2LDRA

Solution structure of helix-ring domain of cbl-b in the tyr363 phosphorylated form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
81
Chain Sequence
GPHMGSDHIKVTQEQYELCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Autoinhibition and phosphorylation-induced activation mechanisms of human cancer and autoimmune disease-related E3 protein Cbl-b
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 81
sequence length 82
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ldrA00
2M3HA 2L5UA 1Z6UA 5TRBA 2VNFA 2KWOA 2K1JA 3FL2A 2LXHC 4ZDTA 1ZBDB 2I50A 3LRQA 4GNEA 2YHOA 2C2LA 1Z60A 4PPEA 2LGVA 2VPDA 4BHWA 3U5NA 3PUQA 4YBSA 1FP0A 4S3OC 4AYCB 2FUUA 4A4BA 4IC3A 4FO9A 2ECWA 2Y43A 4CA1A 1BORA 2YU4A 4PTBA 4YATA 4AYCA 2MA6A 3SHBA 4LKAA 1VYXA 2RSDA 2YW8A 2ECNA 3KV6A 4YABA 3RPGB 5LCWB 3SOWA 5H1TA 2KWKA 3L1ZB 2VPBA 4IC2A 2ECJA 4GNGA 4WZ0A 1WFKA 5H1UA 2YREA 4B7YC 3N9PA 2VPGA 1RMDA 2KWJA 2VJEA 5DINA 4GNFA 4UP0A 3T6RA 2ECIA 2KFTA 3N9MA 5I3LA 3U5PA 2KIZA 4YBMA 2D8SA 3KNVA 2CKLA 2QICA 5FB1A 4LJNA 2LN0A 2K4DA 1WEOA 1WEPA 2KR4A 1HYJA 5J3XA 2E6SA 3SOUA 4TKPB 2QIZA 3IHPA 2G45A 3KV5A 2YSJA 4FIPA 5H1VA 4R2YA 3M63A 1U6GB 4AUQB 1V87A 2F6NA 4L7XA 3C6WA 2UZGA 3MHSA 4YAXA 1X4IA 2L0BA 3ZVYA 2KGIA 2BAYA 3GV4A 5DKAA 3HCUA 3M99A 2VJFA 4B86C 5B78A 3T7LA 2Y1NA 4L58A 2EA6A 1WILA 4I7BA 4WA6A 5G05B 4GNDA 3EB6A 5EYAF 4UI9B 2PNXA 1HYIA 4I7CA 4F52B 4CCGX 1FBVA 3V43A 3L11A 2CSYA 4R7EA 2M6MA 1JM7B 5B77A 2JMDA 2ECGA 2H0DB 3GL6A 5KH9A 4LADB 3DQVR 3SOXA 3LQIA 1DVPA 4V3LC 1T1HA 4A0CD 4N3WA 5TDRA 3U5MA 4YC9A 4QF3A 2H0DA 4BBQA 5TDWA 2YHNA 3I2DA 5G04B 3U5OA 5D1LB 1VD4A 2YYRA 3N9QA 5C11A 2KU3A 4W4UA 4C9ZA 2LRIC 5B75A 5G0FA 2F6JA 3O7AA 5LKUA 3PHDA 3N9LA 5LKZA 4A4CA 2ECVA 2ECTA 4X3GA 5KH3A 4YADA 4ZUXU 2JMJA 1JOCA 2YSMA 4FK5A 2MUMA 3HTKC 4GB0A 1IYMA 4FJCA 3HCTA 3N9OA 3O36A 4YBTA 1VFYA 5D1KB 4S3OB 2YUCA 1G25A 5LKXA 4P5OB 3ZNIA 4AP4A 5D1MB 2LGGA 1WEUA 5B79A 3EB5A 2NAAA 3N9NA 2F42A 3NG2A 5FERA 2LXPC 2MT5A 1X4UA 3O37A 2YURA 5FEYA 4XI1A 1WIMA 2YT5A 5AITA 2KYUA 1F62A 1CHCA 3RPGC 1WGMA 1Z2QA 4UP5A 4N4FA 2Y1MA 1XWHA 2MA5A 3ZVZB 5FB0A 1MM3A 4MVTA 1WENA 2EODA 1WEQA 3ZTGA 4I7DA 2FUIA 2YQMA 5AIUA 2MD8C 2G6QA 4LLBA 2AN6A 2ZETC 4AVXA 2C2VS 2JMIA 1MM2A 2VP7A 2RI7A 4V3KC 5B8DA 3ZPVE 2EGPA 2PUYA 3VK6A 3RTRB 2LDRA 1LDJB 2G43A 4R8PK 1JM7A 3C5KA 2LV9A 5TBNA 2CT2A 3LQJA 3KQIA 2MNZA 4A49A 2HDPA 3ASLA 3PURA 3L1XA 5TABA 2FSAA 5JG6A 2QJ0A 