2LDRA

Solution structure of helix-ring domain of cbl-b in the tyr363 phosphorylated form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
81
Chain Sequence
GPHMGSDHIKVTQEQYELCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Autoinhibition and phosphorylation-induced activation mechanisms of human cancer and autoimmune disease-related E3 protein Cbl-b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase CBL-B
total genus 11
structure length 81
sequence length 82
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ldrA00
2JMIA 2KE1A 3HCUA 3ASLA 5H1TA 1X4JA 5B76A 2HYED 1Z2QA 1E4UA 4AUQB 4X3GA 4BHWA 4XI1A 2VPGA 5D1MB 1X4UA 3VK6A 4FIPA 3U5OA 4LKAA 2VPDA 3RPGB 1WEEA 2LQ6A 2F6JA 2RSDA 2E6SA 4A0CD 1HYIA 2L43A 3N9MA 2LV9A 3U5PA 1WENA 3DQVR 4S3OB 5TDRA 3O70A 4A4CA 1WEOA 5H9MA 2Y43A 2KYUA 4WA6A 2VJEB 5G04B 4I7BA 2OXQC 1VYXA 4O64A 1WFKA 2YW8A 2G45A 2DX8A 2CKLB 5FEYA 3GL6A 2LDRA 1RMDA 3HCTA 2HDPA 4YBSA 2EODA 4CCGX 4L7XA 2JRJA 4LLBA 5I3LA 3HTKC 4CA1A 4R2YA 2YHOA 2AN6A 5J3XA 4R7EA 2LGVA 2PUYA 2RI7A 3M63A 3KV6A 5H1UA 3ZVZB 2YREA 3SOUA 1BORA 4YABA 3O37A 2UZGA 5C11A 2QJ0A 2YQLA 3EB5A 5B77A 2VP7A 4I7DA 1WILA 2YYRA 5B8DA 2M1RA 3L11A 2ECJA 4UP0A 1LDJB 1JM7B 2IDAA 2K17A 2YQMA 4GB0A 4QF2A 1MM2A 4GNGA 4AP4A 2KWOA 3O34A 4YBTA 1CHCA 2CSZA 4WZ0A 2LN0A 4MVTA 2LXPC 1JM7A 2FUIA 3MHSA 2L80A 4W4UA 4AVXA 4FO9A 2F6NA 3EB6A 2QICA 5DKAA 3U5NA 5KH9A 3NG2A 2KGIA 5LKZA 4GNDA 1VD4A 1XWHA 2MNZA 2M6MA 2KWJA 3U5MA 2LGGA 3FL2A 4FK5A 2BAYA 4YADA 2CSYA 5TBNA 2VNFA 3MHHA 3ZPVE 3LQHA 5LKXA 3ZNIA 3N9NA 2D8SA 1WEQA 2MD7B 3KQIA 5FERA 4QF3A 3T6RA 2FUUA 1DVPA 3C6WA 4WZ2A 1VFYA 4WZ3B 4GNFA 4IC3A 2LGLA 1N87A 4BBQA 2M85A 3N9QA 5TDWA 1WEMA 3ZPV1 2ECWA 3N9LA 1V87A 1Z60A 2KR4A 5LKUA 2NAAA 4N4FA 4LADB 3PUQA 3T7LA 3C5KA 5TRBA 5FB1A 2ECTA 2KIZA 2MT5A 4V3KC 2VPEA 5FB0A 5TABA 5B78A 3RTRB 5KH7A 4AYCA 2KWNA 5D1KB 2ECIA 2JMDA 2MD8C 1Z6UA 2EA6A 3SHBA 4ZUXU 5AIUA 1MM3A 2VJFB 2QIZA 2FSAA 3IHPA 4L58A 4YAXA 1IYMA 2H0DB 2VPBA 2MA5A 2VJEA 3M99A 4P5OB 4LJNA 1WEVA 5D1LB 2XB1A 2K1JA 4MSXA 2CT2A 2M3HA 2LRIC 5C13A 4R8PK 2H0DA 2VJFA 2Y1NA 4ZDTA 2Y1MA 2YURA 2K4DA 3O7AA 2L0BA 2I50A 1WESA 3LRQA 3ZTGA 2LXHC 2MUMA 2ECVA 2YUCA 2CKLA 1G25A 4V3LC 1LDKC 2ECNA 3O35A 2YHNA 4PPEA 2LGKA 2K16A 4B86C 5B79A 2ECGA 2MNYA 3DPLR 1F62A 2G43A 1WEPA 5B75A 2KREA 3M62A 1FP0A 1WEUA 2C2VS 2MA6A 4UI9B 2YU4A 3O33A 3ZVYA 2KWKA 4A49A 5H1VA 2XEUA 3N9PA 2KFTA 3KNVA 3V43A 4S3OC 