4S3OB

Pcgf5-ring1b-ubch5c complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
105
Chain Sequence
TQPLSKTWELSLYELQRTPQEAITDLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSNKECPTCRKKLVSKRSLRPDPNFDALISKIYPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BMI1-RING1B is an autoinhibited RING E3 ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/transcription
molecule keywords Ubiquitin-conjugating enzyme E2 D3
total genus 26
structure length 105
sequence length 107
chains with identical sequence E
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4s3oB01
2K16A 2RI7A 2FSAA 1WENA 4S3OB 2ECNA 5J3XA 5B76A 5KH7A 2MNYA 3N9MA 1WESA 4WZ2A 3HCSA 3N9PA 3NG2A 3ZTGA 2LXHC 2M6MA 1HYIA 2XEUA 1CHCA 1Z6UA 4LJNA 3HTKC 5I3LA 2YURA 1WEQA 2G43A 4IC3A 2K4DA 4LKAA 3EB6A 2PUYA 1Z2QA 3O36A 3N9LA 2KWNA 4YABA 4WA6A 5AITA 1WEVA 3O37A 3LQHA 3KQIA 2E6RA 1HYJA 4QF2A 4A0CD 4F52B 1WEWA 2YQMA 2YHOA 3PHDA 2H0DB 3O35A 1FP0A 5JG6A 2M3HA 4YBSA 2I50A 5LKUA 4UP0A 5G05B 5DKAA 3VK6A 4QF3A 3C6WA 3ZYQA 4AP4A 2LDRA 3O34A 1WEOA 2MT5A 2KWOA 3GL6A 2LGGA 3N9OA 1WEPA 5TRBA 1VYXA 2H0DA 2VPBA 2KREA 3ZVYA 1VD4A 5B78A 2QICA 2LRIC 3HCUA 5TDWA 2G6QA 2Y1NA 4V3LC 5D1LB 4FK5A 5FERA 5LKTA 4B86C 5KH3A 2MNZA 2FUIA 2JRJA 4C9ZA 3T7LA 2EA6A 5B79A 2HDPA 2ECIA 3O33A 4I7BA 4YAXA 2VJFB 4GB0A 4X3GA 3RPGB 2BAYA 4IC2A 1JM7A 1WFKA 1U6GB 2IDAA 4PPEA 3SOWA 4FO9A 3C5KA 3SHBA 2E6SA 5D1KB 4AYCB 3DQVR 3M99A 2YW8A 2YSMA 1MM3A 4CA1A 3MHHA 2QJ0A 5C11A 3FL2A 4A4CA 1RMDA 1X4JA 3N9QA 2YYRA 2MD7B 2VPDA 1WE9A 4ZQLA 4AVXA 2YUCA 5LKXA 1WEEA 3M62A 2L43A 5TDRA 4Q6FA 2MA6A 4FJCA 3U5MA 3KNVA 4PTBA 3L1ZB 2F6NA 5G0FA 1IYMA 2EGPA 2YSJA 1BORA 2JMJA 1K2FA 3V43A 1DVPA 4MVTA 4NN2A 1VFYA 2FUUA 2VJEB 2YHNA 3M63A 2VJFA 2L80A 2ECTA 2F42A 2RSDA 4UI9B 2UZGA 2LGVA 4R7EA 2KIZA 4I7CA 3DPLR 2ECGA 4I7DA 4R2YA 4GNGA 2CSZA 2CT2A 3L1XA 4P5OB 1G25A 4WZ0A 1E4UA 3RTRB 5H1TA 1ZBDB 1V87A 4CCGX 2ZETC 3PURA 4BBQA 5B75A 4YATA 5G04B 3I2DA 3SOXA 1FBVA 2K1JA 4L58A 3LRQA 2KYUA 2LGKA 4LK9A 4MSXA 5FB0A 2MD8C 1WGMA 3IHPA 2D8SA 5DINA 2C2LA 5LCWB 2JMDA 2YREA 5TBNA 2CKLB 2VNFA 4N3WA 5TABA 1N87A 3O70A 2KGIA 2LGLA 4V3KC 3SOUA 3T6RA 4GNEA 3ZPV1 1WILA 4ZUXU 3ASLA 2KU3A 5H9MA 5B8DA 2MIQA 5FEYA 1Z60A 2L0BA 5FB1A 5C13A 4L7XA 4A49A 3GV4A 2Y1MA 4FIPA 2LXPC 3U5NA 3KV6A 2KGGA 2Y43A 5B77A 2VP7A 2ECWA 3U5OA 2ECVA 2YQLA 2LN0A 2HYED 4W4UA 2JMIA 4LADB 3ZNIA 1WEUA 2AN6A 3EB5A 3O7AA 4XI1A 2QIZA 3U5PA 5EYAF 3RPGC 