2LDRA

Solution structure of helix-ring domain of cbl-b in the tyr363 phosphorylated form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
81
Chain Sequence
GPHMGSDHIKVTQEQYELCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Autoinhibition and phosphorylation-induced activation mechanisms of human cancer and autoimmune disease-related E3 protein Cbl-b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 81
sequence length 82
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ldrA00
2I50A 4TKPB 2LGVA 2LXPC 4IC3A 2Y1MA 1F62A 4V3KC 5EYAF 2JRJA 4BHWA 2CSYA 1WEEA 3GL6A 3L11A 4QF3A 2E6RA 1JM7A 3M63A 4A4CA 3O37A 3U5OA 4WA6A 4N4FA 1X4UA 3O35A 4FO9A 4WZ0A 1WILA 3ZPV1 4UP0A 3HTKC 1WEUA 4V3LC 2C2LA 2MD7B 3O7AA 3O36A 1WEWA 2L80A 2M3HA 1K2FA 4YADA 3VK6A 4AVXA 3LRQA 2YHOA 3EB6A 4CCGX 2VJEB 2QJ0A 2KYUA 2YSMA 1RMDA 1WGMA 4B7YC 2HYED 3M62A 3T6RA 5TRBA 3RTRB 5B76A 2VPBA 4YBMA 5B78A 5AIUA 1JM7B 1LDKC 5FERA 1Z60A 3SOUA 4BBQA 3ASLA 2ECWA 4N3WA 1FP0A 2M1RA 2F42A 2LRIC 4YBSA 1VYXA 4YC9A 1WEPA 4NN2A 3PUQA 3DPLR 3KQIA 2AN6A 2KWNA 4UI9B 2ECGA 1WFKA 4PPEA 2FUUA 2JMIA 5B77A 2DX8A 2YHNA 4FIPA 3N9NA 4ZDTA 5I3LA 4AYCA 1N87A 1X4JA 3NG2A 3PHDA 2G43A 5FEYA 2QIZA 5LCWB 3O33A 2KE1A 5LKUA 4AP4A 5H1VA 5G0FA 3LQJA 4YABA 4GNDA 1V87A 2YYRA 2VPGA 2VP7A 3N9OA 2IDAA 4FJCA 5B79A 2LDRA 1MM3A 2KWKA 4I7BA 2EA6A 2FSAA 2MA5A 3ZVZB 5G05B 4R8PK 2CKLA 3SOWA 2UZGA 4AYCB 2YQMA 4W4UA 1T1HA 5B8DA 2YW8A 1Z2QA 4R2YA 3SHBA 1G25A 5LKZA 4R7EA 1WENA 3SOXA 3KV6A 2VNFA 2YQLA 4GNFA 3V43A 2QICA 2VJFA 3KV5A 3GV4A 2YUCA 2ECNA 5D1LB 4UP5A 2KR4A 1WEOA 2F6NA 3I2DA 5H9MA 2XEUA 4YAXA 5JG6A 3HCUA 3KNVA 4LKAA 2LGGA 4A0CD 2CKLB 2C2VS 4P5OB 3HCSA 4YBTA 3U5NA 2EGPA 2MA6A 1WEMA 2Y1NA 4GNGA 2F6JA 5C11A 5DINA 2KREA 2Y43A 3T7LA 4A4BA 2LXHC 2ZETC 4GNEA 2VJFB 2CT2A 4FK5A 5H1TA 2JMDA 2VPEA 5DKAA 5TBNA 3C6WA 3U5PA 3MHSA 1IYMA 1DVPA 4MSXA 3L1ZB 1U6GB 4IC2A 3ZPVE 5TABA 5LKTA 2LGKA 2YSJA 1X4IA 2FUIA 2CSZA 2YU4A 4YATA 4LLBA 3N9PA 5LKXA 3HCTA 1HYIA 5KH9A 2YREA 4A49A 3PURA 4QF2A 2E6SA 2MIQA 4XI1A 1BORA 2EODA 2MT5A 4CA1A 1VD4A 5B75A 2ECIA 1HYJA 2LV9A 4O64A 2M6MA 4MVTA 2RI7A 3U5MA 1MM2A 5J3XA 2MD8C 1WEQA 2K1JA 3LQHA 1LDJB 2H0DA 2KWJA 4WZ3B 2BAYA 5KH7A 5KH3A 2MNZA 4X3GA 3FL2A 3RPGC 4PTBA 1VFYA 5TDRA 2MNYA 4I7CA 3C5KA 2OXQC 5FB1A 1WEVA 3ZVYA 2LN0A 3EB5A 2KFTA 5H1UA 2L5UA 5AITA 2L75A 1E4UA 3RPGB 4ZUXU 4Q6FA 4ZQLA 2RSDA 5FB0A 2K16A 3QZVA 3N9MA 2VPDA 2LQ6A 1JOCA 