3O33A 2K16A 5C13A 3ZYQA 2XEUA 3QZVA 2MIQA 2KREA 1WESA 1N87A 5B76A 4NN2A 2VJEB 2VPEA 2DX8A 3DPLR 1WEMA 1WEEA 2IDAA 3O70A 2CKLB 3ZPV1 1WEVA 2M85A 2MD7B 3O35A 2L43A 4WZ2A 2L75A 2LGLA 5LKTA 1WEWA 2JRJA 4WZ3B 2HYED 2KWNA 3HCSA 4Q6FA 4ZQLA 3O34A 1LDKC 2KGGA 2XB1A 3M62A 2K17A 2OXQC 2MNYA 1E4UA 2LQ6A 2YQLA 2LGKA 4LK9A 4QF2A 2KE1A 1WE9A 5KH7A 3MHHA 1X4JA 2M1RA 2E6RA 2L80A 3LQHA 1K2FA 2VJFB 4MSXA 2CSZA 5H9MA 4O64A
chains in the Genus database with same CATH superfamily
2M3HA 2L5UA 1Z6UA 5TRBA 2VNFA 2KWOA 2K1JA 3FL2A 2LXHC 4ZDTA 1ZBDB 2I50A 3LRQA 4GNEA 2YHOA 2OWAA 2CRRA 2C2LA 1Z60A 4PPEA 2LGVA 2VPDA 4BHWA 3FEHA 3U5NA 3PUQA 4YBSA 1FP0A 4S3OC 4AYCB 2FUUA 4A4BA 2DSMA 4IC3A 4FO9A 2ECWA 2Y43A 4CA1A 4OGCA 1BORA 2YU4A 4PTBA 4YATA 4AYCA 2XOCA 2DJAA 2MA6A 3SHBA 4LKAA 1VYXA 2RSDA 2YW8A 2ECNA 3KV6A 4YABA 3RPGB 2D8UA 4O62A 5LCWB 3SOWA 5H1TA 2KWKA 5SVIB 3L1ZB 2VPBA 1DCQA 4IC2A 2ECJA 4GNGA 4Z0RA 4WZ0A 1WFKA 5SVIA 5H1UA 2YREA 4B7YC 3N9PA 2VPGA 1RMDA 2KWJA 2VJEA 5DINA 1MBMA 4GNFA 4UP0A 3T6RA 2ECIA 2KFTA 3N9MA 5I3LA 3U5PA 2KIZA 4YBMA 2D8SA 3KNVA 2CKLA 2JUNA 2QICA 5FB1A 4LJNA 2LN0A 2K4DA 1WEOA 1WEPA 2KR4A 1HYJA 2FFWA 3FJUB 5J3XA 3KDEC 2E6SA 3SOUA 4TKPB 2QIZA 3IHPA 2G45A 3KV5A 2YSJA 4FIPA 5H1VA 4R2YA 3M63A 1U6GB 2KKYA 2L7PA 3JUEA 4AUQB 1V87A 2XOYA 4OGEA 2F6NA 4L7XA 2LAUA 3C6WA 2UZGA 3MHSA 4YAXA 1X4IA 2L0BA 3ZVYA 2KGIA 2BAYA 2RR4A 3GV4A 5DKAA 3HCUA 3M99A 2VJFA 4B86C 5B78A 2FD4A 3T7LA 2Y1NA 4L58A 2EA6A 1WILA 4I7BA 4WA6A 5G05B 4GNDA 3EB6A 5EYAF 4UI9B 2PNXA 1HYIA 4I7CA 4F52B 4CCGX 3LJUX 1FBVA 4F1PA 3V43A 3L11A 2CSYA 4R7EA 2M6MA 1JM7B 5B77A 2JMDA 2KKXA 2ECGA 2H0DB 3GL6A 5KH9A 4LADB 3DQVR 3SOXA 3LQIA 2IQJA 1DVPA 4V3LC 1T1HA 4A0CD 4N3WA 5TDRA 3U5MA 4YC9A 4QF3A 2H0DA 4BBQA 5TDWA 2YHNA 3I2DA 5G04B 3U5OA 5D1LB 1VD4A 4H9DA 2YYRA 3N9QA 5C11A 2KU3A 4W4UA 4C9ZA 2LRIC 5B75A 5G0FA 2F6JA 3O7AA 5LKUA 3PHDA 3N9LA 5LKZA 4A4CA 2ECVA 2ECTA 4X3GA 5KH3A 4YADA 4ZUXU 2JMJA 1JOCA 2YSMA 3FAOA 3PLWA 3T9KA 4FK5A 2XP0A 2MUMA 3HTKC 4GB0A 1IYMA 4FJCA 3HCTA 3N9OA 3O36A 4YBTA 1VFYA 5K3QA 2XOZA 5D1KB 4S3OB 2YUCA 1G25A 2P57A 4P5OB 3ZNIA 4AP4A 5LKXA 3M7KA 5D1MB 2LGGA 1WEUA 2CONA 5B79A 3EB5A 2NAAA 3N9NA 2F42A 3NG2A 5FERA 2LXPC 4Z0OA 2MT5A 1X4UA 3O37A 2YURA 4QQ4A 5FEYA 4XI1A 1WIMA 3LDYA 2YT5A 5AITA 2KYUA 1F62A 1CHCA 3RPGC 1WGMA 1Z2QA 4UP5A 4N4FA 2Y1MA 1XWHA 2MA5A 3ZVZB 5FB0A 1MM3A 4MVTA 1WENA 2EODA 2E61A 1WEQA 2MKEA 3ZTGA 2B0OE 4I7DA 2FUIA 