2PNXA 5AIUA 5KH9A 2K17A 3LQIA 1JM7B 1JOCA 4YADA 2LV9A 3MHSA 1MM2A 1LDKC 4S3OC 4B7YC 5H1UA 2MA5A 2F6JA 4N4FA 3L11A 2KWJA 2KE1A 4GNDA 2M85A 5H1VA 1LDJB 3PUQA 5D1MB 2KR4A 4BHWA 2ECJA 2VPGA 1X4IA 4ZDTA 4A4BA 2CSYA 3QZVA 4LLBA 1X4UA 2VJEA 3N9NA 1WEMA 3ZPVE 4UP5A 1WIMA 2L5UA 4R8PK 4YBTA 2G45A 3HCTA 2YT5A 4TKPB 4AYCA 2M1RA 4AUQB 2EODA 4YC9A 1XWHA 2DX8A 2KFTA 2MUMA 1T1HA 4YBMA 4WZ3B 2KWKA 4O64A 1F62A 2L75A 3KV5A 2OXQC 3ZVZB 2VPEA 5LKZA 2CKLA 2YU4A 3LQJA 2C2VS 2LQ6A 2XB1A 2NAAA 4GNFA
chains in the Genus database with same CATH superfamily
2K16A 2RI7A 2FSAA 1WENA 4S3OB 2ECNA 5J3XA 5B76A 5KH7A 2MNYA 3N9MA 1WESA 4WZ2A 3HCSA 3N9PA 3NG2A 3ZTGA 2LXHC 2M6MA 2DSMA 2XEUA 1HYIA 2FD4A 1CHCA 1Z6UA 4LJNA 3HTKC 3FM8C 5I3LA 2YURA 1WEQA 2G43A 4IC3A 2K4DA 4LKAA 3EB6A 2PUYA 3DWDA 4O62A 2B0OE 1Z2QA 3O36A 3N9LA 2KWNA 4YABA 4WA6A 5AITA 1WEVA 3O37A 3LQHA 3KQIA 2E6RA 1HYJA 4QF2A 4A0CD 5SVXA 4F52B 1WEWA 2YQMA 2YHOA 3PHDA 2H0DB 3O35A 1FP0A 5JG6A 2M3HA 4YBSA 2I50A 5LKUA 4UP0A 5G05B 5DKAA 3VK6A 4QF3A 3C6WA 3ZYQA 4AP4A 2DJAA 2LDRA 3O34A 1WEOA 3KDEC 2XP0A 2MT5A 1MBMA 2KWOA 3GL6A 2LGGA 3T9KA 3N9OA 1WEPA 3FAOA 2XOZA 1VYXA 2H0DA 5TRBA 2VPBA 2KREA 4H9DA 3ZVYA 1VD4A 5B78A 2QICA 2LRIC 3HCUA 5TDWA 2G6QA 2Y1NA 4V3LC 5D1LB 4FK5A 5FERA 5LKTA 4B86C 5KH3A 3LDYA 2MNZA 2FUIA 2CONA 2JRJA 4C9ZA 3T7LA 5SVIA 2L7PA 2EA6A 5B79A 2HDPA 2ECIA 4Z0RA 3O33A 4I7BA 4YAXA 2VJFB 4GB0A 4X3GA 3RPGB 2BAYA 4IC2A 1JM7A 1WFKA 1U6GB 2IDAA 4PPEA 3SOWA 4FO9A 3E2DA 3DDTA 3C5KA 3SHBA 2E6SA 5D1KB 4AYCB 3DQVR 3M99A 2KKXA 2YW8A 2YSMA 1MM3A 4CA1A 3MHHA 2QJ0A 2CSVA 3FL2A 5C11A 4A4CA 1RMDA 1X4JA 2MKEA 3N9QA 2YYRA 2MD7B 2VPDA 4Z0OA 1WE9A 2E61A 4ZQLA 4AVXA 2YUCA 3FANA 2XOYA 5LKXA 1WEEA 3M62A 2L43A 5TDRA 4Q6FA 2MA6A 4FJCA 3U5MA 3KNVA 2CRRA 4PTBA 3L1ZB 2F6NA 2XOCA 2D8UA 5G0FA 1IYMA 2EGPA 2YSJA 1BORA 2JMJA 1K2FA 3V43A 1DVPA 4MVTA 4NN2A 1VFYA 2FUUA 3MDBC 2LAUA 2VJEB 2YHNA 3M63A 2VJFA 2L80A 2ECTA 2F42A 2RSDA 2KKYA 4UI9B 2UZGA 2LGVA 2EXUA 4R7EA 2KIZA 4I7CA 3DPLR 2ECGA 4I7DA 4R2YA 4GNGA 2CSZA 3LVQE 2CT2A 3L1XA 4P5OB 1G25A 3LJUX 4WZ0A 1E4UA 3RTRB 4OGEA 5H1TA 1ZBDB 1V87A 4CCGX 2ZETC 3PURA 4BBQA 5B75A 4YATA 5G04B 3I2DA 3SOXA 2JUNA 1FBVA 3O47A 2K1JA 4L58A 3LRQA 2KYUA 2LGKA 3LVRE 4LK9A 4MSXA 2RR4A 5SVIB 5FB0A 3H7HA 2MD8C 1WGMA 3IHPA 2D8SA 5DINA 2C2LA 5LCWB 2JMDA 2YREA 5TBNA 2CKLB 3M7KA 2VNFA 4N3WA 5TABA 1N87A 3O70A 2KGIA 2LGLA 4V3KC 3SOUA 5K3QA 3T6RA 4GNEA 3ZPV1 1WILA 4ZUXU 3FEHA 