BAYA 2ZETC 1WEPA 2Y1MA 2LRIC 5LCWB 3KV5A 4AYCB 2YHNA 4UI9B 2QIZA 2FSAA 4GNEA 1HYIA 2IDAA 5LKTA 1DVPA 2VPBA 3ASLA 3RPGC 5EYAF 2FUIA 5D1KB 3O36A 2M85A 4AYCA 3O37A 1RMDA 1WENA 1MM2A 5D1LB 4LK9A 3ZPVE 2YQMA 4YABA 3HTKC 4W4UA 4UP5A 2YSMA 2YT5A 2VPGA 1Z60A 4I7CA 5FB1A 2L80A 2YQLA 2LGGA 2MA6A 1Z6UA 1WESA 3L1XA 2YU4A 1WIMA 1E4UA 2VPDA 1WEEA 1WEUA 3SOWA 4NN2A 3M99A 2CT2A 5DKAA 1Z2QA 2VNFA 3I2DA 5DINA 3N9PA 4ZDTA 3U5NA 2KU3A 2KWKA 4B7YC 3O35A 2M6MA 2KR4A 2G43A 1WFKA 2KIZA 2Y43A 5H9MA 2RSDA 2JMDA 3VK6A 5H1TA 4QF3A 2VPEA 5FERA 2OXQC 2H0DB 2XEUA 2K16A 4IC2A 4GNGA 5AITA 4Q6FA 4WA6A 3MHSA 4ZUXU 3L1ZB 2YURA 4A4BA 3N9MA 3FL2A 1FBVA 3MHHA 4YBTA 2QJ0A 3GV4A 4TKPB 2KFTA 3ZTGA 2LDRA 2QICA 3LQHA 2L43A 3V43A 5FEYA 2K1JA 2H0DA 2YYRA 5G0FA 5B78A 5B79A 4S3OB 1WEMA 4FJCA 3PUQA 4XI1A 4LJNA 3SOUA 1V87A 4YBMA 2M1RA 2KGIA 2MD7B 5LKXA 5G05B 4LLBA 4A49A 3LRQA 4YBSA 4B86C 3ZYQA 4UP0A 3QZVA 2MNYA 3O33A 2Y1NA 3T7LA 1WEVA 3KQIA 3HCUA 2KWOA 4AUQB 2ECTA 4R8PK 2KE1A 4A4CA 2E6RA 3SOXA 5B76A 4N4FA 2VP7A 2HYED 2AN6A 2EA6A 1X4JA 1K2FA 2YREA 4QF2A 2CSYA 4C9ZA 1FP0A 5C13A 3KV6A 3PURA 4V3LC 2PNXA 4BHWA 2DX8A 4CA1A 4GB0A 3N9QA 1JOCA 1WEOA 3C6WA 2D8SA 2JRJA 2MD8C 4MSXA 3DQVR 2ECGA 4MVTA 3DPLR 1F62A 2ECJA 4YADA 2ECVA 2KGGA 1WGMA 4V3KC 5AIUA 1ZBDB 1HYJA 4AVXA 1T1HA 2MNZA 1JM7B 5TDWA 1U6GB 5C11A 1CHCA 1VYXA 2MA5A 2LGVA 5JG6A 4PTBA 2K4DA 2YSJA 4GNFA 4FIPA 2MT5A 5LKZA 3T6RA 4GNDA 4A0CD 2ECWA 4I7DA 3N9NA 2HDPA 5H1VA 3U5PA 1JM7A 2F6JA 2YW8A 3EB6A 3O7AA 4R7EA 5KH9A 1X4UA 2UZGA 2LN0A 2LXHC 5G04B 3N9OA
chains in the Genus database with same CATH superfamily
3FAOA 3HCSA 2FUUA 2K17A 2YUCA 4PPEA 1BORA 2F6NA 4QQ4A 5TRBA 2XOYA 3U5OA 2LV9A 2YHOA 2XB1A 3L11A 2ECIA 2LGLA 2VJEB 5B8DA 4BBQA 2E61A 2XP0A 3HCTA 2C2VS 1N87A 2LQ6A 4FO9A 1MM3A 3C5KA 2C2LA 4AP4A 4LADB 3LDYA 4WZ2A 3O47A 1VD4A 1WE9A 4LKAA 2MUMA 5FB0A 4WZ0A 4R2YA 2CSZA 2VJEA 1LDKC 4OGCA 5K3QA 4S3OC 1G25A 2I50A 2RI7A 2JMJA 3SUBA 5LKUA 2L5UA 3O70A 4ZQLA 2KWNA 1DCQA 5B75A 2KREA 2F42A 3NG2A 2M3HA 4YC9A 3DDTA 3E2DA 2PUYA 4P5OB 2EGPA 4H9DA 3O34A 4O64A 5TBNA 3T9KA 1LDJB 3GL6A 4X3GA 3ZPV1 1WILA 2E6SA 2VJFB 4F52B 3ZNIA 5TDRA 2G6QA 4L58A 5D1MB 1IYMA 5KH7A 5KH3A 2KKYA 2CKLB 4F1PA 4L7XA 2EODA 3KNVA 2G45A 2L0BA 2MIQA 3LQJA 2JMIA 4N3WA 3LQIA 