2YQMA 5AIUA 3LVQE 2JM3A 2MD8C 2G6QA 4LLBA 2AN6A 2ZETC 4AVXA 2C2VS 2JMIA 1MM2A 2VP7A 2RI7A 3FM8C 4V3KC 3FANA 5B8DA 3ZPVE 2EGPA 2PUYA 3VK6A 3RTRB 3H7HA 2LDRA 1LDJB 2G43A 2M13A 4R8PK 1JM7A 3C5KA 2LV9A 3E2DA 5TBNA 2CT2A 3SUBA 2CRWA 3LQJA 3DDTA 3KQIA 2MNZA 4A49A 3DWDA 2HDPA 3ASLA 3PURA 3L1XA 5TABA 2FSAA 5JG6A 2QJ0A 3O33A 2K16A 5C13A 3ZYQA 2XEUA 3QZVA 2MIQA 2KREA 1WESA 1N87A 5B76A 4NN2A 2VJEB 2VPEA 2DX8A 3DPLR 1WEMA 1WEEA 3MDBC 2IDAA 3O70A 2CKLB 2EGMA 3LVRE 3ZPV1 1WEVA 2M85A 2MD7B 3O35A 2L43A 4WZ2A 2L75A 2LGLA 5LKTA 1WEWA 2JRJA 3O47A 4WZ3B 2HYED 5SVYA 2KWNA 3HCSA 4Q6FA 4ZQLA 3O34A 1LDKC 2EXUA 2KGGA 2XB1A 3M62A 2K17A 2YVRA 2OXQC 2MNYA 1E4UA 2LQ6A 2YQLA 2LGKA 4LK9A 4QF2A 2KE1A 1WE9A 5KH7A 5SVXA 3MHHA 1X4JA 2M1RA 2E6RA 2L80A 3LQHA 1K2FA 2VJFB 2CSVA 3Q1DA 4MSXA 2CSZA 5H9MA 4O64A
chains in the Genus database with same CATH topology
2M3HA 2L5UA 1Z6UA 5TRBA 2VNFA 2KWOA 2K1JA 3FL2A 2LXHC 4ZDTA 1ZBDB 2I50A 3LRQA 4GNEA 2YHOA 2C2LA 1Z60A 4PPEA 2LGVA 2VPDA 4BHWA 3U5NA 3PUQA 4YBSA 1FP0A 4S3OC 4AYCB 2FUUA 4A4BA 4IC3A 4FO9A 2ECWA 2Y43A 4CA1A 1BORA 2YU4A 4PTBA 4YATA 4AYCA 2MA6A 3SHBA 4LKAA 1VYXA 2RSDA 2YW8A 2ECNA 3KV6A 4YABA 3RPGB 5LCWB 3SOWA 5H1TA 2KWKA 3L1ZB 2VPBA 4IC2A 2ECJA 4GNGA 4WZ0A 1WFKA 5H1UA 2YREA 4B7YC 3N9PA 2VPGA 1RMDA 2KWJA 2VJEA 5DINA 4GNFA 4UP0A 3T6RA 2ECIA 2KFTA 3N9MA 5I3LA 3U5PA 2KIZA 4YBMA 2D8SA 3KNVA 2CKLA 2QICA 5FB1A 4LJNA 2LN0A 2K4DA 1WEOA 1WEPA 2KR4A 1HYJA 5J3XA 2E6SA 3SOUA 4TKPB 2QIZA 3IHPA 2G45A 3KV5A 2YSJA 4FIPA 5H1VA 4R2YA 3M63A 1U6GB 4AUQB 1V87A 2F6NA 4L7XA 3C6WA 2UZGA 3MHSA 4YAXA 1X4IA 2L0BA 3ZVYA 2KGIA 2BAYA 3GV4A 5DKAA 3HCUA 3M99A 2VJFA 4B86C 5B78A 3T7LA 2Y1NA 4L58A 2EA6A 1WILA 4I7BA 4WA6A 5G05B 4GNDA 3EB6A 5EYAF 4UI9B 2PNXA 1HYIA 4I7CA 4F52B 4CCGX 1FBVA 3V43A 3L11A 2CSYA 4R7EA 2M6MA 1JM7B 5B77A 2JMDA 2ECGA 2H0DB 3GL6A 5KH9A 4LADB 3DQVR 3SOXA 3LQIA 1DVPA 4V3LC 1T1HA 4A0CD 4N3WA 5TDRA 3U5MA 4YC9A 4QF3A 2H0DA 4BBQA 5TDWA 2YHNA 3I2DA 5G04B 3U5OA 5D1LB 1VD4A 2YYRA 3N9QA 5C11A 2KU3A 4W4UA 4C9ZA 2LRIC 5B75A 5G0FA 2F6JA 3O7AA 5LKUA 3PHDA 3N9LA 5LKZA 4A4CA 2ECVA 2ECTA 4X3GA 5KH3A 4YADA 4ZUXU 2JMJA 1JOCA 2YSMA 4FK5A 2MUMA 3HTKC 4GB0A 1IYMA 4FJCA 3HCTA 3N9OA 3O36A 4YBTA 1VFYA 5D1KB 4S3OB 2YUCA 1G25A 5LKXA 4P5OB 3ZNIA 4AP4A 5D1MB 2LGGA 1WEUA 5B79A 3EB5A 2NAAA 3N9NA 2F42A 3NG2A 5FERA 2LXPC 2MT5A 1X4UA 3O37A 2YURA 5FEYA 4XI1A 1WIMA 2YT5A 5AITA 2KYUA 1F62A 1CHCA 3RPGC 1WGMA 1Z2QA 