4AUQB 2ECJA 2H0DB 3ZTGA 2KGIA 2M85A 2G45A 3L1XA 4WZ2A 2K4DA 2YT5A 2G6QA 4S3OC 2L43A 4L58A 1XWHA 4LJNA 4LADB 3DQVR 4I7DA 5D1KB 2YURA 4C9ZA 3ZNIA 2PNXA 3N9QA 3M99A 3O34A 3LQIA 4F52B 2KGGA 4S3OB 3MHHA 2NAAA 2KIZA 1WE9A 3ZYQA 4GB0A 1FBVA 1ZBDB 5D1MB 1WESA 2PUYA 2L0BA 2XB1A 3IHPA 2ECTA 2KU3A 5TDWA 4L7XA 1CHCA 2MUMA 2KWOA 4B86C 2HDPA 2JMJA 5C13A 1Z6UA 2D8SA 3O70A 4LK9A 2LGLA 5G04B 3N9LA 2ECVA 2K17A 1WIMA 2VJEA
chains in the Genus database with same CATH superfamily
2I50A 4TKPB 2LGVA 3LJUX 2LXPC 4IC3A 2Y1MA 1F62A 4V3KC 5EYAF 2JRJA 4BHWA 2CSYA 1WEEA 3GL6A 3L11A 4QF3A 3FJUB 2E6RA 1JM7A 3M63A 4A4CA 3O37A 3U5OA 4WA6A 4N4FA 1X4UA 2FD4A 2YVRA 3O35A 4FO9A 4WZ0A 1WILA 3ZPV1 4UP0A 3HTKC 1WEUA 4V3LC 2C2LA 2MD7B 3O7AA 3O36A 1WEWA 2JM3A 2L80A 2M3HA 1K2FA 4YADA 3VK6A 4AVXA 3LRQA 2YHOA 2RR4A 2XOZA 3EB6A 2VJEB 2QJ0A 4CCGX 2KYUA 2YSMA 1RMDA 1WGMA 4B7YC 2HYED 3M62A 3T6RA 5TRBA 3RTRB 5B76A 2VPBA 4YBMA 5B78A 4OGCA 5AIUA 1JM7B 1LDKC 5FERA 1Z60A 3SOUA 4BBQA 3ASLA 2ECWA 4N3WA 1FP0A 2M1RA 2F42A 2LRIC 4YBSA 2B0OE 1VYXA 4YC9A 1WEPA 2XOCA 3LVRE 5SVIA 4NN2A 3PUQA 3DPLR 3KQIA 2AN6A 2E61A 2FFWA 2KWNA 4UI9B 2ECGA 1WFKA 4PPEA 2CSVA 2FUUA 1DCQA 2JMIA 3MDBC 5B77A 2DX8A 2YHNA 4FIPA 2OWAA 3N9NA 4ZDTA 5I3LA 4AYCA 2EGMA 1N87A 1X4JA 3NG2A 3PHDA 2G43A 5FEYA 2QIZA 5LCWB 3O33A 2KE1A 5LKUA 4AP4A 5H1VA 5G0FA 4Z0RA 3FEHA 3LQJA 4YABA 4GNDA 1V87A 2YYRA 2VPGA 2VP7A 3N9OA 5SVIB 2IDAA 4FJCA 5B79A 2LDRA 1MM3A 2CRWA 2KWKA 4Z0OA 4I7BA 2EA6A 5SVYA 2FSAA 2MA5A 2XP0A 2EXUA 3ZVZB 5G05B 4R8PK 2CKLA 3SOWA 2UZGA 4F1PA 4AYCB 2YQMA 4W4UA 1T1HA 5B8DA 2YW8A 1Z2QA 4R2YA 3SHBA 1G25A 5LKZA 4R7EA 1WENA 2JUNA 3SOXA 3KV6A 2VNFA 2LAUA 2YQLA 4GNFA 3V43A 2QICA 2VJFA 3KV5A 3E2DA 3GV4A 2YUCA 2ECNA 3FM8C 5D1LB 4O62A 4UP5A 2KR4A 1WEOA 2F6NA 3KDEC 3I2DA 5H9MA 2XEUA 4YAXA 5JG6A 3HCUA 3KNVA 4LKAA 2LGGA 4A0CD 2CKLB 2C2VS 4P5OB 3HCSA 2P57A 4YBTA 5K3QA 3U5NA 3H7HA 2EGPA 2MA6A 1WEMA 2Y1NA 4GNGA 2F6JA 5C11A 5DINA 2KREA 2Y43A 3T7LA 4A4BA 2LXHC 2ZETC 4GNEA 2VJFB 2CT2A 4FK5A 5H1TA 2JMDA 2VPEA 5DKAA 5TBNA 3C6WA 3U5PA 2CRRA 3MHSA 1IYMA 1DVPA 3LDYA 4MSXA 2CONA 3L1ZB 1U6GB 4IC2A 3ZPVE 5TABA 5LKTA 2LGKA 2YSJA 1X4IA 2FUIA 2CSZA 2YU4A 4OGEA 4YATA 3Q1DA 4LLBA 3N9PA 5LKXA 3HCTA 1HYIA 5KH9A 2YREA 4A49A 3PURA 4QF2A 2E6SA 2XOYA 2MIQA 4XI1A 1BORA 2EODA 2KKYA 2MT5A 4CA1A 1VD4A 5B75A 2ECIA 1HYJA 2L7PA 2LV9A 4O64A 2M6MA 4MVTA 2RI7A 3U5MA 3JUEA 1MM2A 5J3XA 3O47A 2MD8C 1WEQA 2K1JA 