3ASLA 2KU3A 4OGCA 5H9MA 5B8DA 2MIQA 5FEYA 1DCQA 1Z60A 2L0BA 5FB1A 5C13A 3JUEA 4L7XA 4A49A 3GV4A 2Y1MA 4FIPA 2LXPC 3U5NA 3KV6A 2KGGA 2Y43A 5B77A 2VP7A 2ECWA 2YVRA 3U5OA 2ECVA 2YQLA 4QQ4A 2LN0A 2HYED 4W4UA 2JMIA 4LADB 3ZNIA 1WEUA 3Q1DA 2AN6A 3EB5A 2CRWA 3O7AA 4XI1A 2QIZA 3U5PA 5EYAF 3RPGC 3FJUB 2JM3A 2PNXA 5AIUA 5KH9A 2K17A 2M13A 3LQIA 1JM7B 1JOCA 4YADA 2LV9A 3MHSA 1MM2A 1LDKC 4S3OC 4B7YC 5H1UA 2MA5A 2F6JA 4N4FA 3L11A 2KWJA 5SVYA 2KE1A 4GNDA 2M85A 5H1VA 1LDJB 2P57A 3PUQA 5D1MB 2IQJA 2KR4A 4BHWA 2ECJA 2VPGA 1X4IA 2EGMA 4ZDTA 4A4BA 2CSYA 3QZVA 4LLBA 1X4UA 2VJEA 3N9NA 1WEMA 3ZPVE 4UP5A 1WIMA 2L5UA 4R8PK 4YBTA 2G45A 3HCTA 2YT5A 4TKPB 4AYCA 4F1PA 2M1RA 3SUBA 4AUQB 2OWAA 2EODA 4YC9A 1XWHA 2DX8A 2KFTA 2MUMA 1T1HA 4YBMA 4WZ3B 2KWKA 4O64A 1F62A 3PLWA 2FFWA 2L75A 3KV5A 2OXQC 3ZVZB 2VPEA 5LKZA 2CKLA 2YU4A 3LQJA 2C2VS 2LQ6A 2XB1A 2NAAA 4GNFA
chains in the Genus database with same CATH topology
2K16A 2RI7A 2FSAA 1WENA 4S3OB 2ECNA 5J3XA 5B76A 5KH7A 2MNYA 3N9MA 1WESA 4WZ2A 3HCSA 3N9PA 3NG2A 3ZTGA 2LXHC 2M6MA 1HYIA 2XEUA 1CHCA 1Z6UA 4LJNA 3HTKC 5I3LA 2YURA 1WEQA 2G43A 4IC3A 2K4DA 4LKAA 3EB6A 2PUYA 1Z2QA 3O36A 3N9LA 2KWNA 4YABA 4WA6A 5AITA 1WEVA 3O37A 3LQHA 3KQIA 2E6RA 1HYJA 4QF2A 4A0CD 4F52B 1WEWA 2YQMA 2YHOA 3PHDA 2H0DB 3O35A 1FP0A 5JG6A 2M3HA 4YBSA 2I50A 5LKUA 4UP0A 5G05B 5DKAA 3VK6A 4QF3A 3C6WA 3ZYQA 4AP4A 2LDRA 3O34A 1WEOA 2MT5A 2KWOA 3GL6A 2LGGA 3N9OA 1WEPA 5TRBA 1VYXA 2H0DA 2VPBA 2KREA 3ZVYA 1VD4A 5B78A 2QICA 2LRIC 3HCUA 5TDWA 2G6QA 2Y1NA 4V3LC 5D1LB 4FK5A 5FERA 5LKTA 4B86C 5KH3A 2MNZA 2FUIA 2JRJA 4C9ZA 3T7LA 2EA6A 5B79A 2HDPA 2ECIA 3O33A 4I7BA 4YAXA 2VJFB 4GB0A 4X3GA 3RPGB 2BAYA 4IC2A 1JM7A 1WFKA 1U6GB 2IDAA 4PPEA 3SOWA 4FO9A 3C5KA 3SHBA 2E6SA 5D1KB 4AYCB 3DQVR 3M99A 2YW8A 2YSMA 1MM3A 4CA1A 3MHHA 2QJ0A 5C11A 3FL2A 4A4CA 1RMDA 1X4JA 3N9QA 2YYRA 2MD7B 2VPDA 1WE9A 4ZQLA 4AVXA 2YUCA 5LKXA 1WEEA 3M62A 2L43A 5TDRA 4Q6FA 2MA6A 4FJCA 3U5MA 3KNVA 4PTBA 3L1ZB 2F6NA 5G0FA 1IYMA 2EGPA 2YSJA 1BORA 2JMJA 1K2FA 3V43A 1DVPA 4MVTA 4NN2A 1VFYA 2FUUA 2VJEB 2YHNA 3M63A 2VJFA 2L80A 2ECTA 2F42A 2RSDA 4UI9B 2UZGA 2LGVA 4R7EA 2KIZA 4I7CA 3DPLR 2ECGA 4I7DA 4R2YA 4GNGA 2CSZA 2CT2A 3L1XA 4P5OB 1G25A 4WZ0A 1E4UA 3RTRB 5H1TA 1ZBDB 1V87A 4CCGX 2ZETC 3PURA 4BBQA 5B75A 4YATA 5G04B 3I2DA 3SOXA 1FBVA 2K1JA 4L58A 3LRQA 2KYUA 2LGKA 4LK9A 4MSXA 5FB0A 2MD8C 1WGMA 3IHPA 2D8SA 5DINA 2C2LA 5LCWB 2JMDA 2YREA 5TBNA 2CKLB 2VNFA 4N3WA 