4UP5A 4N4FA 2Y1MA 1XWHA 2MA5A 3ZVZB 5FB0A 1MM3A 4MVTA 1WENA 2EODA 1WEQA 3ZTGA 4I7DA 2FUIA 2YQMA 5AIUA 2MD8C 2G6QA 4LLBA 2AN6A 2ZETC 4AVXA 2C2VS 2JMIA 1MM2A 2VP7A 2RI7A 4V3KC 5B8DA 3ZPVE 2EGPA 2PUYA 3VK6A 3RTRB 2LDRA 1LDJB 2G43A 4R8PK 1JM7A 3C5KA 2LV9A 5TBNA 2CT2A 3LQJA 3KQIA 2MNZA 4A49A 2HDPA 3ASLA 3PURA 3L1XA 5TABA 2FSAA 5JG6A 2QJ0A 3O33A 2K16A 5C13A 3ZYQA 2XEUA 3QZVA 2MIQA 2KREA 1WESA 1N87A 5B76A 4NN2A 2VJEB 2VPEA 2DX8A 3DPLR 1WEMA 1WEEA 2IDAA 3O70A 2CKLB 3ZPV1 1WEVA 2M85A 2MD7B 3O35A 2L43A 4WZ2A 2L75A 2LGLA 5LKTA 1WEWA 2JRJA 4WZ3B 2HYED 2KWNA 3HCSA 4Q6FA 4ZQLA 3O34A 1LDKC 2KGGA 2XB1A 3M62A 2K17A 2OXQC 2MNYA 1E4UA 2LQ6A 2YQLA 2LGKA 4LK9A 4QF2A 2KE1A 1WE9A 5KH7A 3MHHA 1X4JA 2M1RA 2E6RA 2L80A 3LQHA 1K2FA 2VJFB 4MSXA 2CSZA 5H9MA 4O64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3H A;  2L5U A;  1Z6U A;  5TRB A;  2VNF A;  2KWO A;  2K1J A;  3FL2 A;  2LXH C;  4ZDT A;  1ZBD B;  2I50 A;  3LRQ A;  4GNE A;  2YHO A;  2C2L A;  1Z60 A;  4PPE A;  2LGV A;  2VPD A;  4BHW A;  3U5N A;  3PUQ A;  4YBS A;  1FP0 A;  4S3O C;  4AYC B;  2FUU A;  4A4B A;  4IC3 A;  4FO9 A;  2ECW A;  2Y43 A;  4CA1 A;  1BOR A;  2YU4 A;  4PTB A;  4YAT A;  4AYC A;  2MA6 A;  3SHB A;  4LKA A;  1VYX A;  2RSD A;  2YW8 A;  2ECN A;  3KV6 A;  4YAB A;  3RPG B;  5LCW B;  3SOW A;  5H1T A;  2KWK A;  3L1Z B;  2VPB A;  4IC2 A;  2ECJ A;  4GNG A;  4WZ0 A;  1WFK A;  5H1U A;  2YRE A;  4B7Y C;  3N9P A;  2VPG A;  1RMD A;  2KWJ A;  2VJE A;  5DIN A;  4GNF A;  4UP0 A;  3T6R A;  2ECI A;  2KFT A;  3N9M A;  5I3L A;  3U5P A;  2KIZ A;  4YBM A;  2D8S A;  3KNV A;  2CKL A;  2QIC A;  5FB1 A;  4LJN A;  2LN0 A;  2K4D A;  1WEO A;  1WEP A;  2KR4 A;  1HYJ A;  5J3X A;  2E6S A;  3SOU A;  4TKP B;  2QIZ A;  3IHP A;  2G45 A;  3KV5 A;  2YSJ A;  4FIP A;  5H1V A;  4R2Y A;  3M63 A;  1U6G B;  4AUQ B;  1V87 A;  2F6N A;  4L7X A;  3C6W A;  2UZG A;  3MHS A;  4YAX A;  1X4I A;  2L0B A;  3ZVY A;  2KGI A;  2BAY A;  3GV4 A;  5DKA A;  3HCU A;  3M99 A;  2VJF A;  4B86 C;  5B78 A;  3T7L A;  2Y1N A;  4L58 A;  2EA6 A;  1WIL A;  4I7B A;  4WA6 A;  5G05 B;  4GND A;  3EB6 A;  5EYA F;  4UI9 B;  2PNX A;  1HYI A;  4I7C A;  4F52 B;  4CCG X;  1FBV A;  3V43 A;  3L11 A;  2CSY A;  4R7E A;  2M6M A;  1JM7 B;  5B77 A;  2JMD A;  2ECG A;  2H0D B;  3GL6 A;  5KH9 A;  4LAD B;  3DQV R;  3SOX A;  3LQI A;  1DVP A;  4V3L C;  1T1H A;  4A0C D;  4N3W A;  5TDR A;  3U5M A;  4YC9 A;  4QF3 A;  2H0D A;  