2L75A 2YT5A 3L1ZB 3SOWA 3LQJA 4ZQLA 1HYJA 3RPGC 3I2DA 1K2FA 3N9OA 1X4IA 4N3WA 3GV4A 1U6GB 2JMJA 3HCSA 1WE9A 2EGPA 2ZETC 1WGMA 4FJCA 4PTBA 2L5UA 3PURA 1ZBDB 2PNXA 2YSMA 4LK9A 3ZYQA 1FBVA 4IC2A 3SOXA 2F42A 5DINA 4Q6FA 5LKTA 3LQIA 1JOCA 5LCWB 2KU3A 2G6QA 2KGGA 5G05B 1T1HA 1WIMA 4UP5A 4B7YC 3KV5A 1WEWA 5KH3A 4YC9A 4C9ZA 4NN2A 3L1XA 4TKPB 4AYCB 3PHDA 2YSJA 5JG6A 5G0FA 4F52B 4GNEA 5EYAF 2C2LA 4YATA 4I7CA 2E6RA 4YBMA 3O36A 4A4BA 5AITA 2MIQA 3QZVA
chains in the Genus database with same CATH superfamily
2JMIA 2KE1A 3HCUA 3ASLA 5H1TA 1X4JA 5B76A 2HYED 1Z2QA 1E4UA 4AUQB 4OGEA 4X3GA 4BHWA 4XI1A 2VPGA 5D1MB 1X4UA 3VK6A 4FIPA 3U5OA 4LKAA 2VPDA 3RPGB 1WEEA 2LQ6A 2F6JA 2RSDA 2E6SA 4A0CD 1HYIA 2L43A 3N9MA 2LV9A 3U5PA 1WENA 3DQVR 4S3OB 5TDRA 3O70A 4A4CA 1WEOA 5H9MA 4H9DA 2Y43A 2KYUA 4WA6A 2VJEB 5G04B 2XOYA 4I7BA 2LAUA 2OXQC 1VYXA 4O64A 1WFKA 2YW8A 2G45A 2DX8A 2DJAA 2CKLB 5FEYA 3GL6A 2LDRA 1RMDA 3HCTA 2HDPA 2EODA 4YBSA 4CCGX 4L7XA 2JRJA 4LLBA 5I3LA 3HTKC 4CA1A 4R2YA 2YHOA 2AN6A 5J3XA 4R7EA 2LGVA 2PUYA 2RI7A 3M63A 3KV6A 5H1UA 3ZVZB 2YREA 3SOUA 1BORA 4YABA 3O37A 2UZGA 5C11A 2QJ0A 3FM8C 2YQLA 3EB5A 5B77A 2VP7A 2IQJA 4I7DA 1WILA 2YYRA 5B8DA 2M1RA 3L11A 2ECJA 4UP0A 1LDJB 1JM7B 4O62A 3O47A 2IDAA 2K17A 3FANA 2YQMA 4GB0A 4QF2A 1MM2A 2RR4A 4GNGA 2XP0A 4AP4A 2KWOA 3O34A 4YBTA 2XOZA 1CHCA 2CSZA 4WZ0A 2KKYA 2LN0A 4MVTA 2LXPC 1JM7A 2FUIA 3MHSA 2L80A 4W4UA 4AVXA 4FO9A 2F6NA 3EB6A 1DCQA 2QICA 5DKAA 5SVIA 3U5NA 5KH9A 3NG2A 2KGIA 5LKZA 4GNDA 1VD4A 1XWHA 2MNZA 2M6MA 2KWJA 3FEHA 3U5MA 2LGGA 3FL2A 4FK5A 2FFWA 2BAYA 2JM3A 4YADA 2CSYA 3PLWA 5TBNA 2VNFA 3MHHA 3ZPVE 3LQHA 5LKXA 5SVIB 3ZNIA 3E2DA 2D8SA 3N9NA 1WEQA 2MD7B 3KQIA 5FERA 4QF3A 3T6RA 2FUUA 1DVPA 2D8UA 3C6WA 2XOCA 3FAOA 4WZ2A 5SVXA 3DWDA 1VFYA 4WZ3B 4GNFA 4IC3A 2LGLA 1N87A 4BBQA 2M85A 3N9QA 5TDWA 1WEMA 3ZPV1 2M13A 2ECWA 3N9LA 1V87A 1Z60A 2KR4A 5LKUA 2NAAA 4N4FA 2DSMA 4LADB 3PUQA 3T7LA 3C5KA 5TRBA 5FB1A 2ECTA 2KIZA 2KKXA 2MT5A 4V3KC 2VPEA 5FB0A 5TABA 5B78A 3RTRB 5KH7A 4AYCA 2P57A 2KWNA 2E61A 1MBMA 5D1KB 2ECIA 2JMDA 2MD8C 1Z6UA 2EA6A 3SHBA 4ZUXU 5AIUA 1MM3A 2VJFB 2EGMA 2QIZA 2FSAA 3IHPA 4L58A 4YAXA 1IYMA 2FD4A 2CRRA 2H0DB 2VPBA 2MA5A 2VJEA 3LJUX 3M99A 2OWAA 4P5OB 4LJNA 1WEVA 2JUNA 5D1LB 4Z0OA 2XB1A 2K1JA 3M7KA 4MSXA 2CT2A 2M3HA 2LRIC 3LDYA 5C13A 2CRWA 4R8PK 2H0DA 2VJFA 2Y1NA 4ZDTA 2Y1MA 3LVRE 2YURA 2K4DA 3O7AA 2L0BA 2I50A 1WESA 3LRQA 3H7HA 3SUBA 3ZTGA 2LXHC 2MUMA 