5TABA 1N87A 3O70A 2KGIA 2LGLA 4V3KC 3SOUA 3T6RA 4GNEA 3ZPV1 1WILA 4ZUXU 3ASLA 2KU3A 5H9MA 5B8DA 2MIQA 5FEYA 1Z60A 2L0BA 5FB1A 5C13A 4L7XA 4A49A 3GV4A 2Y1MA 4FIPA 2LXPC 3U5NA 3KV6A 2KGGA 2Y43A 5B77A 2VP7A 2ECWA 3U5OA 2ECVA 2YQLA 2LN0A 2HYED 4W4UA 2JMIA 4LADB 3ZNIA 1WEUA 2AN6A 3EB5A 3O7AA 4XI1A 2QIZA 3U5PA 5EYAF 3RPGC 2PNXA 5AIUA 5KH9A 2K17A 3LQIA 1JM7B 1JOCA 4YADA 2LV9A 3MHSA 1MM2A 1LDKC 4S3OC 4B7YC 5H1UA 2MA5A 2F6JA 4N4FA 3L11A 2KWJA 2KE1A 4GNDA 2M85A 5H1VA 1LDJB 3PUQA 5D1MB 2KR4A 4BHWA 2ECJA 2VPGA 1X4IA 4ZDTA 4A4BA 2CSYA 3QZVA 4LLBA 1X4UA 2VJEA 3N9NA 1WEMA 3ZPVE 4UP5A 1WIMA 2L5UA 4R8PK 4YBTA 2G45A 3HCTA 2YT5A 4TKPB 4AYCA 2M1RA 4AUQB 2EODA 4YC9A 1XWHA 2DX8A 2KFTA 2MUMA 1T1HA 4YBMA 4WZ3B 2KWKA 4O64A 1F62A 2L75A 3KV5A 2OXQC 3ZVZB 2VPEA 5LKZA 2CKLA 2YU4A 3LQJA 2C2VS 2LQ6A 2XB1A 2NAAA 4GNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K16 A;  2RI7 A;  2FSA A;  1WEN A;  4S3O B;  2ECN A;  5J3X A;  5B76 A;  5KH7 A;  2MNY A;  3N9M A;  1WES A;  4WZ2 A;  3HCS A;  3N9P A;  3NG2 A;  3ZTG A;  2LXH C;  2M6M A;  1HYI A;  2XEU A;  1CHC A;  1Z6U A;  4LJN A;  3HTK C;  5I3L A;  2YUR A;  1WEQ A;  2G43 A;  4IC3 A;  2K4D A;  4LKA A;  3EB6 A;  2PUY A;  1Z2Q A;  3O36 A;  3N9L A;  2KWN A;  4YAB A;  4WA6 A;  5AIT A;  1WEV A;  3O37 A;  3LQH A;  3KQI A;  2E6R A;  1HYJ A;  4QF2 A;  4A0C D;  4F52 B;  1WEW A;  2YQM A;  2YHO A;  3PHD A;  2H0D B;  3O35 A;  1FP0 A;  5JG6 A;  2M3H A;  4YBS A;  2I50 A;  5LKU A;  4UP0 A;  5G05 B;  5DKA A;  3VK6 A;  4QF3 A;  3C6W A;  3ZYQ A;  4AP4 A;  2LDR A;  3O34 A;  1WEO A;  2MT5 A;  2KWO A;  3GL6 A;  2LGG A;  3N9O A;  1WEP A;  5TRB A;  1VYX A;  2H0D A;  2VPB A;  2KRE A;  3ZVY A;  1VD4 A;  5B78 A;  2QIC A;  2LRI C;  3HCU A;  5TDW A;  2G6Q A;  2Y1N A;  4V3L C;  5D1L B;  4FK5 A;  5FER A;  5LKT A;  4B86 C;  5KH3 A;  2MNZ A;  2FUI A;  2JRJ A;  4C9Z A;  3T7L A;  2EA6 A;  5B79 A;  2HDP A;  2ECI A;  3O33 A;  4I7B A;  4YAX A;  2VJF B;  4GB0 A;  4X3G A;  3RPG B;  2BAY A;  4IC2 A;  1JM7 A;  1WFK A;  1U6G B;  2IDA A;  4PPE A;  3SOW A;  4FO9 A;  3C5K A;  3SHB A;  2E6S A;  5D1K B;  4AYC B;  3DQV R;  3M99 A;  2YW8 A;  2YSM A;  1MM3 A;  4CA1 A;  3MHH A;  2QJ0 A;  5C11 A;  3FL2 A;  4A4C A;  1RMD A;  1X4J A;  3N9Q A;  2YYR A;  2MD7 B;  2VPD A;  1WE9 A;  4ZQL A;  4AVX A;  2YUC A;  5LKX A;  1WEE A;  3M62 A;  2L43 A;  5TDR A;  4Q6F A;  2MA6 A;  4FJC A;  3U5M A;  3KNV A;  4PTB A;  3L1Z B;  2F6N A;  5G0F