3LQHA 3LVQE 1LDJB 2H0DA 1MBMA 2KWJA 4WZ3B 2BAYA 3FAOA 5KH3A 5KH7A 2MNZA 4X3GA 3FANA 3FL2A 3RPGC 2MKEA 4PTBA 1VFYA 5TDRA 3SUBA 2MNYA 4I7CA 3C5KA 2OXQC 5FB1A 1WEVA 3ZVYA 2LN0A 3EB5A 2M13A 2KFTA 5H1UA 2L5UA 5AITA 2L75A 1E4UA 2D8UA 3RPGB 2IQJA 4ZUXU 4Q6FA 4ZQLA 2RSDA 5FB0A 3T9KA 3M7KA 2K16A 3QZVA 3N9MA 2VPDA 3DDTA 2LQ6A 1JOCA 4AUQB 2DJAA 2ECJA 2H0DB 3ZTGA 2KGIA 2M85A 2G45A 3L1XA 4WZ2A 2K4DA 2YT5A 2G6QA 4S3OC 4QQ4A 2L43A 4L58A 1XWHA 4LJNA 4LADB 3DQVR 4I7DA 5D1KB 5SVXA 2YURA 4C9ZA 3ZNIA 2PNXA 3N9QA 3M99A 3O34A 3LQIA 4F52B 2KGGA 4S3OB 3MHHA 2NAAA 2KIZA 1WE9A 3ZYQA 4GB0A 1FBVA 1ZBDB 5D1MB 1WESA 2DSMA 2PUYA 2L0BA 2XB1A 3IHPA 2ECTA 2KU3A 5TDWA 3DWDA 4L7XA 1CHCA 2MUMA 2KWOA 4H9DA 4B86C 2HDPA 2JMJA 3PLWA 5C13A 1Z6UA 2D8SA 3O70A 4LK9A 2LGLA 5G04B 2KKXA 3N9LA 2ECVA 2K17A 1WIMA 2VJEA
chains in the Genus database with same CATH topology
2I50A 4TKPB 2LGVA 2LXPC 4IC3A 2Y1MA 1F62A 4V3KC 5EYAF 2JRJA 4BHWA 2CSYA 1WEEA 3GL6A 3L11A 4QF3A 2E6RA 1JM7A 3M63A 4A4CA 3O37A 3U5OA 4WA6A 4N4FA 1X4UA 3O35A 4FO9A 4WZ0A 1WILA 3ZPV1 4UP0A 3HTKC 1WEUA 4V3LC 2C2LA 2MD7B 3O7AA 3O36A 1WEWA 2L80A 2M3HA 1K2FA 4YADA 3VK6A 4AVXA 3LRQA 2YHOA 3EB6A 4CCGX 2VJEB 2QJ0A 2KYUA 2YSMA 1RMDA 1WGMA 4B7YC 2HYED 3M62A 3T6RA 5TRBA 3RTRB 5B76A 2VPBA 4YBMA 5B78A 5AIUA 1JM7B 1LDKC 5FERA 1Z60A 3SOUA 4BBQA 3ASLA 2ECWA 4N3WA 1FP0A 2M1RA 2F42A 2LRIC 4YBSA 1VYXA 4YC9A 1WEPA 4NN2A 3PUQA 3DPLR 3KQIA 2AN6A 2KWNA 4UI9B 2ECGA 1WFKA 4PPEA 2FUUA 2JMIA 5B77A 2DX8A 2YHNA 4FIPA 3N9NA 4ZDTA 5I3LA 4AYCA 1N87A 1X4JA 3NG2A 3PHDA 2G43A 5FEYA 2QIZA 5LCWB 3O33A 2KE1A 5LKUA 4AP4A 5H1VA 5G0FA 3LQJA 4YABA 4GNDA 1V87A 2YYRA 2VPGA 2VP7A 3N9OA 2IDAA 4FJCA 5B79A 2LDRA 1MM3A 2KWKA 4I7BA 2EA6A 2FSAA 2MA5A 3ZVZB 5G05B 4R8PK 2CKLA 3SOWA 2UZGA 4AYCB 2YQMA 4W4UA 1T1HA 5B8DA 2YW8A 1Z2QA 4R2YA 3SHBA 1G25A 5LKZA 4R7EA 1WENA 3SOXA 3KV6A 2VNFA 2YQLA 4GNFA 3V43A 2QICA 2VJFA 3KV5A 3GV4A 2YUCA 2ECNA 5D1LB 4UP5A 2KR4A 1WEOA 2F6NA 3I2DA 5H9MA 2XEUA 4YAXA 5JG6A 3HCUA 3KNVA 4LKAA 2LGGA 4A0CD 2CKLB 2C2VS 4P5OB 3HCSA 4YBTA 3U5NA 2EGPA 2MA6A 1WEMA 2Y1NA 4GNGA 2F6JA 5C11A 5DINA 2KREA 2Y43A 3T7LA 4A4BA 2LXHC 2ZETC 4GNEA 2VJFB 2CT2A 4FK5A 5H1TA 2JMDA 2VPEA 5DKAA 5TBNA 3C6WA 3U5PA 3MHSA 1IYMA 1DVPA 4MSXA 3L1ZB 1U6GB 4IC2A 3ZPVE 5TABA 5LKTA 2LGKA 2YSJA 1X4IA 2FUIA 2CSZA 2YU4A 4YATA 4LLBA 3N9PA 5LKXA 3HCTA 1HYIA 5KH9A 2YREA 4A49A 3PURA 4QF2A 2E6SA 2MIQA 4XI1A 1BORA 2EODA 2MT5A 4CA1A 1VD4A 