2LDRA

Solution structure of helix-ring domain of cbl-b in the tyr363 phosphorylated form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
81
Chain Sequence
b'GPHMGSDHIKVTQEQYELCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase CBL-B
publication title Autoinhibition and phosphorylation-induced activation mechanisms of human cancer and autoimmune disease-related E3 protein Cbl-b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 81
sequence length 82
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ldrA00
3LRQA 2MUMA 2BAYA 4FJCA 1K2FA 5LKXA 1MM3A 4I7BA 1FBVA 4R2YA 3RTRB 3N9MA 1BORA 5DKAA 4AUQB 3SOWA 2M1RA 2YQMA 2JMJA 2EGPA 5H1UA 2LDRA 2KYUA 4B7YC 5LKZA 3KNVA 2YSMA 3LQHA 1WEVA 3MHHA 4V3KC 4PTBA 3N9QA 1WEQA 4P5OB 4UP5A 2MD8C 2YREA 2OXQC 1WENA 3FL2A 3KV6A 5G05B 5B76A 2CSYA 1FP0A 2KE1A 2JRJA 4I7CA 3M62A 2CKLA 2YHNA 1WEOA 1VD4A 4YBTA 4FK5A 2CT2A 2H0DA 2KR4A 2E6RA 3N9OA 3O36A 2ECTA 1LDJB 3KQIA 2IDAA 3EB5A 2YW8A 4YAXA 3PHDA 3V43A 3L1XA 2CKLB 4BHWA 2MNYA 4ZQLA 2PNXA 3U5MA 2L80A 2K4DA 3N9PA 3T6RA 5EYAF 2VJEB 4N3WA 4S3OC 3N9NA 2KWNA 2ZETC 1WEPA 2EODA 4ZDTA 2LGLA 2C2VS 2VP7A 2Y1MA 4A49A 3PURA 4WZ2A 2FSAA 4LK9A 5FB0A 2LRIC 3LQJA 3RPGB 2L75A 2RI7A 2LN0A 4WZ3B 4LADB 3U5NA 3HTKC 1WIMA 4GB0A 2D8SA 2MA5A 3DPLR 3I2DA 4N4FA 5LKUA 2ECVA 5AITA 2FUUA 2LV9A 1WGMA 4AP4A 2LGVA 5G04B 3C5KA 2JMDA 2G6QA 5B79A 2KWJA 5D1LB 3L1ZB 4MVTA 4LKAA 2LQ6A 3O37A 4B86C 1MM2A 2QICA 2MD7B 2YT5A 4IC3A 2YUCA 4XI1A 4PPEA 4MSXA 1Z6UA 3ZNIA 5TRBA 1DVPA 1WILA 2VPGA 3N9LA 4FO9A 1X4UA 2M85A 1XWHA 5B8DA 2HDPA 3ZVYA 4YABA 5AIUA 2MT5A 4L58A 5D1KB 3T7LA 2KWOA 3PUQA 1WEMA 2KGGA 2G45A 4V3LC 2YU4A 1Z60A 2VJEA 2FUIA 3ZVZB 2C2LA 2K1JA 4LLBA 3U5OA 2M6MA 5B75A 2MIQA 1WESA 3ZTGA 2XEUA 4YBMA 2F6JA 2ECNA 5D1MB 4A0CD 1IYMA 2VJFA 5C13A 1HYIA 2LXPC 4L7XA 2ECJA 4QF3A 4NN2A 4AYCB 2LGKA 5KH7A 1ZBDB 2F42A 3C6WA 4Q6FA 3O34A 