A;  1IYM A;  2EGP A;  2YSJ A;  1BOR A;  2JMJ A;  1K2F A;  3V43 A;  1DVP A;  4MVT A;  4NN2 A;  1VFY A;  2FUU A;  2VJE B;  2YHN A;  3M63 A;  2VJF A;  2L80 A;  2ECT A;  2F42 A;  2RSD A;  4UI9 B;  2UZG A;  2LGV A;  4R7E A;  2KIZ A;  4I7C A;  3DPL R;  2ECG A;  4I7D A;  4R2Y A;  4GNG A;  2CSZ A;  2CT2 A;  3L1X A;  4P5O B;  1G25 A;  4WZ0 A;  1E4U A;  3RTR B;  5H1T A;  1ZBD B;  1V87 A;  4CCG X;  2ZET C;  3PUR A;  4BBQ A;  5B75 A;  4YAT A;  5G04 B;  3I2D A;  3SOX A;  1FBV A;  2K1J A;  4L58 A;  3LRQ A;  2KYU A;  2LGK A;  4LK9 A;  4MSX A;  5FB0 A;  2MD8 C;  1WGM A;  3IHP A;  2D8S A;  5DIN A;  2C2L A;  5LCW B;  2JMD A;  2YRE A;  5TBN A;  2CKL B;  2VNF A;  4N3W A;  5TAB A;  1N87 A;  3O70 A;  2KGI A;  2LGL A;  4V3K C;  3SOU A;  3T6R A;  4GNE A;  3ZPV 1;  1WIL A;  4ZUX U;  3ASL A;  2KU3 A;  5H9M A;  5B8D A;  2MIQ A;  5FEY A;  1Z60 A;  2L0B A;  5FB1 A;  5C13 A;  4L7X A;  4A49 A;  3GV4 A;  2Y1M A;  4FIP A;  2LXP C;  3U5N A;  3KV6 A;  2KGG A;  2Y43 A;  5B77 A;  2VP7 A;  2ECW A;  3U5O A;  2ECV A;  2YQL A;  2LN0 A;  2HYE D;  4W4U A;  2JMI A;  4LAD B;  3ZNI A;  1WEU A;  2AN6 A;  3EB5 A;  3O7A A;  4XI1 A;  2QIZ A;  3U5P A;  5EYA F;  3RPG C;  2PNX A;  5AIU A;  5KH9 A;  2K17 A;  3LQI A;  1JM7 B;  1JOC A;  4YAD A;  2LV9 A;  3MHS A;  1MM2 A;  1LDK C;  4S3O C;  4B7Y C;  5H1U A;  2MA5 A;  2F6J A;  4N4F A;  3L11 A;  2KWJ A;  2KE1 A;  4GND A;  2M85 A;  5H1V A;  1LDJ B;  3PUQ A;  5D1M B;  2KR4 A;  4BHW A;  2ECJ A;  2VPG A;  1X4I A;  4ZDT A;  4A4B A;  2CSY A;  3QZV A;  4LLB A;  1X4U A;  2VJE A;  3N9N A;  1WEM A;  3ZPV E;  4UP5 A;  1WIM A;  2L5U A;  4R8P K;  4YBT A;  2G45 A;  3HCT A;  2YT5 A;  4TKP B;  4AYC A;  2M1R A;  4AUQ B;  2EOD A;  4YC9 A;  1XWH A;  2DX8 A;  2KFT A;  2MUM A;  1T1H A;  4YBM A;  4WZ3 B;  2KWK A;  4O64 A;  1F62 A;  2L75 A;  3KV5 A;  2OXQ C;  3ZVZ B;  2VPE A;  5LKZ A;  2CKL A;  2YU4 A;  3LQJ A;  2C2V S;  2LQ6 A;  2XB1 A;  2NAA A;  4GNF A; 
#chains in the Genus database with same CATH topology
 2K16 A;  2RI7 A;  2FSA A;  1WEN A;  4S3O B;  2ECN A;  5J3X A;  5B76 A;  5KH7 A;  2MNY A;  3N9M A;  1WES A;  4WZ2 A;  3HCS A;  3N9P A;  3NG2 A;  3ZTG A;  2LXH C;  2M6M A;  2DSM A;  2XEU A;  1HYI A;  2FD4 A;  1CHC A;  1Z6U A;  4LJN A;  3HTK C;  3FM8 C;  5I3L A;  2YUR A;  1WEQ A;  2G43 A;  4IC3 A;  2K4D A;  4LKA A;  3EB6 A;  2PUY A;  3DWD A;  4O62 A;  2B0O E;  1Z2Q A;  3O36 A;  3N9L A;  2KWN A;  4YAB A;  4WA6 