2IQJA 2LXPC 3ZVYA 1WEWA 5H1UA 4CCGX 3RPGB 1X4IA 4FK5A 5I3LA 2VJFA 3PHDA 1XWHA 4WZ3B 2NAAA 2KYUA 2LGKA 4I7BA 5J3XA 3IHPA 5B77A 2KWJA 3N9LA 1VFYA 2CKLA 3M62A 3M63A 2L75A 4YATA 2ECNA 3ZVZB 3EB5A 3SHBA 4IC3A 4YAXA 5TABA 1WEQA 3U5MA 3RTRB 2BAYA 2ZETC 1WEPA 2YVRA 2Y1MA 2LRIC 5LCWB 3KV5A 2B0OE 4AYCB 2YHNA 4UI9B 2QIZA 2FSAA 4GNEA 1HYIA 2IDAA 5LKTA 1DVPA 2VPBA 3ASLA 3RPGC 5EYAF 2FUIA 5D1KB 3O36A 2M85A 4AYCA 3O37A 1RMDA 1WENA 1MM2A 5D1LB 4LK9A 3ZPVE 2YQMA 4YABA 3HTKC 4W4UA 4UP5A 2YSMA 2YT5A 2M13A 3DWDA 2VPGA 1Z60A 4I7CA 5FB1A 2L80A 2YQLA 2LGGA 2MA6A 1Z6UA 1WESA 3L1XA 2YU4A 1WIMA 1E4UA 2VPDA 1WEEA 1WEUA 3SOWA 4NN2A 3M99A 2CT2A 5DKAA 1Z2QA 2VNFA 3I2DA 3FEHA 5DINA 3N9PA 4ZDTA 3U5NA 2KU3A 2KWKA 4B7YC 4Z0RA 3O35A 2M6MA 2KR4A 2G43A 1WFKA 2KIZA 2Y43A 5H9MA 2RSDA 2JMDA 3VK6A 5H1TA 4QF3A 2VPEA 3PLWA 5FERA 4O62A 2CONA 2OXQC 3Q1DA 2H0DB 2P57A 2XEUA 2OWAA 2K16A 4IC2A 1MBMA 2XOZA 4GNGA 2DJAA 5AITA 4Q6FA 4WA6A 3FJUB 3MHSA 4ZUXU 3L1ZB 2YURA 4A4BA 3N9MA 3FL2A 1FBVA 3MHHA 4YBTA 2QJ0A 2FD4A 3GV4A 5SVIA 4TKPB 3FM8C 2KFTA 2EXUA 3ZTGA 2LDRA 2QICA 3LQHA 2L43A 3V43A 5FEYA 2K1JA 2H0DA 2YYRA 2JM3A 5G0FA 5B78A 5B79A 4S3OB 1WEMA 4FJCA 3PUQA 4XI1A 4LJNA 3SOUA 1V87A 4YBMA 2M1RA 2KGIA 2MD7B 5LKXA 2CSVA 5G05B 3FANA 2FFWA 4LLBA 4A49A 2DSMA 3LRQA 4YBSA 4B86C 3ZYQA 4UP0A 3QZVA 2MNYA 3H7HA 3O33A 2Y1NA 2L7PA 3T7LA 1WEVA 3KQIA 3HCUA 2KWOA 4AUQB 2ECTA 4R8PK 2KE1A 4A4CA 2E6RA 3SOXA 5B76A 4N4FA 2VP7A 5SVXA 2CRWA 2HYED 2AN6A 2EA6A 5SVYA 1X4JA 1K2FA 2CRRA 2YREA 2MKEA 4QF2A 2CSYA 2LAUA 1FP0A 4C9ZA 5C13A 3KV6A 3PURA 4V3LC 2PNXA 4BHWA 2DX8A 4CA1A 4GB0A 3N9QA 1JOCA 1WEOA 3LVRE 3C6WA 2D8SA 2KKXA 2JRJA 4MSXA 2MD8C 3DQVR 2ECGA 4MVTA 4Z0OA 3DPLR 4OGEA 3M7KA 1F62A 2ECJA 4YADA 2ECVA 2KGGA 1WGMA 4V3KC 5AIUA 1ZBDB 1HYJA 4AVXA 1T1HA 2MNZA 1JM7B 5TDWA 1U6GB 5C11A 1CHCA 3JUEA 1VYXA 2MA5A 5SVIB 2LGVA 5JG6A 4PTBA 2K4DA 3LVQE 2YSJA 4GNFA 4FIPA 2D8UA 2MT5A 5LKZA 3T6RA 4GNDA 4A0CD 2ECWA 2XOCA 3N9NA 2HDPA 4I7DA 5H1VA 3U5PA 1JM7A 2F6JA 2YW8A 3EB6A 3O7AA 4R7EA 3KDEC 5KH9A 1X4UA 2UZGA 2RR4A 2LN0A 3MDBC 2LXHC 2EGMA 3LJUX 2JUNA 5G04B 3N9OA
chains in the Genus database with same CATH topology