4BBQ A;  5TDW A;  2YHN A;  3I2D A;  5G04 B;  3U5O A;  5D1L B;  1VD4 A;  2YYR A;  3N9Q A;  5C11 A;  2KU3 A;  4W4U A;  4C9Z A;  2LRI C;  5B75 A;  5G0F A;  2F6J A;  3O7A A;  5LKU A;  3PHD A;  3N9L A;  5LKZ A;  4A4C A;  2ECV A;  2ECT A;  4X3G A;  5KH3 A;  4YAD A;  4ZUX U;  2JMJ A;  1JOC A;  2YSM A;  4FK5 A;  2MUM A;  3HTK C;  4GB0 A;  1IYM A;  4FJC A;  3HCT A;  3N9O A;  3O36 A;  4YBT A;  1VFY A;  5D1K B;  4S3O B;  2YUC A;  1G25 A;  5LKX A;  4P5O B;  3ZNI A;  4AP4 A;  5D1M B;  2LGG A;  1WEU A;  5B79 A;  3EB5 A;  2NAA A;  3N9N A;  2F42 A;  3NG2 A;  5FER A;  2LXP C;  2MT5 A;  1X4U A;  3O37 A;  2YUR A;  5FEY A;  4XI1 A;  1WIM A;  2YT5 A;  5AIT A;  2KYU A;  1F62 A;  1CHC A;  3RPG C;  1WGM A;  1Z2Q A;  4UP5 A;  4N4F A;  2Y1M A;  1XWH A;  2MA5 A;  3ZVZ B;  5FB0 A;  1MM3 A;  4MVT A;  1WEN A;  2EOD A;  1WEQ A;  3ZTG A;  4I7D A;  2FUI A;  2YQM A;  5AIU A;  2MD8 C;  2G6Q A;  4LLB A;  2AN6 A;  2ZET C;  4AVX A;  2C2V S;  2JMI A;  1MM2 A;  2VP7 A;  2RI7 A;  4V3K C;  5B8D A;  3ZPV E;  2EGP A;  2PUY A;  3VK6 A;  3RTR B;  2LDR A;  1LDJ B;  2G43 A;  4R8P K;  1JM7 A;  3C5K A;  2LV9 A;  5TBN A;  2CT2 A;  3LQJ A;  3KQI A;  2MNZ A;  4A49 A;  2HDP A;  3ASL A;  3PUR A;  3L1X A;  5TAB A;  2FSA A;  5JG6 A;  2QJ0 A;  3O33 A;  2K16 A;  5C13 A;  3ZYQ A;  2XEU A;  3QZV A;  2MIQ A;  2KRE A;  1WES A;  1N87 A;  5B76 A;  4NN2 A;  2VJE B;  2VPE A;  2DX8 A;  3DPL R;  1WEM A;  1WEE A;  2IDA A;  3O70 A;  2CKL B;  3ZPV 1;  1WEV A;  2M85 A;  2MD7 B;  3O35 A;  2L43 A;  4WZ2 A;  2L75 A;  2LGL A;  5LKT A;  1WEW A;  2JRJ A;  4WZ3 B;  2HYE D;  2KWN A;  3HCS A;  4Q6F A;  4ZQL A;  3O34 A;  1LDK C;  2KGG A;  2XB1 A;  3M62 A;  2K17 A;  2OXQ C;  2MNY A;  1E4U A;  2LQ6 A;  2YQL A;  2LGK A;  4LK9 A;  4QF2 A;  2KE1 A;  1WE9 A;  5KH7 A;  3MHH A;  1X4J A;  2M1R A;  2E6R A;  2L80 A;  3LQH A;  1K2F A;  2VJF B;  4MSX A;  2CSZ A;  5H9M A;  4O64 A; 
#chains in the Genus database with same CATH topology
 2M3H A;  2L5U A;  1Z6U A;  5TRB A;  2VNF A;  2KWO A;  2K1J A;  3FL2 A;  2LXH C;  4ZDT A;  1ZBD B;  2I50 A;  3LRQ A;  4GNE A;  2YHO A;  2OWA A;  2CRR A;  2C2L A;  1Z60 A;  4PPE A;  2LGV A;  2VPD A;  4BHW A;  3FEH A;  3U5N A;  3PUQ A;  4YBS A;  1FP0 A;  4S3O C;  4AYC B;  2FUU A;  4A4B A;  2DSM A;  4IC3 A;  4FO9 A;  2ECW A;  2Y43 A;  4CA1 A;  4OGC A;  1BOR A;  2YU4 A;  4PTB A;  4YAT A;  4AYC A;  2XOC A;  2DJA A;  2MA6 A;  3SHB A;  4LKA A;  