A;  5AIT A;  1WEV A;  3O37 A;  3LQH A;  3KQI A;  2E6R A;  1HYJ A;  4QF2 A;  4A0C D;  5SVX A;  4F52 B;  1WEW A;  2YQM A;  2YHO A;  3PHD A;  2H0D B;  3O35 A;  1FP0 A;  5JG6 A;  2M3H A;  4YBS A;  2I50 A;  5LKU A;  4UP0 A;  5G05 B;  5DKA A;  3VK6 A;  4QF3 A;  3C6W A;  3ZYQ A;  4AP4 A;  2DJA A;  2LDR A;  3O34 A;  1WEO A;  3KDE C;  2XP0 A;  2MT5 A;  1MBM A;  2KWO A;  3GL6 A;  2LGG A;  3T9K A;  3N9O A;  1WEP A;  3FAO A;  2XOZ A;  1VYX A;  2H0D A;  5TRB A;  2VPB A;  2KRE A;  4H9D A;  3ZVY A;  1VD4 A;  5B78 A;  2QIC A;  2LRI C;  3HCU A;  5TDW A;  2G6Q A;  2Y1N A;  4V3L C;  5D1L B;  4FK5 A;  5FER A;  5LKT A;  4B86 C;  5KH3 A;  3LDY A;  2MNZ A;  2FUI A;  2CON A;  2JRJ A;  4C9Z A;  3T7L A;  5SVI A;  2L7P A;  2EA6 A;  5B79 A;  2HDP A;  2ECI A;  4Z0R A;  3O33 A;  4I7B A;  4YAX A;  2VJF B;  4GB0 A;  4X3G A;  3RPG B;  2BAY A;  4IC2 A;  1JM7 A;  1WFK A;  1U6G B;  2IDA A;  4PPE A;  3SOW A;  4FO9 A;  3E2D A;  3DDT A;  3C5K A;  3SHB A;  2E6S A;  5D1K B;  4AYC B;  3DQV R;  3M99 A;  2KKX A;  2YW8 A;  2YSM A;  1MM3 A;  4CA1 A;  3MHH A;  2QJ0 A;  2CSV A;  3FL2 A;  5C11 A;  4A4C A;  1RMD A;  1X4J A;  2MKE A;  3N9Q A;  2YYR A;  2MD7 B;  2VPD A;  4Z0O A;  1WE9 A;  2E61 A;  4ZQL A;  4AVX A;  2YUC A;  3FAN A;  2XOY A;  5LKX A;  1WEE A;  3M62 A;  2L43 A;  5TDR A;  4Q6F A;  2MA6 A;  4FJC A;  3U5M A;  3KNV A;  2CRR A;  4PTB A;  3L1Z B;  2F6N A;  2XOC A;  2D8U A;  5G0F A;  1IYM A;  2EGP A;  2YSJ A;  1BOR A;  2JMJ A;  1K2F A;  3V43 A;  1DVP A;  4MVT A;  4NN2 A;  1VFY A;  2FUU A;  3MDB C;  2LAU A;  2VJE B;  2YHN A;  3M63 A;  2VJF A;  2L80 A;  2ECT A;  2F42 A;  2RSD A;  2KKY A;  4UI9 B;  2UZG A;  2LGV A;  2EXU A;  4R7E A;  2KIZ A;  4I7C A;  3DPL R;  2ECG A;  4I7D A;  4R2Y A;  4GNG A;  2CSZ A;  3LVQ E;  2CT2 A;  3L1X A;  4P5O B;  1G25 A;  3LJU X;  4WZ0 A;  1E4U A;  3RTR B;  4OGE A;  5H1T A;  1ZBD B;  1V87 A;  4CCG X;  2ZET C;  3PUR A;  4BBQ A;  5B75 A;  4YAT A;  5G04 B;  3I2D A;  3SOX A;  2JUN A;  1FBV A;  3O47 A;  2K1J A;  4L58 A;  3LRQ A;  2KYU A;  2LGK A;  3LVR E;  4LK9 A;  4MSX A;  2RR4 A;  5SVI B;  5FB0 A;  3H7H A;  2MD8 C;  1WGM A;  3IHP A;  2D8S A;  5DIN A;  2C2L A;  5LCW B;  2JMD A;  2YRE A;  5TBN A;  2CKL B;  3M7K A;  2VNF A;  4N3W A;  5TAB A;  1N87 A;  3O70 A;  2KGI A;  2LGL A;  4V3K C;  3SOU A;  5K3Q A;  3T6R A;  4GNE A;  3ZPV 1;  1WIL A;  4ZUX U;  3FEH A;  3ASL A;  2KU3 A;  4OGC A;  5H9M A;  5B8D A;  2MIQ A;  