2ECVA 2YUCA 3KDEC 2L7PA 2CKLA 1G25A 4V3LC 1LDKC 2ECNA 3O35A 2YHNA 4PPEA 2LGKA 2EXUA 4QQ4A 2K16A 4B86C 5B79A 2ECGA 2MNYA 3DPLR 1F62A 2G43A 1WEPA 5B75A 2KREA 3M62A 1FP0A 1WEUA 2C2VS 2MA6A 4UI9B 2YU4A 3O33A 3ZVYA 2KWKA 4A49A 5H1VA 2XEUA 3N9PA 5K3QA 2KFTA 3KNVA 3V43A 4S3OC 2L75A 3Q1DA 2YT5A 3L1ZB 3SOWA 3LQJA 4ZQLA 1HYJA 3RPGC 3I2DA 1K2FA 3N9OA 1X4IA 4N3WA 5SVYA 3MDBC 3GV4A 1U6GB 2JMJA 3HCSA 1WE9A 2EGPA 2ZETC 1WGMA 2B0OE 4Z0RA 3FJUB 4FJCA 4PTBA 2L5UA 3PURA 1ZBDB 2PNXA 2YSMA 4LK9A 3T9KA 1FBVA 3ZYQA 4IC2A 3SOXA 4F1PA 2F42A 4OGCA 5DINA 4Q6FA 5LKTA 3LQIA 1JOCA 5LCWB 2KU3A 2CONA 2G6QA 2KGGA 5G05B 1T1HA 1WIMA 3LVQE 4UP5A 4B7YC 3KV5A 1WEWA 5KH3A 4YC9A 4C9ZA 4NN2A 3L1XA 4TKPB 4AYCB 3PHDA 2YSJA 5JG6A 3JUEA 5G0FA 4F52B 4GNEA 5EYAF 2MKEA 2C2LA 2CSVA 2YVRA 3DDTA 4YATA 4I7CA 2E6RA 4YBMA 3O36A 4A4BA 5AITA 2MIQA 3QZVA
chains in the Genus database with same CATH topology
2JMIA 2KE1A 3HCUA 3ASLA 5H1TA 1X4JA 5B76A 2HYED 1Z2QA 1E4UA 4AUQB 4X3GA 4BHWA 4XI1A 2VPGA 5D1MB 1X4UA 3VK6A 4FIPA 3U5OA 4LKAA 2VPDA 3RPGB 1WEEA 2LQ6A 2F6JA 2RSDA 2E6SA 4A0CD 1HYIA 2L43A 3N9MA 2LV9A 3U5PA 1WENA 3DQVR 4S3OB 5TDRA 3O70A 4A4CA 1WEOA 5H9MA 2Y43A 2KYUA 4WA6A 2VJEB 5G04B 4I7BA 2OXQC 1VYXA 4O64A 1WFKA 2YW8A 2G45A 2DX8A 2CKLB 5FEYA 3GL6A 2LDRA 1RMDA 3HCTA 2HDPA 4YBSA 2EODA 4CCGX 4L7XA 2JRJA 4LLBA 5I3LA 3HTKC 4CA1A 4R2YA 2YHOA 2AN6A 5J3XA 4R7EA 2LGVA 2PUYA 2RI7A 3M63A 3KV6A 5H1UA 3ZVZB 2YREA 3SOUA 1BORA 4YABA 3O37A 2UZGA 5C11A 2QJ0A 2YQLA 3EB5A 5B77A 2VP7A 4I7DA 1WILA 2YYRA 5B8DA 2M1RA 3L11A 2ECJA 4UP0A 1LDJB 1JM7B 2IDAA 2K17A 2YQMA 4GB0A 4QF2A 1MM2A 4GNGA 4AP4A 2KWOA 3O34A 4YBTA 1CHCA 2CSZA 4WZ0A 2LN0A 4MVTA 2LXPC 1JM7A 2FUIA 3MHSA 2L80A 4W4UA 4AVXA 4FO9A 2F6NA 3EB6A 2QICA 5DKAA 3U5NA 5KH9A 3NG2A 2KGIA 5LKZA 4GNDA 1VD4A 1XWHA 2MNZA 2M6MA 2KWJA 3U5MA 2LGGA 3FL2A 4FK5A 2BAYA 4YADA 2CSYA 5TBNA 2VNFA 3MHHA 3ZPVE 3LQHA 5LKXA 3ZNIA 3N9NA 2D8SA 1WEQA 2MD7B 3KQIA 5FERA 4QF3A 3T6RA 2FUUA 1DVPA 3C6WA 4WZ2A 1VFYA 4WZ3B 4GNFA 4IC3A 2LGLA 1N87A 4BBQA 2M85A 3N9QA 5TDWA 1WEMA 3ZPV1 2ECWA 3N9LA 1V87A 1Z60A 2KR4A 5LKUA 2NAAA 4N4FA 4LADB 3PUQA 3T7LA 3C5KA 5TRBA 5FB1A 2ECTA 2KIZA 2MT5A 4V3KC 2VPEA 5FB0A 5TABA 5B78A 3RTRB 5KH7A 4AYCA 2KWNA 5D1KB 2ECIA 2JMDA 2MD8C 1Z6UA 2EA6A 3SHBA 4ZUXU 5AIUA 1MM3A 2VJFB 2QIZA 2FSAA 3IHPA 4L58A 4YAXA 1IYMA 2H0DB 2VPBA 2MA5A 2VJEA 3M99A 4P5OB 4LJNA 1WEVA 5D1LB 2XB1A 2K1JA 4MSXA 2CT2A 2M3HA 2LRIC 5C13A 4R8PK 2H0DA 