1VYX A;  2RSD A;  2YW8 A;  2ECN A;  3KV6 A;  4YAB A;  3RPG B;  2D8U A;  4O62 A;  5LCW B;  3SOW A;  5H1T A;  2KWK A;  5SVI B;  3L1Z B;  2VPB A;  1DCQ A;  4IC2 A;  2ECJ A;  4GNG A;  4Z0R A;  4WZ0 A;  1WFK A;  5SVI A;  5H1U A;  2YRE A;  4B7Y C;  3N9P A;  2VPG A;  1RMD A;  2KWJ A;  2VJE A;  5DIN A;  1MBM A;  4GNF A;  4UP0 A;  3T6R A;  2ECI A;  2KFT A;  3N9M A;  5I3L A;  3U5P A;  2KIZ A;  4YBM A;  2D8S A;  3KNV A;  2CKL A;  2JUN A;  2QIC A;  5FB1 A;  4LJN A;  2LN0 A;  2K4D A;  1WEO A;  1WEP A;  2KR4 A;  1HYJ A;  2FFW A;  3FJU B;  5J3X A;  3KDE C;  2E6S A;  3SOU A;  4TKP B;  2QIZ A;  3IHP A;  2G45 A;  3KV5 A;  2YSJ A;  4FIP A;  5H1V A;  4R2Y A;  3M63 A;  1U6G B;  2KKY A;  2L7P A;  3JUE A;  4AUQ B;  1V87 A;  2XOY A;  4OGE A;  2F6N A;  4L7X A;  2LAU A;  3C6W A;  2UZG A;  3MHS A;  4YAX A;  1X4I A;  2L0B A;  3ZVY A;  2KGI A;  2BAY A;  2RR4 A;  3GV4 A;  5DKA A;  3HCU A;  3M99 A;  2VJF A;  4B86 C;  5B78 A;  2FD4 A;  3T7L A;  2Y1N A;  4L58 A;  2EA6 A;  1WIL A;  4I7B A;  4WA6 A;  5G05 B;  4GND A;  3EB6 A;  5EYA F;  4UI9 B;  2PNX A;  1HYI A;  4I7C A;  4F52 B;  4CCG X;  3LJU X;  1FBV A;  4F1P A;  3V43 A;  3L11 A;  2CSY A;  4R7E A;  2M6M A;  1JM7 B;  5B77 A;  2JMD A;  2KKX A;  2ECG A;  2H0D B;  3GL6 A;  5KH9 A;  4LAD B;  3DQV R;  3SOX A;  3LQI A;  2IQJ A;  1DVP A;  4V3L C;  1T1H A;  4A0C D;  4N3W A;  5TDR A;  3U5M A;  4YC9 A;  4QF3 A;  2H0D A;  4BBQ A;  5TDW A;  2YHN A;  3I2D A;  5G04 B;  3U5O A;  5D1L B;  1VD4 A;  4H9D A;  2YYR A;  3N9Q A;  5C11 A;  2KU3 A;  4W4U A;  4C9Z A;  2LRI C;  5B75 A;  5G0F A;  2F6J A;  3O7A A;  5LKU A;  3PHD A;  3N9L A;  5LKZ A;  4A4C A;  2ECV A;  2ECT A;  4X3G A;  5KH3 A;  4YAD A;  4ZUX U;  2JMJ A;  1JOC A;  2YSM A;  3FAO A;  3PLW A;  3T9K A;  4FK5 A;  2XP0 A;  2MUM A;  3HTK C;  4GB0 A;  1IYM A;  4FJC A;  3HCT A;  3N9O A;  3O36 A;  4YBT A;  1VFY A;  5K3Q A;  2XOZ A;  5D1K B;  4S3O B;  2YUC A;  1G25 A;  2P57 A;  4P5O B;  3ZNI A;  4AP4 A;  5LKX A;  3M7K A;  5D1M B;  2LGG A;  1WEU A;  2CON A;  5B79 A;  3EB5 A;  2NAA A;  3N9N A;  2F42 A;  3NG2 A;  5FER A;  2LXP C;  4Z0O A;  2MT5 A;  1X4U A;  3O37 A;  2YUR A;  4QQ4 A;  5FEY A;  4XI1 A;  1WIM A;  3LDY A;  2YT5 A;  5AIT A;  2KYU A;  1F62 A;  1CHC A;  3RPG C;  1WGM A;  1Z2Q A;  4UP5 A;  4N4F A;  2Y1M A;  1XWH A;  2MA5 A;  3ZVZ B;  5FB0 A;  1MM3 A;  4MVT A;  1WEN A;  2EOD A;  2E61 A;  1WEQ A;  2MKE A;  3ZTG A;  2B0O E;  4I7D