5B75A 2ECIA 1HYJA 2LV9A 4O64A 2M6MA 4MVTA 2RI7A 3U5MA 1MM2A 5J3XA 2MD8C 1WEQA 2K1JA 3LQHA 1LDJB 2H0DA 2KWJA 4WZ3B 2BAYA 5KH7A 5KH3A 2MNZA 4X3GA 3FL2A 3RPGC 4PTBA 1VFYA 5TDRA 2MNYA 4I7CA 3C5KA 2OXQC 5FB1A 1WEVA 3ZVYA 2LN0A 3EB5A 2KFTA 5H1UA 2L5UA 5AITA 2L75A 1E4UA 3RPGB 4ZUXU 4Q6FA 4ZQLA 2RSDA 5FB0A 2K16A 3QZVA 3N9MA 2VPDA 2LQ6A 1JOCA 4AUQB 2ECJA 2H0DB 3ZTGA 2KGIA 2M85A 2G45A 3L1XA 4WZ2A 2K4DA 2YT5A 2G6QA 4S3OC 2L43A 4L58A 1XWHA 4LJNA 4LADB 3DQVR 4I7DA 5D1KB 2YURA 4C9ZA 3ZNIA 2PNXA 3N9QA 3M99A 3O34A 3LQIA 4F52B 2KGGA 4S3OB 3MHHA 2NAAA 2KIZA 1WE9A 3ZYQA 4GB0A 1FBVA 1ZBDB 5D1MB 1WESA 2PUYA 2L0BA 2XB1A 3IHPA 2ECTA 2KU3A 5TDWA 4L7XA 1CHCA 2MUMA 2KWOA 4B86C 2HDPA 2JMJA 5C13A 1Z6UA 2D8SA 3O70A 4LK9A 2LGLA 5G04B 3N9LA 2ECVA 2K17A 1WIMA 2VJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I50 A;  4TKP B;  2LGV A;  2LXP C;  4IC3 A;  2Y1M A;  1F62 A;  4V3K C;  5EYA F;  2JRJ A;  4BHW A;  2CSY A;  1WEE A;  3GL6 A;  3L11 A;  4QF3 A;  2E6R A;  1JM7 A;  3M63 A;  4A4C A;  3O37 A;  3U5O A;  4WA6 A;  4N4F A;  1X4U A;  3O35 A;  4FO9 A;  4WZ0 A;  1WIL A;  3ZPV 1;  4UP0 A;  3HTK C;  1WEU A;  4V3L C;  2C2L A;  2MD7 B;  3O7A A;  3O36 A;  1WEW A;  2L80 A;  2M3H A;  1K2F A;  4YAD A;  3VK6 A;  4AVX A;  3LRQ A;  2YHO A;  3EB6 A;  4CCG X;  2VJE B;  2QJ0 A;  2KYU A;  2YSM A;  1RMD A;  1WGM A;  4B7Y C;  2HYE D;  3M62 A;  3T6R A;  5TRB A;  3RTR B;  5B76 A;  2VPB A;  4YBM A;  5B78 A;  5AIU A;  1JM7 B;  1LDK C;  5FER A;  1Z60 A;  3SOU A;  4BBQ A;  3ASL A;  2ECW A;  4N3W A;  1FP0 A;  2M1R A;  2F42 A;  2LRI C;  4YBS A;  1VYX A;  4YC9 A;  1WEP A;  4NN2 A;  3PUQ A;  3DPL R;  3KQI A;  2AN6 A;  2KWN A;  4UI9 B;  2ECG A;  1WFK A;  4PPE A;  2FUU A;  2JMI A;  5B77 A;  2DX8 A;  2YHN A;  4FIP A;  3N9N A;  4ZDT A;  5I3L A;  4AYC A;  1N87 A;  1X4J A;  3NG2 A;  3PHD A;  2G43 A;  5FEY A;  2QIZ A;  5LCW B;  3O33 A;  2KE1 A;  5LKU A;  4AP4 A;  5H1V A;  5G0F A;  3LQJ A;  4YAB A;  4GND A;  1V87 A;  2YYR A;  2VPG A;  2VP7 A;  3N9O A;  2IDA A;  4FJC A;  5B79 A;  2LDR A;  1MM3 A;  2KWK A;  4I7B A;  2EA6 A;  2FSA A;  2MA5 A;  3ZVZ B;  5G05 B;  4R8P K;  2CKL A;  3SOW A;  2UZG A;  4AYC B;  2YQM A;  4W4U A;  1T1H A;  5B8D A;  2YW8 A;  1Z2Q A;  4R2Y A;  3SHB A;  1G25 A;  5LKZ A;  4R7E A;  1WEN A;  3SOX A;  3KV6 A;  2VNF A;  2YQL A;  4GNF A;  3V43 A;  2QIC A;  2VJF A;  3KV5 A;  3GV4 A;  2YUC A;  2ECN A;  5D1L B;  4UP5 A;  2KR4 A;  