2VJFA 2Y1NA 4ZDTA 2Y1MA 2YURA 2K4DA 3O7AA 2L0BA 2I50A 1WESA 3LRQA 3ZTGA 2LXHC 2MUMA 2ECVA 2YUCA 2CKLA 1G25A 4V3LC 1LDKC 2ECNA 3O35A 2YHNA 4PPEA 2LGKA 2K16A 4B86C 5B79A 2ECGA 2MNYA 3DPLR 1F62A 2G43A 1WEPA 5B75A 2KREA 3M62A 1FP0A 1WEUA 2C2VS 2MA6A 4UI9B 2YU4A 3O33A 3ZVYA 2KWKA 4A49A 5H1VA 2XEUA 3N9PA 2KFTA 3KNVA 3V43A 4S3OC 2L75A 2YT5A 3L1ZB 3SOWA 3LQJA 4ZQLA 1HYJA 3RPGC 3I2DA 1K2FA 3N9OA 1X4IA 4N3WA 3GV4A 1U6GB 2JMJA 3HCSA 1WE9A 2EGPA 2ZETC 1WGMA 4FJCA 4PTBA 2L5UA 3PURA 1ZBDB 2PNXA 2YSMA 4LK9A 3ZYQA 1FBVA 4IC2A 3SOXA 2F42A 5DINA 4Q6FA 5LKTA 3LQIA 1JOCA 5LCWB 2KU3A 2G6QA 2KGGA 5G05B 1T1HA 1WIMA 4UP5A 4B7YC 3KV5A 1WEWA 5KH3A 4YC9A 4C9ZA 4NN2A 3L1XA 4TKPB 4AYCB 3PHDA 2YSJA 5JG6A 5G0FA 4F52B 4GNEA 5EYAF 2C2LA 4YATA 4I7CA 2E6RA 4YBMA 3O36A 4A4BA 5AITA 2MIQA 3QZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMI A;  2KE1 A;  3HCU A;  3ASL A;  5H1T A;  1X4J A;  5B76 A;  2HYE D;  1Z2Q A;  1E4U A;  4AUQ B;  4X3G A;  4BHW A;  4XI1 A;  2VPG A;  5D1M B;  1X4U A;  3VK6 A;  4FIP A;  3U5O A;  4LKA A;  2VPD A;  3RPG B;  1WEE A;  2LQ6 A;  2F6J A;  2RSD A;  2E6S A;  4A0C D;  1HYI A;  2L43 A;  3N9M A;  2LV9 A;  3U5P A;  1WEN A;  3DQV R;  4S3O B;  5TDR A;  3O70 A;  4A4C A;  1WEO A;  5H9M A;  2Y43 A;  2KYU A;  4WA6 A;  2VJE B;  5G04 B;  4I7B A;  2OXQ C;  1VYX A;  4O64 A;  1WFK A;  2YW8 A;  2G45 A;  2DX8 A;  2CKL B;  5FEY A;  3GL6 A;  2LDR A;  1RMD A;  3HCT A;  2HDP A;  4YBS A;  2EOD A;  4CCG X;  4L7X A;  2JRJ A;  4LLB A;  5I3L A;  3HTK C;  4CA1 A;  4R2Y A;  2YHO A;  2AN6 A;  5J3X A;  4R7E A;  2LGV A;  2PUY A;  2RI7 A;  3M63 A;  3KV6 A;  5H1U A;  3ZVZ B;  2YRE A;  3SOU A;  1BOR A;  4YAB A;  3O37 A;  2UZG A;  5C11 A;  2QJ0 A;  2YQL A;  3EB5 A;  5B77 A;  2VP7 A;  4I7D A;  1WIL A;  2YYR A;  5B8D A;  2M1R A;  3L11 A;  2ECJ A;  4UP0 A;  1LDJ B;  1JM7 B;  2IDA A;  2K17 A;  2YQM A;  4GB0 A;  4QF2 A;  1MM2 A;  4GNG A;  4AP4 A;  2KWO A;  3O34 A;  4YBT A;  1CHC A;  2CSZ A;  4WZ0 A;  2LN0 A;  4MVT A;  2LXP C;  1JM7 A;  2FUI A;  3MHS A;  2L80 A;  4W4U A;  4AVX A;  4FO9 A;  2F6N A;  3EB6 A;  2QIC A;  5DKA A;  3U5N A;  5KH9 A;  3NG2 A;  2KGI A;  5LKZ A;  4GND A;  1VD4 A;  1XWH A;  2MNZ A;  2M6M A;  2KWJ A;  3U5M A;  2LGG A;  3FL2 A;  4FK5 A;  2BAY A;  4YAD A;  2CSY A;  5TBN A;  2VNF A;  3MHH A;  3ZPV E;  3LQH A;  5LKX A;  3ZNI A;  3N9N A;  2D8S A;  1WEQ A;  2MD7 B;  3KQI A;  5FER A;  4QF3 A;  3T6R A;  2FUU A;  