3HCSA 2FUUA 2K17A 2YUCA 4PPEA 1BORA 2F6NA 5TRBA 3U5OA 2LV9A 2YHOA 2XB1A 3L11A 2ECIA 2LGLA 2VJEB 5B8DA 4BBQA 3HCTA 2C2VS 1N87A 2LQ6A 4FO9A 1MM3A 3C5KA 2C2LA 4AP4A 4LADB 4WZ2A 1VD4A 1WE9A 4LKAA 2MUMA 5FB0A 4WZ0A 4R2YA 2CSZA 2VJEA 1LDKC 4S3OC 1G25A 2I50A 2RI7A 2JMJA 5LKUA 2L5UA 3O70A 4ZQLA 2KWNA 5B75A 2KREA 2F42A 3NG2A 2M3HA 4YC9A 4P5OB 2PUYA 2EGPA 3O34A 4O64A 5TBNA 1LDJB 3GL6A 4X3GA 3ZPV1 1WILA 2E6SA 2VJFB 4F52B 3ZNIA 5TDRA 2G6QA 4L58A 5D1MB 1IYMA 5KH7A 5KH3A 2CKLB 4L7XA 2EODA 3KNVA 2G45A 2L0BA 2MIQA 3LQJA 2JMIA 4N3WA 3LQIA 2LXPC 3ZVYA 1WEWA 5H1UA 4CCGX 3RPGB 1X4IA 4FK5A 5I3LA 2VJFA 3PHDA 1XWHA 4WZ3B 2NAAA 2KYUA 2LGKA 4I7BA 5J3XA 3IHPA 5B77A 2KWJA 3N9LA 1VFYA 2CKLA 3M62A 3M63A 2L75A 4YATA 2ECNA 3ZVZB 3EB5A 3SHBA 4IC3A 4YAXA 5TABA 1WEQA 3U5MA 3RTRB 2BAYA 2ZETC 1WEPA 2Y1MA 2LRIC 5LCWB 3KV5A 4AYCB 2YHNA 4UI9B 2QIZA 2FSAA 4GNEA 1HYIA 2IDAA 5LKTA 1DVPA 2VPBA 3ASLA 3RPGC 5EYAF 2FUIA 5D1KB 3O36A 2M85A 4AYCA 3O37A 1RMDA 1WENA 1MM2A 5D1LB 4LK9A 3ZPVE 2YQMA 4YABA 3HTKC 4W4UA 4UP5A 2YSMA 2YT5A 2VPGA 1Z60A 4I7CA 5FB1A 2L80A 2YQLA 2LGGA 2MA6A 1Z6UA 1WESA 3L1XA 2YU4A 1WIMA 1E4UA 2VPDA 1WEEA 1WEUA 3SOWA 4NN2A 3M99A 2CT2A 5DKAA 1Z2QA 2VNFA 3I2DA 5DINA 3N9PA 4ZDTA 3U5NA 2KU3A 2KWKA 4B7YC 3O35A 2M6MA 2KR4A 2G43A 1WFKA 2KIZA 2Y43A 5H9MA 2RSDA 2JMDA 3VK6A 5H1TA 4QF3A 2VPEA 5FERA 2OXQC 2H0DB 2XEUA 2K16A 4IC2A 4GNGA 5AITA 4Q6FA 4WA6A 3MHSA 4ZUXU 3L1ZB 2YURA 4A4BA 3N9MA 3FL2A 1FBVA 3MHHA 4YBTA 2QJ0A 3GV4A 4TKPB 2KFTA 3ZTGA 2LDRA 2QICA 3LQHA 2L43A 3V43A 5FEYA 2K1JA 2H0DA 2YYRA 5G0FA 5B78A 5B79A 4S3OB 1WEMA 4FJCA 3PUQA 4XI1A 4LJNA 3SOUA 1V87A 4YBMA 2M1RA 2KGIA 2MD7B 5LKXA 5G05B 4LLBA 4A49A 3LRQA 4YBSA 4B86C 3ZYQA 4UP0A 3QZVA 2MNYA 3O33A 2Y1NA 3T7LA 1WEVA 3KQIA 3HCUA 2KWOA 4AUQB 2ECTA 4R8PK 2KE1A 4A4CA 2E6RA 3SOXA 5B76A 4N4FA 2VP7A 2HYED 2AN6A 2EA6A 1X4JA 1K2FA 2YREA 4QF2A 2CSYA 4C9ZA 1FP0A 5C13A 3KV6A 3PURA 4V3LC 2PNXA 4BHWA 2DX8A 4CA1A 4GB0A 3N9QA 1JOCA 1WEOA 3C6WA 2D8SA 2JRJA 2MD8C 4MSXA 3DQVR 2ECGA 4MVTA 3DPLR 1F62A 2ECJA 4YADA 2ECVA 2KGGA 1WGMA 4V3KC 5AIUA 1ZBDB 1HYJA 4AVXA 1T1HA 2MNZA 1JM7B 5TDWA 1U6GB 5C11A 1CHCA 1VYXA 2MA5A 2LGVA 5JG6A 4PTBA 2K4DA 2YSJA 4GNFA 4FIPA 2MT5A 5LKZA 3T6RA 4GNDA 4A0CD 2ECWA 4I7DA 3N9NA 2HDPA 5H1VA 3U5PA 1JM7A 2F6JA 2YW8A 3EB6A 3O7AA 4R7EA 5KH9A 1X4UA 2UZGA 2LN0A 2LXHC 5G04B 3N9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCS A;  2FUU A;  2K17 A;  2YUC A;  4PPE A;  1BOR A;  2F6N A;  5TRB A;  3U5O A;  2LV9 A;  2YHO A;  2XB1 A;  3L11 A;  2ECI A;  2LGL A;  2VJE B;  5B8D A;  4BBQ A;  3HCT A;  2C2V S;  1N87 A;  2LQ6 A;  4FO9 A;  1MM3 A;  3C5K A;  2C2L A;  4AP4 A;  4LAD B;  4WZ2 A;  1VD4 A;  1WE9 A;  4LKA A;  2MUM A;  5FB0 A;  4WZ0 A;  4R2Y A;  2CSZ A;  2VJE A;  1LDK C;  4S3O C;  1G25 A;  2I50 A;  2RI7 A;  2JMJ A;  5LKU A;  2L5U A;  3O70 A;  4ZQL A;  2KWN A;  5B75 A;  2KRE A;  2F42 A;  3NG2 A;  2M3H A;  4YC9 A;  4P5O B;  2PUY A;  2EGP A;  3O34 A;  4O64 A;  5TBN A;  1LDJ B;  3GL6 A;  4X3G A;  3ZPV 1;  1WIL A;  2E6S A;  2VJF B;  4F52 B;  3ZNI A;  5TDR A;  2G6Q A;  4L58 A;  5D1M B;  1IYM A;  5KH7 A;  5KH3 A;  2CKL B;  4L7X A;  2EOD A;  3KNV A;  2G45 A;  2L0B A;  2MIQ A;  3LQJ A;  2JMI A;  4N3W A;  3LQI A;  2LXP C;  3ZVY A;  1WEW A;  5H1U A;  4CCG X;  3RPG B;  1X4I A;  4FK5 A;  5I3L A;  2VJF A;  3PHD A;  1XWH A;  4WZ3 B;  2NAA A;  2KYU A;  2LGK A;  4I7B A;  5J3X A;  3IHP A;  5B77 A;  2KWJ A;  3N9L A;  1VFY A;  2CKL A;  3M62 A;  3M63 A;  2L75 A;  4YAT A;  2ECN A;  3ZVZ B;  3EB5 A;  3SHB A;  4IC3 A;  4YAX A;  5TAB A;  1WEQ A;  3U5M A;  3RTR B;  2BAY A;  2ZET C;  1WEP A;  2Y1M A;  2LRI C;  5LCW B;  3KV5 A;  4AYC B;  2YHN A;  4UI9 B;  2QIZ A;  2FSA A;  4GNE A;  1HYI A;  2IDA A;  5LKT A;  1DVP A;  2VPB A;  3ASL A;  3RPG C;  5EYA F;  2FUI A;  5D1K B;  3O36 A;  2M85 A;  4AYC A;  3O37 A;  1RMD A;  1WEN A;  1MM2 A;  5D1L B;  4LK9 A;  3ZPV E;  2YQM A;  4YAB A;  3HTK C;  4W4U A;  4UP5 A;  2YSM A;  2YT5 A;  2VPG A;  1Z60 A;  4I7C A;  5FB1 A;  2L80 A;  2YQL A;  2LGG A;  2MA6 A;  1Z6U A;  1WES A;  3L1X A;  2YU4 A;  1WIM A;  1E4U A;  2VPD A;  1WEE A;  1WEU A;  3SOW A;  4NN2 A;  3M99 A;  2CT2 A;  5DKA A;  1Z2Q A;  2VNF A;  3I2D A;  5DIN A;  3N9P A;  4ZDT A;  3U5N A;  2KU3 A;  2KWK A;  4B7Y C;  3O35 A;  2M6M A;  2KR4 A;  2G43 A;  1WFK A;  2KIZ A;  2Y43 A;  5H9M A;  2RSD A;  2JMD A;  3VK6 A;  5H1T A;  4QF3 A;  2VPE A;  5FER A;  2OXQ C;  2H0D B;  2XEU A;  2K16 A;  4IC2 A;  4GNG A;  5AIT A;  4Q6F A;  4WA6 A;  3MHS A;  4ZUX U;  3L1Z B;  2YUR A;  4A4B A;  3N9M A;  3FL2 A;  1FBV A;  3MHH A;  4YBT A;  2QJ0 A;  3GV4 A;  4TKP B;  2KFT A;  3ZTG A;  2LDR A;  2QIC A;  