1WEO A;  2F6N A;  3I2D A;  5H9M A;  2XEU A;  4YAX A;  5JG6 A;  3HCU A;  3KNV A;  4LKA A;  2LGG A;  4A0C D;  2CKL B;  2C2V S;  4P5O B;  3HCS A;  4YBT A;  3U5N A;  2EGP A;  2MA6 A;  1WEM A;  2Y1N A;  4GNG A;  2F6J A;  5C11 A;  5DIN A;  2KRE A;  2Y43 A;  3T7L A;  4A4B A;  2LXH C;  2ZET C;  4GNE A;  2VJF B;  2CT2 A;  4FK5 A;  5H1T A;  2JMD A;  2VPE A;  5DKA A;  5TBN A;  3C6W A;  3U5P A;  3MHS A;  1IYM A;  1DVP A;  4MSX A;  3L1Z B;  1U6G B;  4IC2 A;  3ZPV E;  5TAB A;  5LKT A;  2LGK A;  2YSJ A;  1X4I A;  2FUI A;  2CSZ A;  2YU4 A;  4YAT A;  4LLB A;  3N9P A;  5LKX A;  3HCT A;  1HYI A;  5KH9 A;  2YRE A;  4A49 A;  3PUR A;  4QF2 A;  2E6S A;  2MIQ A;  4XI1 A;  1BOR A;  2EOD A;  2MT5 A;  4CA1 A;  1VD4 A;  5B75 A;  2ECI A;  1HYJ A;  2LV9 A;  4O64 A;  2M6M A;  4MVT A;  2RI7 A;  3U5M A;  1MM2 A;  5J3X A;  2MD8 C;  1WEQ A;  2K1J A;  3LQH A;  1LDJ B;  2H0D A;  2KWJ A;  4WZ3 B;  2BAY A;  5KH7 A;  5KH3 A;  2MNZ A;  4X3G A;  3FL2 A;  3RPG C;  4PTB A;  1VFY A;  5TDR A;  2MNY A;  4I7C A;  3C5K A;  2OXQ C;  5FB1 A;  1WEV A;  3ZVY A;  2LN0 A;  3EB5 A;  2KFT A;  5H1U A;  2L5U A;  5AIT A;  2L75 A;  1E4U A;  3RPG B;  4ZUX U;  4Q6F A;  4ZQL A;  2RSD A;  5FB0 A;  2K16 A;  3QZV A;  3N9M A;  2VPD A;  2LQ6 A;  1JOC A;  4AUQ B;  2ECJ A;  2H0D B;  3ZTG A;  2KGI A;  2M85 A;  2G45 A;  3L1X A;  4WZ2 A;  2K4D A;  2YT5 A;  2G6Q A;  4S3O C;  2L43 A;  4L58 A;  1XWH A;  4LJN A;  4LAD B;  3DQV R;  4I7D A;  5D1K B;  2YUR A;  4C9Z A;  3ZNI A;  2PNX A;  3N9Q A;  3M99 A;  3O34 A;  3LQI A;  4F52 B;  2KGG A;  4S3O B;  3MHH A;  2NAA A;  2KIZ A;  1WE9 A;  3ZYQ A;  4GB0 A;  1FBV A;  1ZBD B;  5D1M B;  1WES A;  2PUY A;  2L0B A;  2XB1 A;  3IHP A;  2ECT A;  2KU3 A;  5TDW A;  4L7X A;  1CHC A;  2MUM A;  2KWO A;  4B86 C;  2HDP A;  2JMJ A;  5C13 A;  1Z6U A;  2D8S A;  3O70 A;  4LK9 A;  2LGL A;  5G04 B;  3N9L A;  2ECV A;  2K17 A;  1WIM A;  2VJE A; 
#chains in the Genus database with same CATH topology
 2I50 A;  4TKP B;  2LGV A;  3LJU X;  2LXP C;  4IC3 A;  2Y1M A;  1F62 A;  4V3K C;  5EYA F;  2JRJ A;  4BHW A;  2CSY A;  1WEE A;  3GL6 A;  3L11 A;  4QF3 A;  3FJU B;  2E6R A;  1JM7 A;  3M63 A;  4A4C A;  3O37 A;  3U5O A;  4WA6 A;  4N4F A;  1X4U A;  2FD4 A;  2YVR A;  3O35 A;  4FO9 A;  4WZ0 A;  1WIL A;  3ZPV 1;  4UP0 A;  3HTK C;  1WEU A;  4V3L C;  2C2L A;  2MD7 B;  3O7A A;  3O36 A;  1WEW A;  2JM3 A;  2L80 A;  2M3H A;  1K2F A;  4YAD A;  3VK6 A;  