1DVP A;  3C6W A;  4WZ2 A;  1VFY A;  4WZ3 B;  4GNF A;  4IC3 A;  2LGL A;  1N87 A;  4BBQ A;  2M85 A;  3N9Q A;  5TDW A;  1WEM A;  3ZPV 1;  2ECW A;  3N9L A;  1V87 A;  1Z60 A;  2KR4 A;  5LKU A;  2NAA A;  4N4F A;  4LAD B;  3PUQ A;  3T7L A;  3C5K A;  5TRB A;  5FB1 A;  2ECT A;  2KIZ A;  2MT5 A;  4V3K C;  2VPE A;  5FB0 A;  5TAB A;  5B78 A;  3RTR B;  5KH7 A;  4AYC A;  2KWN A;  5D1K B;  2ECI A;  2JMD A;  2MD8 C;  1Z6U A;  2EA6 A;  3SHB A;  4ZUX U;  5AIU A;  1MM3 A;  2VJF B;  2QIZ A;  2FSA A;  3IHP A;  4L58 A;  4YAX A;  1IYM A;  2H0D B;  2VPB A;  2MA5 A;  2VJE A;  3M99 A;  4P5O B;  4LJN A;  1WEV A;  5D1L B;  2XB1 A;  2K1J A;  4MSX A;  2CT2 A;  2M3H A;  2LRI C;  5C13 A;  4R8P K;  2H0D A;  2VJF A;  2Y1N A;  4ZDT A;  2Y1M A;  2YUR A;  2K4D A;  3O7A A;  2L0B A;  2I50 A;  1WES A;  3LRQ A;  3ZTG A;  2LXH C;  2MUM A;  2ECV A;  2YUC A;  2CKL A;  1G25 A;  4V3L C;  1LDK C;  2ECN A;  3O35 A;  2YHN A;  4PPE A;  2LGK A;  2K16 A;  4B86 C;  5B79 A;  2ECG A;  2MNY A;  3DPL R;  1F62 A;  2G43 A;  1WEP A;  5B75 A;  2KRE A;  3M62 A;  1FP0 A;  1WEU A;  2C2V S;  2MA6 A;  4UI9 B;  2YU4 A;  3O33 A;  3ZVY A;  2KWK A;  4A49 A;  5H1V A;  2XEU A;  3N9P A;  2KFT A;  3KNV A;  3V43 A;  4S3O C;  2L75 A;  2YT5 A;  3L1Z B;  3SOW A;  3LQJ A;  4ZQL A;  1HYJ A;  3RPG C;  3I2D A;  1K2F A;  3N9O A;  1X4I A;  4N3W A;  3GV4 A;  1U6G B;  2JMJ A;  3HCS A;  1WE9 A;  2EGP A;  2ZET C;  1WGM A;  4FJC A;  4PTB A;  2L5U A;  3PUR A;  1ZBD B;  2PNX A;  2YSM A;  4LK9 A;  3ZYQ A;  1FBV A;  4IC2 A;  3SOX A;  2F42 A;  5DIN A;  4Q6F A;  5LKT A;  3LQI A;  1JOC A;  5LCW B;  2KU3 A;  2G6Q A;  2KGG A;  5G05 B;  1T1H A;  1WIM A;  4UP5 A;  4B7Y C;  3KV5 A;  1WEW A;  5KH3 A;  4YC9 A;  4C9Z A;  4NN2 A;  3L1X A;  4TKP B;  4AYC B;  3PHD A;  2YSJ A;  5JG6 A;  5G0F A;  4F52 B;  4GNE A;  5EYA F;  2C2L A;  4YAT A;  4I7C A;  2E6R A;  4YBM A;  3O36 A;  4A4B A;  5AIT A;  2MIQ A;  3QZV A; 
#chains in the Genus database with same CATH topology
 2JMI A;  2KE1 A;  3HCU A;  3ASL A;  5H1T A;  1X4J A;  5B76 A;  2HYE D;  1Z2Q A;  1E4U A;  4AUQ B;  4OGE A;  4X3G A;  4BHW A;  4XI1 A;  2VPG A;  5D1M B;  1X4U A;  3VK6 A;  4FIP A;  3U5O A;  4LKA A;  2VPD A;  3RPG B;  1WEE A;  2LQ6 A;  2F6J A;  2RSD A;  2E6S A;  4A0C D;  1HYI A;  2L43 A;  3N9M A;  2LV9 A;  3U5P A;  1WEN A;  3DQV R;  4S3O B;  5TDR A;  3O70 A;  4A4C A;  1WEO A;  5H9M A;  4H9D A;  2Y43 A;  2KYU A;  4WA6 A;  2VJE B;  5G04 B;  2XOY A;  4I7B A;  2LAU A;  2OXQ C;  1VYX A;  4O64 A;  1WFK A;  2YW8 A;  2G45 A;  2DX8 A;  2DJA A;  2CKL B;  5FEY A;  3GL6 A;  2LDR A;  1RMD A;  3HCT A;  2HDP A;  2EOD A;  4YBS A;  4CCG X;  4L7X A;  2JRJ A;  4LLB A;  5I3L A;  3HTK C;  4CA1 A;  4R2Y A;  2YHO A;  2AN6 A;  5J3X A;  4R7E A;  2LGV A;  2PUY A;  2RI7 A;  3M63 A;  3KV6 A;  5H1U A;  3ZVZ B;  2YRE A;  3SOU A;  1BOR A;  4YAB A;  3O37 A;  2UZG A;  5C11 A;  2QJ0 A;  3FM8 C;  2YQL A;  3EB5 A;  5B77 A;  2VP7 A;  2IQJ A;  4I7D A;  1WIL A;  2YYR A;  5B8D A;  2M1R A;  3L11 A;  2ECJ A;  4UP0 A;  1LDJ B;  1JM7 B;  4O62 A;  3O47 A;  2IDA A;  2K17 A;  3FAN A;  2YQM A;  4GB0 A;  4QF2 A;  1MM2 A;  2RR4 A;  4GNG A;  2XP0 A;  4AP4 A;  2KWO A;  3O34 A;  4YBT A;  2XOZ A;  1CHC A;  2CSZ A;  4WZ0 A;  2KKY A;  2LN0 A;  4MVT A;  2LXP C;  1JM7 A;  2FUI A;  3MHS A;  2L80 A;  4W4U A;  4AVX A;  4FO9 A;  2F6N A;  3EB6 A;  1DCQ A;  2QIC A;  5DKA A;  5SVI A;  3U5N A;  5KH9 A;  3NG2 A;  2KGI A;  5LKZ A;  4GND A;  1VD4 A;  1XWH A;  2MNZ A;  2M6M A;  2KWJ A;  3FEH A;  3U5M A;  2LGG A;  3FL2 A;  4FK5 A;  2FFW A;  2BAY A;  2JM3 A;  4YAD A;  2CSY A;  3PLW A;  5TBN A;  2VNF A;  3MHH A;  3ZPV E;  3LQH A;  5LKX A;  5SVI B;  3ZNI A;  3E2D A;  2D8S A;  3N9N A;  1WEQ A;  2MD7 B;  3KQI A;  5FER A;  4QF3 A;  3T6R A;  2FUU A;  1DVP A;  2D8U A;  3C6W A;  2XOC A;  3FAO A;  4WZ2 A;  5SVX A;  3DWD A;  1VFY A;  4WZ3 B;  4GNF A;  4IC3 A;  2LGL A;  1N87 A;  4BBQ A;  2M85 A;  3N9Q A;  5TDW A;  1WEM A;  3ZPV 1;  2M13 A;  2ECW A;  3N9L A;  1V87 A;  1Z60 A;  2KR4 A;  5LKU A;  2NAA A;  4N4F A;  2DSM A;  4LAD B;  3PUQ A;  3T7L A;  3C5K A;  5TRB A;  5FB1 A;  2ECT A;  2KIZ A;  2KKX A;  2MT5 A;  4V3K C;  2VPE A;  5FB0 A;  5TAB A;  5B78 A;  3RTR B;  5KH7 A;  4AYC A;  2P57 A;  2KWN A;  2E61 A;  1MBM A;  5D1K B;  2ECI A;  2JMD A;  2MD8 C;  1Z6U A;  2EA6 A;  3SHB A;  4ZUX U;  5AIU A;  1MM3 A;  2VJF B;  2EGM A;  2QIZ A;  2FSA A;  3IHP A;  4L58 A;  4YAX A;  1IYM A;  2FD4 A;  2CRR A;  2H0D B;  2VPB A;  2MA5 A;  2VJE A;  3LJU X;  3M99 A;  2OWA A;  4P5O B;  4LJN A;  1WEV A;  2JUN A;  5D1L B;  4Z0O A;  2XB1 A;  2K1J A;  3M7K A;  4MSX A;  2CT2 A;  2M3H A;  2LRI C;  3LDY A;  5C13 A;  2CRW A;  4R8P K;  2H0D A;  2VJF A;  2Y1N A;  4ZDT A;  2Y1M A;  3LVR E;  2YUR A;  2K4D A;  3O7A A;  2L0B A;  2I50 A;  1WES A;  3LRQ A;  3H7H A;  3SUB A;  3ZTG A;  2LXH C;  2MUM A;  2ECV A;  2YUC A;  3KDE C;  2L7P A;  2CKL A;  1G25 A;  4V3L C;  1LDK C;  2ECN A;  3O35 A;  2YHN A;  4PPE A;  2LGK A;  2EXU A;  4QQ4 A;  2K16 A;  4B86 C;  5B79 A;  2ECG A;  2MNY A;  3DPL R;  1F62 A;  2G43 A;  1WEP A;  5B75 A;  2KRE A;  3M62 A;  1FP0 A;  1WEU A;  2C2V S;  2MA6 A;  4UI9 B;  2YU4 A;  3O33 A;  3ZVY A;  2KWK A;  4A49 A;  5H1V A;  2XEU A;  3N9P A;  5K3Q A;  2KFT A;  3KNV A;  3V43 A;  4S3O C;  2L75 A;  3Q1D A;  2YT5 A;  3L1Z B;  3SOW A;  3LQJ A;  4ZQL A;  1HYJ A;  3RPG C;  3I2D A;  1K2F A;  3N9O A;  1X4I A;  4N3W A;  5SVY A;  3MDB C;  3GV4 A;  1U6G B;  2JMJ A;  3HCS A;  1WE9 A;  2EGP A;  2ZET C;  1WGM A;  2B0O E;  4Z0R A;  3FJU B;  4FJC A;  4PTB A;  2L5U A;  3PUR A;  1ZBD B;  2PNX A;  2YSM A;  4LK9 A;  3T9K A;  1FBV A;  3ZYQ A;  4IC2 A;  3SOX A;  4F1P A;  2F42 A;  4OGC A;  5DIN A;  4Q6F A;  5LKT A;  3LQI A;  1JOC A;  5LCW B;  2KU3 A;  2CON A;  2G6Q A;  2KGG A;  5G05 B;  1T1H A;  1WIM A;  3LVQ E;  4UP5 A;  4B7Y C;  3KV5 A;  1WEW A;  5KH3 A;  4YC9 A;  4C9Z A;  4NN2 A;  3L1X A;  4TKP B;  4AYC B;  3PHD A;  2YSJ A;  5JG6 A;  3JUE A;  5G0F A;  4F52 B;  4GNE A;  5EYA F;  2MKE A;  2C2L A;  2CSV A;  2YVR A;  3DDT A;  4YAT A;  4I7C A;  2E6R A;  4YBM A;  3O36 A;  4A4B A;  5AIT A;  2MIQ A;  3QZV A; 
#chains in the Genus database with same CATH homology
 2JMI A;  2KE1 A;  3HCU A;  3ASL A;  5H1T A;  1X4J A;  5B76 A;  2HYE D;  1Z2Q A;  1E4U A;  4AUQ B;  4X3G A;  4BHW A;  4XI1 A;  2VPG A;  5D1M B;  1X4U A;  3VK6 A;  4FIP A;  3U5O A;  4LKA A;  2VPD A;  3RPG B;  1WEE A;  2LQ6 A;  2F6J A;  2RSD A;  2E6S A;  4A0C D;  1HYI A;  2L43 A;  3N9M A;  2LV9 A;  3U5P A;  1WEN A;  3DQV R;  4S3O B;  5TDR A;  3O70 A;  4A4C A;  1WEO A;  5H9M A;  2Y43 A;  2KYU A;  4WA6 A;  2VJE B;  5G04 B;  4I7B A;  2OXQ C;  1VYX A;  4O64 A;  1WFK A;  2YW8 A;  2G45 A;  2DX8 A;  2CKL B;  5FEY A;  3GL6 A;  2LDR A;  1RMD A;  3HCT A;  2HDP A;  4YBS A;  2EOD A;  4CCG X;  4L7X A;  2JRJ A;  4LLB A;  5I3L A;  3HTK C;  4CA1 A;  4R2Y A;  2YHO A;  2AN6 A;  5J3X A;  4R7E A;  2LGV A;  2PUY A;  2RI7 A;  3M63 A;  3KV6 A;  5H1U A;  3ZVZ B;  2YRE A;  3SOU A;  1BOR A;  4YAB A;  3O37 A;  2UZG A;  5C11 A;  2QJ0 A;  2YQL A;  3EB5 A;  5B77 A;  2VP7 A;  4I7D A;  1WIL A;  2YYR A;  5B8D A;  2M1R A;  3L11 A;  2ECJ A;  4UP0 A;  1LDJ B;  1JM7 B;  2IDA A;  2K17 A;  2YQM A;  4GB0 A;  4QF2 A;  1MM2 A;  4GNG A;  4AP4 A;  2KWO A;  3O34 A;  4YBT A;  1CHC A;  2CSZ A;  4WZ0 A;  