5FEY A;  1DCQ A;  1Z60 A;  2L0B A;  5FB1 A;  5C13 A;  3JUE A;  4L7X A;  4A49 A;  3GV4 A;  2Y1M A;  4FIP A;  2LXP C;  3U5N A;  3KV6 A;  2KGG A;  2Y43 A;  5B77 A;  2VP7 A;  2ECW A;  2YVR A;  3U5O A;  2ECV A;  2YQL A;  4QQ4 A;  2LN0 A;  2HYE D;  4W4U A;  2JMI A;  4LAD B;  3ZNI A;  1WEU A;  3Q1D A;  2AN6 A;  3EB5 A;  2CRW A;  3O7A A;  4XI1 A;  2QIZ A;  3U5P A;  5EYA F;  3RPG C;  3FJU B;  2JM3 A;  2PNX A;  5AIU A;  5KH9 A;  2K17 A;  2M13 A;  3LQI A;  1JM7 B;  1JOC A;  4YAD A;  2LV9 A;  3MHS A;  1MM2 A;  1LDK C;  4S3O C;  4B7Y C;  5H1U A;  2MA5 A;  2F6J A;  4N4F A;  3L11 A;  2KWJ A;  5SVY A;  2KE1 A;  4GND A;  2M85 A;  5H1V A;  1LDJ B;  2P57 A;  3PUQ A;  5D1M B;  2IQJ A;  2KR4 A;  4BHW A;  2ECJ A;  2VPG A;  1X4I A;  2EGM A;  4ZDT A;  4A4B A;  2CSY A;  3QZV A;  4LLB A;  1X4U A;  2VJE A;  3N9N A;  1WEM A;  3ZPV E;  4UP5 A;  1WIM A;  2L5U A;  4R8P K;  4YBT A;  2G45 A;  3HCT A;  2YT5 A;  4TKP B;  4AYC A;  4F1P A;  2M1R A;  3SUB A;  4AUQ B;  2OWA A;  2EOD A;  4YC9 A;  1XWH A;  2DX8 A;  2KFT A;  2MUM A;  1T1H A;  4YBM A;  4WZ3 B;  2KWK A;  4O64 A;  1F62 A;  3PLW A;  2FFW A;  2L75 A;  3KV5 A;  2OXQ C;  3ZVZ B;  2VPE A;  5LKZ A;  2CKL A;  2YU4 A;  3LQJ A;  2C2V S;  2LQ6 A;  2XB1 A;  2NAA A;  4GNF A; 
#chains in the Genus database with same CATH homology
 2K16 A;  2RI7 A;  2FSA A;  1WEN A;  4S3O B;  2ECN A;  5J3X A;  5B76 A;  5KH7 A;  2MNY A;  3N9M A;  1WES A;  4WZ2 A;  3HCS A;  3N9P A;  3NG2 A;  3ZTG A;  2LXH C;  2M6M A;  1HYI A;  2XEU A;  1CHC A;  1Z6U A;  4LJN A;  3HTK C;  5I3L A;  2YUR A;  1WEQ A;  2G43 A;  4IC3 A;  2K4D A;  4LKA A;  3EB6 A;  2PUY A;  1Z2Q A;  3O36 A;  3N9L A;  2KWN A;  4YAB A;  4WA6 A;  5AIT A;  1WEV A;  3O37 A;  3LQH A;  3KQI A;  2E6R A;  1HYJ A;  4QF2 A;  4A0C D;  4F52 B;  1WEW A;  2YQM A;  2YHO A;  3PHD A;  2H0D B;  3O35 A;  1FP0 A;  5JG6 A;  2M3H A;  4YBS A;  2I50 A;  5LKU A;  4UP0 A;  5G05 B;  5DKA A;  3VK6 A;  4QF3 A;  3C6W A;  3ZYQ A;  4AP4 A;  2LDR A;  3O34 A;  1WEO A;  2MT5 A;  2KWO A;  3GL6 A;  2LGG A;  3N9O A;  1WEP A;  5TRB A;  1VYX A;  2H0D A;  2VPB A;  2KRE A;  3ZVY A;  1VD4 A;  5B78 A;  2QIC A;  2LRI C;  3HCU A;  5TDW A;  2G6Q A;  2Y1N A;  4V3L C;  5D1L B;  4FK5 A;  5FER A;  5LKT A;  4B86 C;  5KH3 A;  2MNZ A;  2FUI A;  2JRJ A;  4C9Z A;  3T7L A;  2EA6 A;  5B79 A;  2HDP A;  2ECI A;  3O33 A;  4I7B A;  4YAX A;  2VJF B;  4GB0 A;  4X3G A;  3RPG B;  2BAY A;  4IC2 A;  