4AVX A;  3LRQ A;  2YHO A;  2RR4 A;  2XOZ A;  3EB6 A;  2VJE B;  2QJ0 A;  4CCG X;  2KYU A;  2YSM A;  1RMD A;  1WGM A;  4B7Y C;  2HYE D;  3M62 A;  3T6R A;  5TRB A;  3RTR B;  5B76 A;  2VPB A;  4YBM A;  5B78 A;  4OGC A;  5AIU A;  1JM7 B;  1LDK C;  5FER A;  1Z60 A;  3SOU A;  4BBQ A;  3ASL A;  2ECW A;  4N3W A;  1FP0 A;  2M1R A;  2F42 A;  2LRI C;  4YBS A;  2B0O E;  1VYX A;  4YC9 A;  1WEP A;  2XOC A;  3LVR E;  5SVI A;  4NN2 A;  3PUQ A;  3DPL R;  3KQI A;  2AN6 A;  2E61 A;  2FFW A;  2KWN A;  4UI9 B;  2ECG A;  1WFK A;  4PPE A;  2CSV A;  2FUU A;  1DCQ A;  2JMI A;  3MDB C;  5B77 A;  2DX8 A;  2YHN A;  4FIP A;  2OWA A;  3N9N A;  4ZDT A;  5I3L A;  4AYC A;  2EGM A;  1N87 A;  1X4J A;  3NG2 A;  3PHD A;  2G43 A;  5FEY A;  2QIZ A;  5LCW B;  3O33 A;  2KE1 A;  5LKU A;  4AP4 A;  5H1V A;  5G0F A;  4Z0R A;  3FEH A;  3LQJ A;  4YAB A;  4GND A;  1V87 A;  2YYR A;  2VPG A;  2VP7 A;  3N9O A;  5SVI B;  2IDA A;  4FJC A;  5B79 A;  2LDR A;  1MM3 A;  2CRW A;  2KWK A;  4Z0O A;  4I7B A;  2EA6 A;  5SVY A;  2FSA A;  2MA5 A;  2XP0 A;  2EXU A;  3ZVZ B;  5G05 B;  4R8P K;  2CKL A;  3SOW A;  2UZG A;  4F1P A;  4AYC B;  2YQM A;  4W4U A;  1T1H A;  5B8D A;  2YW8 A;  1Z2Q A;  4R2Y A;  3SHB A;  1G25 A;  5LKZ A;  4R7E A;  1WEN A;  2JUN A;  3SOX A;  3KV6 A;  2VNF A;  2LAU A;  2YQL A;  4GNF A;  3V43 A;  2QIC A;  2VJF A;  3KV5 A;  3E2D A;  3GV4 A;  2YUC A;  2ECN A;  3FM8 C;  5D1L B;  4O62 A;  4UP5 A;  2KR4 A;  1WEO A;  2F6N A;  3KDE C;  3I2D A;  5H9M A;  2XEU A;  4YAX A;  5JG6 A;  3HCU A;  3KNV A;  4LKA A;  2LGG A;  4A0C D;  2CKL B;  2C2V S;  4P5O B;  3HCS A;  2P57 A;  4YBT A;  5K3Q A;  3U5N A;  3H7H A;  2EGP A;  2MA6 A;  1WEM A;  2Y1N A;  4GNG A;  2F6J A;  5C11 A;  5DIN A;  2KRE A;  2Y43 A;  3T7L A;  4A4B A;  2LXH C;  2ZET C;  4GNE A;  2VJF B;  2CT2 A;  4FK5 A;  5H1T A;  2JMD A;  2VPE A;  5DKA A;  5TBN A;  3C6W A;  3U5P A;  2CRR A;  3MHS A;  1IYM A;  1DVP A;  3LDY A;  4MSX A;  2CON A;  3L1Z B;  1U6G B;  4IC2 A;  3ZPV E;  5TAB A;  5LKT A;  2LGK A;  2YSJ A;  1X4I A;  2FUI A;  2CSZ A;  2YU4 A;  4OGE A;  4YAT A;  3Q1D A;  4LLB A;  3N9P A;  5LKX A;  3HCT A;  1HYI A;  5KH9 A;  2YRE A;  4A49 A;  3PUR A;  4QF2 A;  2E6S A;  2XOY A;  2MIQ A;  4XI1 A;  1BOR A;  2EOD A;  2KKY A;  2MT5 A;  4CA1 A;  1VD4 A;  5B75 A;  2ECI A;  1HYJ A;  2L7P A;  2LV9 A;  4O64 A;  2M6M A;  4MVT A;  2RI7 A;  3U5M A;  3JUE A;  1MM2 A;  5J3X A;  3O47 A;  2MD8 C;  1WEQ A;  2K1J A;  3LQH A;  3LVQ E;  1LDJ B;  2H0D A;  1MBM A;  2KWJ A;  4WZ3 B;  2BAY A;  3FAO A;  5KH3 A;  5KH7 A;  2MNZ A;  4X3G A;  3FAN A;  3FL2 A;  3RPG C;  2MKE A;  4PTB A;  1VFY A;  5TDR A;  3SUB A;  2MNY A;  4I7C A;  3C5K A;  2OXQ C;  5FB1 A;  1WEV A;  3ZVY A;  2LN0 A;  3EB5 A;  2M13 A;  2KFT A;  5H1U A;  2L5U A;  5AIT A;  2L75 A;  1E4U A;  2D8U A;  3RPG B;  2IQJ A;  4ZUX U;  4Q6F A;  4ZQL A;  2RSD A;  5FB0 A;  3T9K A;  3M7K A;  2K16 A;  3QZV A;  3N9M A;  2VPD A;  3DDT A;  2LQ6 A;  1JOC A;  4AUQ B;  2DJA A;  2ECJ A;  2H0D B;  3ZTG A;  2KGI A;  2M85 A;  2G45 A;  3L1X A;  4WZ2 A;  2K4D A;  2YT5 A;  2G6Q A;  4S3O C;  4QQ4 A;  2L43 A;  4L58 A;  1XWH A;  4LJN A;  4LAD B;  3DQV R;  4I7D A;  5D1K B;  5SVX A;  2YUR A;  4C9Z A;  3ZNI A;  2PNX A;  3N9Q A;  3M99 A;  3O34 A;  3LQI A;  4F52 B;  2KGG A;  4S3O B;  3MHH A;  2NAA A;  2KIZ A;  1WE9 A;  3ZYQ A;  4GB0 A;  1FBV A;  1ZBD B;  5D1M B;  1WES A;  2DSM A;  2PUY A;  2L0B A;  2XB1 A;  3IHP A;  2ECT A;  2KU3 A;  5TDW A;  3DWD A;  4L7X A;  1CHC A;  2MUM A;  2KWO A;  4H9D A;  4B86 C;  2HDP A;  2JMJ A;  3PLW A;  5C13 A;  1Z6U A;  2D8S A;  3O70 A;  4LK9 A;  2LGL A;  5G04 B;  2KKX A;  3N9L A;  2ECV A;  2K17 A;  1WIM A;  2VJE A; 
#chains in the Genus database with same CATH homology
 2I50 A;  4TKP B;  2LGV A;  2LXP C;  4IC3 A;  2Y1M A;  1F62 A;  4V3K C;  5EYA F;  2JRJ A;  4BHW A;  2CSY A;  1WEE A;  3GL6 A;  3L11 A;  4QF3 A;  2E6R A;  1JM7 A;  3M63 A;  4A4C A;  3O37 A;  3U5O A;  4WA6 A;  4N4F A;  1X4U A;  3O35 A;  4FO9 A;  4WZ0 A;  1WIL A;  3ZPV 1;  4UP0 A;  3HTK C;  1WEU A;  4V3L C;  2C2L A;  2MD7 B;  3O7A A;  3O36 A;  1WEW A;  2L80 A;  2M3H A;  1K2F A;  4YAD A;  3VK6 A;  4AVX A;  3LRQ A;  2YHO A;  3EB6 A;  4CCG X;  2VJE B;  2QJ0 A;  2KYU A;  2YSM A;  1RMD A;  1WGM A;  4B7Y C;  2HYE D;  3M62 A;  3T6R A;  5TRB A;  3RTR B;  5B76 A;  2VPB A;  4YBM A;  5B78 A;  5AIU A;  1JM7 B;  1LDK C;  5FER A;  1Z60 A;  3SOU A;  4BBQ A;  3ASL A;  2ECW A;  4N3W A;  1FP0 A;  2M1R A;  2F42 A;  2LRI C;  4YBS A;  1VYX A;  4YC9 A;  1WEP A;  4NN2 A;  3PUQ A;  3DPL R;  3KQI A;  2AN6 A;  2KWN A;  4UI9 B;  2ECG A;  1WFK A;  4PPE A;  2FUU A;  2JMI A;  5B77 A;  2DX8 A;  2YHN A;  4FIP A;  3N9N A;  4ZDT A;  5I3L A;  4AYC A;  1N87 A;  1X4J A;  3NG2 A;  3PHD A;  2G43 A;  5FEY A;  2QIZ A;  5LCW B;  3O33 A;  2KE1 A;  5LKU A;  4AP4 A;  5H1V A;  5G0F A;  3LQJ A;  4YAB A;  4GND