3DQVR 4F52B 2CSZA 4GNEA 3MHSA 4S3OB 5DINA 4O64A 1T1HA 4LJNA 5FEYA 1E4UA 1RMDA 2AN6A 4GNFA 4ZUXU 2VJFB 2YHOA 2EA6A 3M63A 2MA6A 3KV5A 1N87A 5KH3A 2VNFA 4YATA 5H1TA 2L43A 4UI9B 2JMIA 2YURA 1F62A 4AVXA 1X4IA 1X4JA 3ASLA 3O70A 2VPBA 5J3XA 2Y1NA 1V87A 2MNZA 1JOCA 1G25A 4IC2A 5TDRA 5TABA 5G0FA 2YQLA 2QJ0A 2K17A 1WEWA 3QZVA 2E6SA 4YC9A 5LKTA 2KREA 2ECGA 2DX8A 4GNGA 4A4CA 2M3HA 2UZGA 2I50A 1JM7B 4CCGX 3ZYQA 5JG6A 3GV4A 2VPEA 1WFKA 1U6GB 5B78A 2L5UA 4X3GA 3L11A 3NG2A 2VPDA 3U5PA 4YADA 1CHCA 3GL6A 4C9ZA 2K16A 4R8PK 1LDKC 5FB1A 2KIZA 1Z2QA 2KFTA 5H9MA 2QIZA 1VYXA 2KU3A 5C11A 2Y43A 4AYCA 3O35A 2KGIA 3ZPV1 3HCTA 5H1VA 2YYRA 3O7AA 1WEEA 5LCWB 5TDWA 4GNDA 5I3LA 4UP0A 1WEUA 3IHPA 4WZ0A 2PUYA 2ECIA 5B77A 4CA1A 3HCSA 2KWKA 3SOXA 2H0DB 5FERA 4WA6A 2G43A 4TKPB 2LGGA 2XB1A 4FIPA 4W4UA 3LQIA 4YBSA 3SOUA 4I7DA 4QF2A 2ECWA 5KH9A 5TBNA 3O33A 3RPGC 2L0BA 3ZPVE 2YSJA 3HCUA 3M99A 4A4BA 2LXHC 1JM7A 3EB6A 4BBQA 1HYJA 3SHBA 2HYED 1VFYA 2RSDA 4R7EA 3VK6A 2F6NA 2NAAA 1WE9A
chains in the Genus database with same CATH superfamily
3LRQA 2MUMA 2BAYA 4FJCA 1K2FA 5LKXA 1MM3A 4I7BA 3DDTA 1FBVA 4R2YA 3N9MA 3RTRB 1BORA 5DKAA 4AUQB 3SOWA 2M1RA 4Z0OA 2YQMA 2JMJA 2EGPA 5H1UA 2LDRA 2KYUA 4B7YC 5LKZA 3KNVA 2YSMA 3LQHA 1WEVA 3MHHA 4V3KC 2B0OE 4PTBA 3N9QA 1WEQA 4P5OB 4UP5A 2MD8C 2YREA 2OXQC 1WENA 3FL2A 3KV6A 5G05B 5B76A 2CSYA 1FP0A 2KE1A 2JRJA 4I7CA 3M62A 2CKLA 2YHNA 1WEOA 1VD4A 4YBTA 4FK5A 2CT2A 2H0DA 3FAOA 2KR4A 2E6RA 3N9OA 3O36A 2L7PA 2ECTA 1LDJB 3KQIA 2IDAA 3EB5A 2YW8A 3FM8C 4YAXA 3PHDA 3V43A 3L1XA 2CKLB 2XOZA 4BHWA 2MNYA 4ZQLA 2PNXA 2CONA 3U5MA 2L80A 2K4DA 2LAUA 3N9PA 3T6RA 5EYAF 2YVRA 2VJEB 4N3WA 4S3OC 3N9NA 2KWNA 2ZETC 1WEPA 2EODA 4ZDTA 2LGLA 4F1PA 2CSVA 2C2VS 2VP7A 2Y1MA 4A49A 3PURA 3MDBC 4WZ2A 2FSAA 4LK9A 5FB0A 2LRIC 3LQJA 3RPGB 2L75A 2RI7A 2JUNA 2LN0A 2MKEA 3LVQE 2RR4A 4WZ3B 4LADB 5K3QA 3SUBA 3U5NA 2XOCA 3HTKC 