1JM7 A;  1WFK A;  1U6G B;  2IDA A;  4PPE A;  3SOW A;  4FO9 A;  3C5K A;  3SHB A;  2E6S A;  5D1K B;  4AYC B;  3DQV R;  3M99 A;  2YW8 A;  2YSM A;  1MM3 A;  4CA1 A;  3MHH A;  2QJ0 A;  5C11 A;  3FL2 A;  4A4C A;  1RMD A;  1X4J A;  3N9Q A;  2YYR A;  2MD7 B;  2VPD A;  1WE9 A;  4ZQL A;  4AVX A;  2YUC A;  5LKX A;  1WEE A;  3M62 A;  2L43 A;  5TDR A;  4Q6F A;  2MA6 A;  4FJC A;  3U5M A;  3KNV A;  4PTB A;  3L1Z B;  2F6N A;  5G0F A;  1IYM A;  2EGP A;  2YSJ A;  1BOR A;  2JMJ A;  1K2F A;  3V43 A;  1DVP A;  4MVT A;  4NN2 A;  1VFY A;  2FUU A;  2VJE B;  2YHN A;  3M63 A;  2VJF A;  2L80 A;  2ECT A;  2F42 A;  2RSD A;  4UI9 B;  2UZG A;  2LGV A;  4R7E A;  2KIZ A;  4I7C A;  3DPL R;  2ECG A;  4I7D A;  4R2Y A;  4GNG A;  2CSZ A;  2CT2 A;  3L1X A;  4P5O B;  1G25 A;  4WZ0 A;  1E4U A;  3RTR B;  5H1T A;  1ZBD B;  1V87 A;  4CCG X;  2ZET C;  3PUR A;  4BBQ A;  5B75 A;  4YAT A;  5G04 B;  3I2D A;  3SOX A;  1FBV A;  2K1J A;  4L58 A;  3LRQ A;  2KYU A;  2LGK A;  4LK9 A;  4MSX A;  5FB0 A;  2MD8 C;  1WGM A;  3IHP A;  2D8S A;  5DIN A;  2C2L A;  5LCW B;  2JMD A;  2YRE A;  5TBN A;  2CKL B;  2VNF A;  4N3W A;  5TAB A;  1N87 A;  3O70 A;  2KGI A;  2LGL A;  4V3K C;  3SOU A;  3T6R A;  4GNE A;  3ZPV 1;  1WIL A;  4ZUX U;  3ASL A;  2KU3 A;  5H9M A;  5B8D A;  2MIQ A;  5FEY A;  1Z60 A;  2L0B A;  5FB1 A;  5C13 A;  4L7X A;  4A49 A;  3GV4 A;  2Y1M A;  4FIP A;  2LXP C;  3U5N A;  3KV6 A;  2KGG A;  2Y43 A;  5B77 A;  2VP7 A;  2ECW A;  3U5O A;  2ECV A;  2YQL A;  2LN0 A;  2HYE D;  4W4U A;  2JMI A;  4LAD B;  3ZNI A;  1WEU A;  2AN6 A;  3EB5 A;  3O7A A;  4XI1 A;  2QIZ A;  3U5P A;  5EYA F;  3RPG C;  2PNX A;  5AIU A;  5KH9 A;  2K17 A;  3LQI A;  1JM7 B;  1JOC A;  4YAD A;  2LV9 A;  3MHS A;  1MM2 A;  1LDK C;  4S3O C;  4B7Y C;  5H1U A;  2MA5 A;  2F6J A;  4N4F A;  3L11 A;  2KWJ A;  2KE1 A;  4GND A;  2M85 A;  5H1V A;  1LDJ B;  3PUQ A;  5D1M B;  2KR4 A;  4BHW A;  2ECJ A;  2VPG A;  1X4I A;  4ZDT A;  4A4B A;  2CSY A;  3QZV A;  4LLB A;  1X4U A;  2VJE A;  3N9N A;  1WEM A;  3ZPV E;  4UP5 A;  1WIM A;  2L5U A;  4R8P K;  4YBT A;  2G45 A;  3HCT A;  2YT5 A;  4TKP B;  4AYC A;  2M1R A;  4AUQ B;  2EOD A;  4YC9 A;  1XWH A;  2DX8 A;  2KFT A;  2MUM A;  1T1H A;  4YBM A;  4WZ3 B;  2KWK A;  4O64 A;  1F62 A;  2L75 A;  3KV5 A;  2OXQ C;  3ZVZ B;  2VPE A;  5LKZ A;  2CKL A;  2YU4 A;  3LQJ A;  2C2V S;  2LQ6 A;  2XB1 A;  2NAA A;  4GNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...