3LQH A;  2L43 A;  3V43 A;  5FEY A;  2K1J A;  2H0D A;  2YYR A;  5G0F A;  5B78 A;  5B79 A;  4S3O B;  1WEM A;  4FJC A;  3PUQ A;  4XI1 A;  4LJN A;  3SOU A;  1V87 A;  4YBM A;  2M1R A;  2KGI A;  2MD7 B;  5LKX A;  5G05 B;  4LLB A;  4A49 A;  3LRQ A;  4YBS A;  4B86 C;  3ZYQ A;  4UP0 A;  3QZV A;  2MNY A;  3O33 A;  2Y1N A;  3T7L A;  1WEV A;  3KQI A;  3HCU A;  2KWO A;  4AUQ B;  2ECT A;  4R8P K;  2KE1 A;  4A4C A;  2E6R A;  3SOX A;  5B76 A;  4N4F A;  2VP7 A;  2HYE D;  2AN6 A;  2EA6 A;  1X4J A;  1K2F A;  2YRE A;  4QF2 A;  2CSY A;  4C9Z A;  1FP0 A;  5C13 A;  3KV6 A;  3PUR A;  4V3L C;  2PNX A;  4BHW A;  2DX8 A;  4CA1 A;  4GB0 A;  3N9Q A;  1JOC A;  1WEO A;  3C6W A;  2D8S A;  2JRJ A;  2MD8 C;  4MSX A;  3DQV R;  2ECG A;  4MVT A;  3DPL R;  1F62 A;  2ECJ A;  4YAD A;  2ECV A;  2KGG A;  1WGM A;  4V3K C;  5AIU A;  1ZBD B;  1HYJ A;  4AVX A;  1T1H A;  2MNZ A;  1JM7 B;  5TDW A;  1U6G B;  5C11 A;  1CHC A;  1VYX A;  2MA5 A;  2LGV A;  5JG6 A;  4PTB A;  2K4D A;  2YSJ A;  4GNF A;  4FIP A;  2MT5 A;  5LKZ A;  3T6R A;  4GND A;  4A0C D;  2ECW A;  4I7D A;  3N9N A;  2HDP A;  5H1V A;  3U5P A;  1JM7 A;  2F6J A;  2YW8 A;  3EB6 A;  3O7A A;  4R7E A;  5KH9 A;  1X4U A;  2UZG A;  2LN0 A;  2LXH C;  5G04 B;  3N9O A; 
#chains in the Genus database with same CATH topology
 3FAO A;  3HCS A;  2FUU A;  2K17 A;  2YUC A;  4PPE A;  1BOR A;  2F6N A;  4QQ4 A;  5TRB A;  2XOY A;  3U5O A;  2LV9 A;  2YHO A;  2XB1 A;  3L11 A;  2ECI A;  2LGL A;  2VJE B;  5B8D A;  4BBQ A;  2E61 A;  2XP0 A;  3HCT A;  2C2V S;  1N87 A;  2LQ6 A;  4FO9 A;  1MM3 A;  3C5K A;  2C2L A;  4AP4 A;  4LAD B;  3LDY A;  4WZ2 A;  3O47 A;  1VD4 A;  1WE9 A;  4LKA A;  2MUM A;  5FB0 A;  4WZ0 A;  4R2Y A;  2CSZ A;  2VJE A;  1LDK C;  4OGC A;  5K3Q A;  4S3O C;  1G25 A;  2I50 A;  2RI7 A;  2JMJ A;  3SUB A;  5LKU A;  2L5U A;  3O70 A;  4ZQL A;  2KWN A;  1DCQ A;  5B75 A;  2KRE A;  2F42 A;  3NG2 A;  2M3H A;  4YC9 A;  3DDT A;  3E2D A;  2PUY A;  4P5O B;  2EGP A;  4H9D A;  3O34 A;  4O64 A;  5TBN A;  3T9K A;  1LDJ B;  3GL6 A;  4X3G A;  3ZPV 1;  1WIL A;  2E6S A;  2VJF B;  4F52 B;  3ZNI A;  5TDR A;  2G6Q A;  4L58 A;  5D1M B;  1IYM A;  5KH7 A;  5KH3 A;  2KKY A;  2CKL B;  4F1P A;  4L7X A;  2EOD A;  3KNV A;  2G45 A;  2L0B A;  2MIQ A;  3LQJ A;  2JMI A;  4N3W A;  3LQI A;  2IQJ A;  2LXP C;  3ZVY A;  1WEW A;  5H1U A;  4CCG X;  3RPG B;  1X4I A;  4FK5 A;  5I3L A;  2VJF A;  3PHD A;  1XWH A;  4WZ3 B;  2NAA A;  2KYU A;  2LGK A;  4I7B A;  5J3X A;  3IHP A;  5B77 A;  2KWJ A;  3N9L A;  1VFY A;  2CKL A;  3M62 A;  3M63 A;  2L75 A;  4YAT A;  2ECN A;  3ZVZ B;  3EB5 A;  3SHB A;  4IC3 A;  4YAX A;  5TAB A;  1WEQ A;  3U5M A;  3RTR B;  2BAY A;  2ZET C;  1WEP A;  2YVR A;  2Y1M A;  2LRI C;  5LCW B;  3KV5 A;  2B0O E;  4AYC B;  2YHN A;  4UI9 B;  2QIZ A;  2FSA A;  4GNE A;  1HYI A;  2IDA A;  5LKT A;  1DVP A;  2VPB A;  3ASL A;  3RPG C;  5EYA F;  2FUI A;  5D1K B;  3O36 A;  2M85 A;  4AYC A;  3O37 A;  1RMD A;  1WEN A;  1MM2 A;  5D1L B;  4LK9 A;  3ZPV E;  2YQM A;  4YAB A;  3HTK C;  4W4U A;  4UP5 A;  2YSM A;  2YT5 A;  2M13 A;  3DWD A;  2VPG A;  1Z60 A;  4I7C A;  5FB1 A;  2L80 A;  2YQL A;  2LGG A;  2MA6 A;  1Z6U A;  1WES A;  3L1X A;  2YU4 A;  1WIM A;  1E4U A;  2VPD A;  1WEE A;  1WEU A;  3SOW A;  4NN2 A;  3M99 A;  2CT2 A;  5DKA A;  1Z2Q A;  2VNF A;  3I2D A;  3FEH A;  5DIN A;  3N9P A;  4ZDT A;  3U5N A;  2KU3 A;  2KWK A;  4B7Y C;  4Z0R A;  3O35 A;  2M6M A;  2KR4 A;  2G43 A;  1WFK A;  2KIZ A;  2Y43 A;  5H9M A;  2RSD A;  2JMD A;  3VK6 A;  5H1T A;  4QF3 A;  2VPE A;  3PLW A;  5FER A;  4O62 A;  2CON A;  2OXQ C;  3Q1D A;  2H0D B;  2P57 A;  2XEU A;  2OWA A;  2K16 A;  4IC2 A;  1MBM A;  2XOZ A;  4GNG A;  2DJA A;  5AIT A;  4Q6F A;  4WA6 A;  3FJU B;  3MHS A;  4ZUX U;  3L1Z B;  2YUR A;  4A4B A;  3N9M A;  3FL2 A;  1FBV A;  3MHH A;  4YBT A;  2QJ0 A;  2FD4 A;  3GV4 A;  5SVI A;  4TKP B;  3FM8 C;  2KFT A;  2EXU A;  3ZTG A;  2LDR A;  2QIC A;  3LQH A;  2L43 A;  3V43 A;  5FEY A;  2K1J A;  2H0D A;  2YYR A;  2JM3 A;  5G0F A;  5B78 A;  5B79 A;  4S3O B;  1WEM A;  4FJC A;  3PUQ A;  4XI1 A;  4LJN A;  3SOU A;  1V87 A;  4YBM A;  2M1R A;  2KGI A;  2MD7 B;  5LKX A;  2CSV A;  5G05 B;  3FAN A;  2FFW A;  4LLB A;  4A49 A;  2DSM A;  3LRQ A;  4YBS A;  4B86 C;  3ZYQ A;  4UP0 A;  3QZV A;  2MNY A;  3H7H A;  3O33 A;  2Y1N A;  2L7P A;  3T7L A;  1WEV A;  3KQI A;  3HCU A;  2KWO A;  4AUQ B;  2ECT A;  4R8P K;  2KE1 A;  4A4C A;  2E6R A;  3SOX A;  5B76 A;  4N4F A;  2VP7 A;  5SVX A;  2CRW A;  2HYE D;  2AN6 A;  2EA6 A;  5SVY A;  1X4J A;  