1WIMA 4OGEA 4GB0A 2D8SA 2MA5A 3DPLR 3I2DA 4N4FA 5LKUA 2ECVA 5AITA 2FUUA 2LV9A 1WGMA 3PLWA 2LGVA 5G04B 4AP4A 3C5KA 2JMDA 2G6QA 5B79A 2KWJA 5D1LB 3L1ZB 4MVTA 2CRWA 4LKAA 2LQ6A 3O37A 4B86C 1MM2A 2QICA 2MD7B 2YT5A 4IC3A 2KKYA 2YUCA 3T9KA 4XI1A 4PPEA 4MSXA 1Z6UA 3ZNIA 5TRBA 1DVPA 3DWDA 1WILA 4OGCA 2VPGA 3N9LA 4FO9A 1X4UA 2M85A 1XWHA 5B8DA 2HDPA 3ZVYA 3JUEA 4YABA 5AIUA 2OWAA 2MT5A 4L58A 5D1KB 3T7LA 2KWOA 2IQJA 3PUQA 1WEMA 2KGGA 2G45A 4V3LC 2YU4A 1Z60A 2VJEA 2FUIA 3ZVZB 2C2LA 2K1JA 4LLBA 3FANA 3U5OA 2M6MA 2EGMA 5B75A 2MIQA 2DJAA 1WESA 3ZTGA 2XEUA 4YBMA 2F6JA 2ECNA 3LDYA 5D1MB 4A0CD 1IYMA 2VJFA 5C13A 1HYIA 2LXPC 4L7XA 2ECJA 4QF3A 4NN2A 2DSMA 4AYCB 2LGKA 5KH7A 1ZBDB 2KKXA 3C6WA 4Q6FA 3O34A 3DQVR 4F52B 2CSZA 4GNEA 3MHSA 4S3OB 5DINA 4O64A 1T1HA 4LJNA 5FEYA 1E4UA 1RMDA 1WE9A 2AN6A 3E2DA 4GNFA 4ZUXU 2VJFB 2YHOA 2EA6A 3M63A 3KDEC 2MA6A 3KV5A 1N87A 1MBMA 5KH3A 2VNFA 4YATA 5H1TA 2L43A 5SVYA 4UI9B 2JMIA 2YURA 1F62A 4AVXA 1X4IA 1X4JA 2XOYA 3ASLA 3O70A 2JM3A 2VPBA 2M13A 5J3XA 2Y1NA 1V87A 2MNZA 4H9DA 1JOCA 1G25A 2P57A 4IC2A 3O47A 5TDRA 5TABA 5G0FA 2XP0A 2YQLA 2FD4A 2K17A 2QJ0A 1WEWA 3QZVA 2D8UA 2E6SA 4YC9A 5LKTA 2KREA 2ECGA 2CRRA 2DX8A 4GNGA 4A4CA 3FEHA 2M3HA 2UZGA 2I50A 1JM7B 4CCGX 3ZYQA 5JG6A 1DCQA 3GV4A 2VPEA 1WFKA 1U6GB 5B78A 2L5UA 4X3GA 3L11A 3NG2A 4Z0RA 2VPDA 3LVRE 3U5PA 4YADA 1CHCA 3GL6A 4C9ZA 2K16A 5SVIA 4R8PK 3M7KA 1LDKC 5FB1A 2KIZA 1Z2QA 2KFTA 5H9MA 2QIZA 1VYXA 2KU3A 5C11A 2Y43A 2EXUA 4AYCA 3O35A 2KGIA 3FJUB 3ZPV1 3HCTA 5H1VA 2YYRA 3O7AA 1WEEA 5LCWB 2E61A 5TDWA 4GNDA 5I3LA 5SVIB 4UP0A 1WEUA 3IHPA 3LJUX 4WZ0A 2PUYA 2ECIA 5B77A 4CA1A 3HCSA 4QQ4A 2KWKA 2FFWA 3SOXA 2H0DB 5FERA 4WA6A 5SVXA 2G43A 4TKPB 2LGGA 2XB1A 4FIPA 4W4UA 3Q1DA 3LQIA 4YBSA 3SOUA 4I7DA 4O62A 4QF2A 2ECWA 5KH9A 5TBNA 3O33A 3RPGC 2L0BA 3ZPVE 2YSJA 3HCUA 3M99A 3H7HA 4A4BA 2LXHC 1JM7A 3EB6A 4BBQA 1HYJA 3SHBA 2HYED 1VFYA 2RSDA 4R7EA 3VK6A 2F6NA 2NAAA 2F42A