A;  2FUI A;  2YQM A;  5AIU A;  3LVQ E;  2JM3 A;  2MD8 C;  2G6Q A;  4LLB A;  2AN6 A;  2ZET C;  4AVX A;  2C2V S;  2JMI A;  1MM2 A;  2VP7 A;  2RI7 A;  3FM8 C;  4V3K C;  3FAN A;  5B8D A;  3ZPV E;  2EGP A;  2PUY A;  3VK6 A;  3RTR B;  3H7H A;  2LDR A;  1LDJ B;  2G43 A;  2M13 A;  4R8P K;  1JM7 A;  3C5K A;  2LV9 A;  3E2D A;  5TBN A;  2CT2 A;  3SUB A;  2CRW A;  3LQJ A;  3DDT A;  3KQI A;  2MNZ A;  4A49 A;  3DWD A;  2HDP A;  3ASL A;  3PUR A;  3L1X A;  5TAB A;  2FSA A;  5JG6 A;  2QJ0 A;  3O33 A;  2K16 A;  5C13 A;  3ZYQ A;  2XEU A;  3QZV A;  2MIQ A;  2KRE A;  1WES A;  1N87 A;  5B76 A;  4NN2 A;  2VJE B;  2VPE A;  2DX8 A;  3DPL R;  1WEM A;  1WEE A;  3MDB C;  2IDA A;  3O70 A;  2CKL B;  2EGM A;  3LVR E;  3ZPV 1;  1WEV A;  2M85 A;  2MD7 B;  3O35 A;  2L43 A;  4WZ2 A;  2L75 A;  2LGL A;  5LKT A;  1WEW A;  2JRJ A;  3O47 A;  4WZ3 B;  2HYE D;  5SVY A;  2KWN A;  3HCS A;  4Q6F A;  4ZQL A;  3O34 A;  1LDK C;  2EXU A;  2KGG A;  2XB1 A;  3M62 A;  2K17 A;  2YVR A;  2OXQ C;  2MNY A;  1E4U A;  2LQ6 A;  2YQL A;  2LGK A;  4LK9 A;  4QF2 A;  2KE1 A;  1WE9 A;  5KH7 A;  5SVX A;  3MHH A;  1X4J A;  2M1R A;  2E6R A;  2L80 A;  3LQH A;  1K2F A;  2VJF B;  2CSV A;  3Q1D A;  4MSX A;  2CSZ A;  5H9M A;  4O64 A; 
#chains in the Genus database with same CATH homology
 2M3H A;  2L5U A;  1Z6U A;  5TRB A;  2VNF A;  2KWO A;  2K1J A;  3FL2 A;  2LXH C;  4ZDT A;  1ZBD B;  2I50 A;  3LRQ A;  4GNE A;  2YHO A;  2C2L A;  1Z60 A;  4PPE A;  2LGV A;  2VPD A;  4BHW A;  3U5N A;  3PUQ A;  4YBS A;  1FP0 A;  4S3O C;  4AYC B;  2FUU A;  4A4B A;  4IC3 A;  4FO9 A;  2ECW A;  2Y43 A;  4CA1 A;  1BOR A;  2YU4 A;  4PTB A;  4YAT A;  4AYC A;  2MA6 A;  3SHB A;  4LKA A;  1VYX A;  2RSD A;  2YW8 A;  2ECN A;  3KV6 A;  4YAB A;  3RPG B;  5LCW B;  3SOW A;  5H1T A;  2KWK A;  3L1Z B;  2VPB A;  4IC2 A;  2ECJ A;  4GNG A;  4WZ0 A;  1WFK A;  5H1U A;  2YRE A;  4B7Y C;  3N9P A;  2VPG A;  1RMD A;  2KWJ A;  2VJE A;  5DIN A;  4GNF A;  4UP0 A;  3T6R A;  2ECI A;  2KFT A;  3N9M A;  5I3L A;  3U5P A;  2KIZ A;  4YBM A;  2D8S A;  3KNV A;  2CKL A;  2QIC A;  5FB1 A;  4LJN A;  2LN0 A;  2K4D A;  1WEO A;  1WEP A;  2KR4 A;  1HYJ A;  5J3X A;  2E6S A;  3SOU A;  4TKP B;  2QIZ A;  3IHP A;  2G45 A;  3KV5 A;  2YSJ A;  4FIP A;  5H1V A;  4R2Y A;  3M63 A;  1U6G B;  4AUQ B;  1V87 A;  2F6N A;  4L7X A;  3C6W A;  2UZG A;  3MHS A;  4YAX A;  1X4I A;  2L0B A;  3ZVY A;  2KGI A;  2BAY A;  3GV4 A;  5DKA