A;  1V87 A;  2YYR A;  2VPG A;  2VP7 A;  3N9O A;  2IDA A;  4FJC A;  5B79 A;  2LDR A;  1MM3 A;  2KWK A;  4I7B A;  2EA6 A;  2FSA A;  2MA5 A;  3ZVZ B;  5G05 B;  4R8P K;  2CKL A;  3SOW A;  2UZG A;  4AYC B;  2YQM A;  4W4U A;  1T1H A;  5B8D A;  2YW8 A;  1Z2Q A;  4R2Y A;  3SHB A;  1G25 A;  5LKZ A;  4R7E A;  1WEN A;  3SOX A;  3KV6 A;  2VNF A;  2YQL A;  4GNF A;  3V43 A;  2QIC A;  2VJF A;  3KV5 A;  3GV4 A;  2YUC A;  2ECN A;  5D1L B;  4UP5 A;  2KR4 A;  1WEO A;  2F6N A;  3I2D A;  5H9M A;  2XEU A;  4YAX A;  5JG6 A;  3HCU A;  3KNV A;  4LKA A;  2LGG A;  4A0C D;  2CKL B;  2C2V S;  4P5O B;  3HCS A;  4YBT A;  3U5N A;  2EGP A;  2MA6 A;  1WEM A;  2Y1N A;  4GNG A;  2F6J A;  5C11 A;  5DIN A;  2KRE A;  2Y43 A;  3T7L A;  4A4B A;  2LXH C;  2ZET C;  4GNE A;  2VJF B;  2CT2 A;  4FK5 A;  5H1T A;  2JMD A;  2VPE A;  5DKA A;  5TBN A;  3C6W A;  3U5P A;  3MHS A;  1IYM A;  1DVP A;  4MSX A;  3L1Z B;  1U6G B;  4IC2 A;  3ZPV E;  5TAB A;  5LKT A;  2LGK A;  2YSJ A;  1X4I A;  2FUI A;  2CSZ A;  2YU4 A;  4YAT A;  4LLB A;  3N9P A;  5LKX A;  3HCT A;  1HYI A;  5KH9 A;  2YRE A;  4A49 A;  3PUR A;  4QF2 A;  2E6S A;  2MIQ A;  4XI1 A;  1BOR A;  2EOD A;  2MT5 A;  4CA1 A;  1VD4 A;  5B75 A;  2ECI A;  1HYJ A;  2LV9 A;  4O64 A;  2M6M A;  4MVT A;  2RI7 A;  3U5M A;  1MM2 A;  5J3X A;  2MD8 C;  1WEQ A;  2K1J A;  3LQH A;  1LDJ B;  2H0D A;  2KWJ A;  4WZ3 B;  2BAY A;  5KH7 A;  5KH3 A;  2MNZ A;  4X3G A;  3FL2 A;  3RPG C;  4PTB A;  1VFY A;  5TDR A;  2MNY A;  4I7C A;  3C5K A;  2OXQ C;  5FB1 A;  1WEV A;  3ZVY A;  2LN0 A;  3EB5 A;  2KFT A;  5H1U A;  2L5U A;  5AIT A;  2L75 A;  1E4U A;  3RPG B;  4ZUX U;  4Q6F A;  4ZQL A;  2RSD A;  5FB0 A;  2K16 A;  3QZV A;  3N9M A;  2VPD A;  2LQ6 A;  1JOC A;  4AUQ B;  2ECJ A;  2H0D B;  3ZTG A;  2KGI A;  2M85 A;  2G45 A;  3L1X A;  4WZ2 A;  2K4D A;  2YT5 A;  2G6Q A;  4S3O C;  2L43 A;  4L58 A;  1XWH A;  4LJN A;  4LAD B;  3DQV R;  4I7D A;  5D1K B;  2YUR A;  4C9Z A;  3ZNI A;  2PNX A;  3N9Q A;  3M99 A;  3O34 A;  3LQI A;  4F52 B;  2KGG A;  4S3O B;  3MHH A;  2NAA A;  2KIZ A;  1WE9 A;  3ZYQ A;  4GB0 A;  1FBV A;  1ZBD B;  5D1M B;  1WES A;  2PUY A;  2L0B A;  2XB1 A;  3IHP A;  2ECT A;  2KU3 A;  5TDW A;  4L7X A;  1CHC A;  2MUM A;  2KWO A;  4B86 C;  2HDP A;  2JMJ A;  5C13 A;  1Z6U A;  2D8S A;  3O70 A;  4LK9 A;  2LGL A;  5G04 B;  3N9L A;  2ECV A;  2K17 A;  1WIM A;  2VJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...