chains in the Genus database with same CATH topology
3LRQA 2MUMA 2BAYA 4FJCA 1K2FA 5LKXA 1MM3A 4I7BA 1FBVA 4R2YA 3RTRB 3N9MA 1BORA 5DKAA 4AUQB 3SOWA 2M1RA 2YQMA 2JMJA 2EGPA 5H1UA 2LDRA 2KYUA 4B7YC 5LKZA 3KNVA 2YSMA 3LQHA 1WEVA 3MHHA 4V3KC 4PTBA 3N9QA 1WEQA 4P5OB 4UP5A 2MD8C 2YREA 2OXQC 1WENA 3FL2A 3KV6A 5G05B 5B76A 2CSYA 1FP0A 2KE1A 2JRJA 4I7CA 3M62A 2CKLA 2YHNA 1WEOA 1VD4A 4YBTA 4FK5A 2CT2A 2H0DA 2KR4A 2E6RA 3N9OA 3O36A 2ECTA 1LDJB 3KQIA 2IDAA 3EB5A 2YW8A 4YAXA 3PHDA 3V43A 3L1XA 2CKLB 4BHWA 2MNYA 4ZQLA 2PNXA 3U5MA 2L80A 2K4DA 3N9PA 3T6RA 5EYAF 2VJEB 4N3WA 4S3OC 3N9NA 2KWNA 2ZETC 1WEPA 2EODA 4ZDTA 2LGLA 2C2VS 2VP7A 2Y1MA 4A49A 3PURA 4WZ2A 2FSAA 4LK9A 5FB0A 2LRIC 3LQJA 3RPGB 2L75A 2RI7A 2LN0A 4WZ3B 4LADB 3U5NA 3HTKC 1WIMA 4GB0A 2D8SA 2MA5A 3DPLR 3I2DA 4N4FA 5LKUA 2ECVA 5AITA 2FUUA 2LV9A 1WGMA 4AP4A 2LGVA 5G04B 3C5KA 2JMDA 2G6QA 5B79A 2KWJA 5D1LB 3L1ZB 4MVTA 4LKAA 2LQ6A 3O37A 4B86C 1MM2A 2QICA 2MD7B 2YT5A 4IC3A 2YUCA 4XI1A 4PPEA 4MSXA 1Z6UA 3ZNIA 5TRBA 1DVPA 1WILA 2VPGA 3N9LA 4FO9A 1X4UA 2M85A 1XWHA 5B8DA 2HDPA 3ZVYA 4YABA 5AIUA 2MT5A 4L58A 5D1KB 3T7LA 2KWOA 3PUQA 1WEMA 2KGGA 2G45A 4V3LC 2YU4A 1Z60A 2VJEA 2FUIA 3ZVZB 2C2LA 2K1JA 4LLBA 3U5OA 2M6MA 5B75A 2MIQA 1WESA 3ZTGA 2XEUA 4YBMA 2F6JA 2ECNA 5D1MB 4A0CD 1IYMA 2VJFA 5C13A 1HYIA 2LXPC 4L7XA 2ECJA 4QF3A 4NN2A 4AYCB 2LGKA 5KH7A 1ZBDB 2F42A 3C6WA 4Q6FA 3O34A 3DQVR 4F52B 2CSZA 4GNEA 3MHSA 4S3OB 5DINA 4O64A 1T1HA 4LJNA 5FEYA 1E4UA 1RMDA 2AN6A 4GNFA 4ZUXU 2VJFB 2YHOA 2EA6A 3M63A 2MA6A 3KV5A 1N87A 5KH3A 2VNFA 4YATA 5H1TA 2L43A 4UI9B 2JMIA 2YURA 1F62A 4AVXA 1X4IA 1X4JA 3ASLA 3O70A 2VPBA 5J3XA 2Y1NA 1V87A 2MNZA 1JOCA 1G25A 4IC2A 5TDRA 5TABA 5G0FA 2YQLA 2QJ0A 2K17A 1WEWA 3QZVA 2E6SA 4YC9A 5LKTA 2KREA 2ECGA 2DX8A 4GNGA 4A4CA 2M3HA 2UZGA 2I50A 1JM7B 4CCGX 3ZYQA 5JG6A 3GV4A 2VPEA 1WFKA 1U6GB 5B78A 2L5UA 