A;  3HCU A;  3M99 A;  2VJF A;  4B86 C;  5B78 A;  3T7L A;  2Y1N A;  4L58 A;  2EA6 A;  1WIL A;  4I7B A;  4WA6 A;  5G05 B;  4GND A;  3EB6 A;  5EYA F;  4UI9 B;  2PNX A;  1HYI A;  4I7C A;  4F52 B;  4CCG X;  1FBV A;  3V43 A;  3L11 A;  2CSY A;  4R7E A;  2M6M A;  1JM7 B;  5B77 A;  2JMD A;  2ECG A;  2H0D B;  3GL6 A;  5KH9 A;  4LAD B;  3DQV R;  3SOX A;  3LQI A;  1DVP A;  4V3L C;  1T1H A;  4A0C D;  4N3W A;  5TDR A;  3U5M A;  4YC9 A;  4QF3 A;  2H0D A;  4BBQ A;  5TDW A;  2YHN A;  3I2D A;  5G04 B;  3U5O A;  5D1L B;  1VD4 A;  2YYR A;  3N9Q A;  5C11 A;  2KU3 A;  4W4U A;  4C9Z A;  2LRI C;  5B75 A;  5G0F A;  2F6J A;  3O7A A;  5LKU A;  3PHD A;  3N9L A;  5LKZ A;  4A4C A;  2ECV A;  2ECT A;  4X3G A;  5KH3 A;  4YAD A;  4ZUX U;  2JMJ A;  1JOC A;  2YSM A;  4FK5 A;  2MUM A;  3HTK C;  4GB0 A;  1IYM A;  4FJC A;  3HCT A;  3N9O A;  3O36 A;  4YBT A;  1VFY A;  5D1K B;  4S3O B;  2YUC A;  1G25 A;  5LKX A;  4P5O B;  3ZNI A;  4AP4 A;  5D1M B;  2LGG A;  1WEU A;  5B79 A;  3EB5 A;  2NAA A;  3N9N A;  2F42 A;  3NG2 A;  5FER A;  2LXP C;  2MT5 A;  1X4U A;  3O37 A;  2YUR A;  5FEY A;  4XI1 A;  1WIM A;  2YT5 A;  5AIT A;  2KYU A;  1F62 A;  1CHC A;  3RPG C;  1WGM A;  1Z2Q A;  4UP5 A;  4N4F A;  2Y1M A;  1XWH A;  2MA5 A;  3ZVZ B;  5FB0 A;  1MM3 A;  4MVT A;  1WEN A;  2EOD A;  1WEQ A;  3ZTG A;  4I7D A;  2FUI A;  2YQM A;  5AIU A;  2MD8 C;  2G6Q A;  4LLB A;  2AN6 A;  2ZET C;  4AVX A;  2C2V S;  2JMI A;  1MM2 A;  2VP7 A;  2RI7 A;  4V3K C;  5B8D A;  3ZPV E;  2EGP A;  2PUY A;  3VK6 A;  3RTR B;  2LDR A;  1LDJ B;  2G43 A;  4R8P K;  1JM7 A;  3C5K A;  2LV9 A;  5TBN A;  2CT2 A;  3LQJ A;  3KQI A;  2MNZ A;  4A49 A;  2HDP A;  3ASL A;  3PUR A;  3L1X A;  5TAB A;  2FSA A;  5JG6 A;  2QJ0 A;  3O33 A;  2K16 A;  5C13 A;  3ZYQ A;  2XEU A;  3QZV A;  2MIQ A;  2KRE A;  1WES A;  1N87 A;  5B76 A;  4NN2 A;  2VJE B;  2VPE A;  2DX8 A;  3DPL R;  1WEM A;  1WEE A;  2IDA A;  3O70 A;  2CKL B;  3ZPV 1;  1WEV A;  2M85 A;  2MD7 B;  3O35 A;  2L43 A;  4WZ2 A;  2L75 A;  2LGL A;  5LKT A;  1WEW A;  2JRJ A;  4WZ3 B;  2HYE D;  2KWN A;  3HCS A;  4Q6F A;  4ZQL A;  3O34 A;  1LDK C;  2KGG A;  2XB1 A;  3M62 A;  2K17 A;  2OXQ C;  2MNY A;  1E4U A;  2LQ6 A;  2YQL A;  2LGK A;  4LK9 A;  4QF2 A;  2KE1 A;  1WE9 A;  5KH7 A;  3MHH A;  1X4J A;  2M1R A;  2E6R A;  2L80 A;  3LQH A;  1K2F A;  2VJF B;  4MSX A;  2CSZ A;  5H9M A;  4O64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...