2LN0 A;  4MVT A;  2LXP C;  1JM7 A;  2FUI A;  3MHS A;  2L80 A;  4W4U A;  4AVX A;  4FO9 A;  2F6N A;  3EB6 A;  2QIC A;  5DKA A;  3U5N A;  5KH9 A;  3NG2 A;  2KGI A;  5LKZ A;  4GND A;  1VD4 A;  1XWH A;  2MNZ A;  2M6M A;  2KWJ A;  3U5M A;  2LGG A;  3FL2 A;  4FK5 A;  2BAY A;  4YAD A;  2CSY A;  5TBN A;  2VNF A;  3MHH A;  3ZPV E;  3LQH A;  5LKX A;  3ZNI A;  3N9N A;  2D8S A;  1WEQ A;  2MD7 B;  3KQI A;  5FER A;  4QF3 A;  3T6R A;  2FUU A;  1DVP A;  3C6W A;  4WZ2 A;  1VFY A;  4WZ3 B;  4GNF A;  4IC3 A;  2LGL A;  1N87 A;  4BBQ A;  2M85 A;  3N9Q A;  5TDW A;  1WEM A;  3ZPV 1;  2ECW A;  3N9L A;  1V87 A;  1Z60 A;  2KR4 A;  5LKU A;  2NAA A;  4N4F A;  4LAD B;  3PUQ A;  3T7L A;  3C5K A;  5TRB A;  5FB1 A;  2ECT A;  2KIZ A;  2MT5 A;  4V3K C;  2VPE A;  5FB0 A;  5TAB A;  5B78 A;  3RTR B;  5KH7 A;  4AYC A;  2KWN A;  5D1K B;  2ECI A;  2JMD A;  2MD8 C;  1Z6U A;  2EA6 A;  3SHB A;  4ZUX U;  5AIU A;  1MM3 A;  2VJF B;  2QIZ A;  2FSA A;  3IHP A;  4L58 A;  4YAX A;  1IYM A;  2H0D B;  2VPB A;  2MA5 A;  2VJE A;  3M99 A;  4P5O B;  4LJN A;  1WEV A;  5D1L B;  2XB1 A;  2K1J A;  4MSX A;  2CT2 A;  2M3H A;  2LRI C;  5C13 A;  4R8P K;  2H0D A;  2VJF A;  2Y1N A;  4ZDT A;  2Y1M A;  2YUR A;  2K4D A;  3O7A A;  2L0B A;  2I50 A;  1WES A;  3LRQ A;  3ZTG A;  2LXH C;  2MUM A;  2ECV A;  2YUC A;  2CKL A;  1G25 A;  4V3L C;  1LDK C;  2ECN A;  3O35 A;  2YHN A;  4PPE A;  2LGK A;  2K16 A;  4B86 C;  5B79 A;  2ECG A;  2MNY A;  3DPL R;  1F62 A;  2G43 A;  1WEP A;  5B75 A;  2KRE A;  3M62 A;  1FP0 A;  1WEU A;  2C2V S;  2MA6 A;  4UI9 B;  2YU4 A;  3O33 A;  3ZVY A;  2KWK A;  4A49 A;  5H1V A;  2XEU A;  3N9P A;  2KFT A;  3KNV A;  3V43 A;  4S3O C;  2L75 A;  2YT5 A;  3L1Z B;  3SOW A;  3LQJ A;  4ZQL A;  1HYJ A;  3RPG C;  3I2D A;  1K2F A;  3N9O A;  1X4I A;  4N3W A;  3GV4 A;  1U6G B;  2JMJ A;  3HCS A;  1WE9 A;  2EGP A;  2ZET C;  1WGM A;  4FJC A;  4PTB A;  2L5U A;  3PUR A;  1ZBD B;  2PNX A;  2YSM A;  4LK9 A;  3ZYQ A;  1FBV A;  4IC2 A;  3SOX A;  2F42 A;  5DIN A;  4Q6F A;  5LKT A;  3LQI A;  1JOC A;  5LCW B;  2KU3 A;  2G6Q A;  2KGG A;  5G05 B;  1T1H A;  1WIM A;  4UP5 A;  4B7Y C;  3KV5 A;  1WEW A;  5KH3 A;  4YC9 A;  4C9Z A;  4NN2 A;  3L1X A;  4TKP B;  4AYC B;  3PHD A;  2YSJ A;  5JG6 A;  5G0F A;  4F52 B;  4GNE A;  5EYA F;  2C2L A;  4YAT A;  4I7C A;  2E6R A;  4YBM A;  3O36 A;  4A4B A;  5AIT A;  2MIQ A;  3QZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...