1K2F A;  2CRR A;  2YRE A;  2MKE A;  4QF2 A;  2CSY A;  2LAU A;  1FP0 A;  4C9Z A;  5C13 A;  3KV6 A;  3PUR A;  4V3L C;  2PNX A;  4BHW A;  2DX8 A;  4CA1 A;  4GB0 A;  3N9Q A;  1JOC A;  1WEO A;  3LVR E;  3C6W A;  2D8S A;  2KKX A;  2JRJ A;  4MSX A;  2MD8 C;  3DQV R;  2ECG A;  4MVT A;  4Z0O A;  3DPL R;  4OGE A;  3M7K A;  1F62 A;  2ECJ A;  4YAD A;  2ECV A;  2KGG A;  1WGM A;  4V3K C;  5AIU A;  1ZBD B;  1HYJ A;  4AVX A;  1T1H A;  2MNZ A;  1JM7 B;  5TDW A;  1U6G B;  5C11 A;  1CHC A;  3JUE A;  1VYX A;  2MA5 A;  5SVI B;  2LGV A;  5JG6 A;  4PTB A;  2K4D A;  3LVQ E;  2YSJ A;  4GNF A;  4FIP A;  2D8U A;  2MT5 A;  5LKZ A;  3T6R A;  4GND A;  4A0C D;  2ECW A;  2XOC A;  3N9N A;  2HDP A;  4I7D A;  5H1V A;  3U5P A;  1JM7 A;  2F6J A;  2YW8 A;  3EB6 A;  3O7A A;  4R7E A;  3KDE C;  5KH9 A;  1X4U A;  2UZG A;  2RR4 A;  2LN0 A;  3MDB C;  2LXH C;  2EGM A;  3LJU X;  2JUN A;  5G04 B;  3N9O A; 
#chains in the Genus database with same CATH homology
 3HCS A;  2FUU A;  2K17 A;  2YUC A;  4PPE A;  1BOR A;  2F6N A;  5TRB A;  3U5O A;  2LV9 A;  2YHO A;  2XB1 A;  3L11 A;  2ECI A;  2LGL A;  2VJE B;  5B8D A;  4BBQ A;  3HCT A;  2C2V S;  1N87 A;  2LQ6 A;  4FO9 A;  1MM3 A;  3C5K A;  2C2L A;  4AP4 A;  4LAD B;  4WZ2 A;  1VD4 A;  1WE9 A;  4LKA A;  2MUM A;  5FB0 A;  4WZ0 A;  4R2Y A;  2CSZ A;  2VJE A;  1LDK C;  4S3O C;  1G25 A;  2I50 A;  2RI7 A;  2JMJ A;  5LKU A;  2L5U A;  3O70 A;  4ZQL A;  2KWN A;  5B75 A;  2KRE A;  2F42 A;  3NG2 A;  2M3H A;  4YC9 A;  4P5O B;  2PUY A;  2EGP A;  3O34 A;  4O64 A;  5TBN A;  1LDJ B;  3GL6 A;  4X3G A;  3ZPV 1;  1WIL A;  2E6S A;  2VJF B;  4F52 B;  3ZNI A;  5TDR A;  2G6Q A;  4L58 A;  5D1M B;  1IYM A;  5KH7 A;  5KH3 A;  2CKL B;  4L7X A;  2EOD A;  3KNV A;  2G45 A;  2L0B A;  2MIQ A;  3LQJ A;  2JMI A;  4N3W A;  3LQI A;  2LXP C;  3ZVY A;  1WEW A;  5H1U A;  4CCG X;  3RPG B;  1X4I A;  4FK5 A;  5I3L A;  2VJF A;  3PHD A;  1XWH A;  4WZ3 B;  2NAA A;  2KYU A;  2LGK A;  4I7B A;  5J3X A;  3IHP A;  5B77 A;  2KWJ A;  3N9L A;  1VFY A;  2CKL A;  3M62 A;  3M63 A;  2L75 A;  4YAT A;  2ECN A;  3ZVZ B;  3EB5 A;  3SHB A;  4IC3 A;  4YAX A;  5TAB A;  1WEQ A;  3U5M A;  3RTR B;  2BAY A;  2ZET C;  1WEP A;  2Y1M A;  2LRI C;  5LCW B;  3KV5 A;  4AYC B;  2YHN A;  4UI9 B;  2QIZ A;  2FSA A;  4GNE A;  1HYI A;  2IDA A;  5LKT A;  1DVP A;  2VPB A;  3ASL A;  3RPG C;  5EYA F;  2FUI A;  5D1K B;  3O36 A;  2M85 A;  4AYC A;  3O37 A;  1RMD A;  1WEN A;  1MM2 A;  5D1L B;  4LK9 A;  3ZPV E;  2YQM A;  4YAB A;  3HTK C;  4W4U A;  4UP5 A;  2YSM A;  2YT5 A;  2VPG A;  1Z60 A;  4I7C A;  5FB1 A;  2L80 A;  2YQL A;  2LGG A;  2MA6 A;  1Z6U A;  1WES A;  3L1X A;  2YU4 A;  1WIM A;  1E4U A;  2VPD A;  1WEE A;  1WEU A;  3SOW A;  4NN2 A;  3M99 A;  2CT2 A;  5DKA A;  1Z2Q A;  2VNF A;  3I2D A;  5DIN A;  3N9P A;  4ZDT A;  3U5N A;  2KU3 A;  2KWK A;  4B7Y C;  3O35 A;  2M6M A;  2KR4 A;  2G43 A;  1WFK A;  2KIZ A;  2Y43 A;  5H9M A;  2RSD A;  2JMD A;  3VK6 A;  5H1T A;  4QF3 A;  2VPE A;  5FER A;  2OXQ C;  2H0D B;  2XEU A;  2K16 A;  4IC2 A;  4GNG A;  5AIT A;  4Q6F A;  4WA6 A;  3MHS A;  4ZUX U;  3L1Z B;  2YUR A;  4A4B A;  3N9M A;  3FL2 A;  1FBV A;  3MHH A;  4YBT A;  2QJ0 A;  3GV4 A;  4TKP B;  2KFT A;  3ZTG A;  2LDR A;  2QIC A;  3LQH A;  2L43 A;  3V43 A;  5FEY A;  2K1J A;  2H0D A;  2YYR A;  5G0F A;  5B78 A;  5B79 A;  4S3O B;  1WEM A;  4FJC A;  3PUQ A;  4XI1 A;  4LJN A;  3SOU A;  1V87 A;  4YBM A;  2M1R A;  2KGI A;  2MD7 B;  5LKX A;  5G05 B;  4LLB A;  4A49 A;  3LRQ A;  4YBS A;  4B86 C;  3ZYQ A;  4UP0 A;  3QZV A;  2MNY A;  3O33 A;  2Y1N A;  3T7L A;  1WEV A;  3KQI A;  3HCU A;  2KWO A;  4AUQ B;  2ECT A;  4R8P K;  2KE1 A;  4A4C A;  2E6R A;  3SOX A;  5B76 A;  4N4F A;  2VP7 A;  2HYE D;  2AN6 A;  2EA6 A;  1X4J A;  1K2F A;  2YRE A;  4QF2 A;  2CSY A;  4C9Z A;  1FP0 A;  5C13 A;  3KV6 A;  3PUR A;  4V3L C;  2PNX A;  4BHW A;  2DX8 A;  4CA1 A;  4GB0 A;  3N9Q A;  1JOC A;  1WEO A;  3C6W A;  2D8S A;  2JRJ A;  2MD8 C;  4MSX A;  3DQV R;  2ECG A;  4MVT A;  3DPL R;  1F62 A;  2ECJ A;  4YAD A;  2ECV A;  2KGG A;  1WGM A;  4V3K C;  5AIU A;  1ZBD B;  1HYJ A;  4AVX A;  1T1H A;  2MNZ A;  1JM7 B;  5TDW A;  1U6G B;  5C11 A;  1CHC A;  1VYX A;  2MA5 A;  2LGV A;  5JG6 A;  4PTB A;  2K4D A;  2YSJ A;  4GNF A;  4FIP A;  2MT5 A;  5LKZ A;  3T6R A;  4GND A;  4A0C D;  2ECW A;  4I7D A;  3N9N A;  2HDP A;  5H1V A;  3U5P A;  1JM7 A;  2F6J A;  2YW8 A;  3EB6 A;  3O7A A;  4R7E A;  5KH9 A;  1X4U A;  2UZG A;  2LN0 A;  2LXH C;  5G04 B;  3N9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...