4X3GA 3L11A 3NG2A 2VPDA 3U5PA 4YADA 1CHCA 3GL6A 4C9ZA 2K16A 4R8PK 1LDKC 5FB1A 2KIZA 1Z2QA 2KFTA 5H9MA 2QIZA 1VYXA 2KU3A 5C11A 2Y43A 4AYCA 3O35A 2KGIA 3ZPV1 3HCTA 5H1VA 2YYRA 3O7AA 1WEEA 5LCWB 5TDWA 4GNDA 5I3LA 4UP0A 1WEUA 3IHPA 4WZ0A 2PUYA 2ECIA 5B77A 4CA1A 3HCSA 2KWKA 3SOXA 2H0DB 5FERA 4WA6A 2G43A 4TKPB 2LGGA 2XB1A 4FIPA 4W4UA 3LQIA 4YBSA 3SOUA 4I7DA 4QF2A 2ECWA 5KH9A 5TBNA 3O33A 3RPGC 2L0BA 3ZPVE 2YSJA 3HCUA 3M99A 4A4BA 2LXHC 1JM7A 3EB6A 4BBQA 1HYJA 3SHBA 2HYED 1VFYA 2RSDA 4R7EA 3VK6A 2F6NA 2NAAA 1WE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LRQ A;  2MUM A;  2BAY A;  4FJC A;  1K2F A;  5LKX A;  1MM3 A;  4I7B A;  1FBV A;  4R2Y A;  3RTR B;  3N9M A;  1BOR A;  5DKA A;  4AUQ B;  3SOW A;  2M1R A;  2YQM A;  2JMJ A;  2EGP A;  5H1U A;  2LDR A;  2KYU A;  4B7Y C;  5LKZ A;  3KNV A;  2YSM A;  3LQH A;  1WEV A;  3MHH A;  4V3K C;  4PTB A;  3N9Q A;  1WEQ A;  4P5O B;  4UP5 A;  2MD8 C;  2YRE A;  2OXQ C;  1WEN A;  3FL2 A;  3KV6 A;  5G05 B;  5B76 A;  2CSY A;  1FP0 A;  2KE1 A;  2JRJ A;  4I7C A;  3M62 A;  2CKL A;  2YHN A;  1WEO A;  1VD4 A;  4YBT A;  4FK5 A;  2CT2 A;  2H0D A;  2KR4 A;  2E6R A;  3N9O A;  3O36 A;  2ECT A;  1LDJ B;  3KQI A;  2IDA A;  3EB5 A;  2YW8 A;  4YAX A;  3PHD A;  3V43 A;  3L1X A;  2CKL B;  4BHW A;  2MNY A;  4ZQL A;  2PNX A;  3U5M A;  2L80 A;  2K4D A;  3N9P A;  3T6R A;  5EYA F;  2VJE B;  4N3W A;  4S3O C;  3N9N A;  2KWN A;  2ZET C;  1WEP A;  2EOD A;  4ZDT A;  2LGL A;  2C2V S;  2VP7 A;  2Y1M A;  4A49 A;  3PUR A;  4WZ2 A;  2FSA A;  4LK9 A;  5FB0 A;  2LRI C;  3LQJ A;  3RPG B;  2L75 A;  2RI7 A;  2LN0 A;  4WZ3 B;  4LAD B;  3U5N A;  3HTK C;  1WIM A;  4GB0 A;  2D8S A;  2MA5 A;  3DPL R;  3I2D A;  4N4F A;  5LKU A;  2ECV A;  5AIT A;  2FUU A;  2LV9 A;  1WGM A;  4AP4 A;  2LGV A;  5G04 B;  3C5K A;  2JMD A;  2G6Q A;  5B79 A;  2KWJ A;  5D1L B;  3L1Z B;  4MVT A;  4LKA A;  2LQ6 A;  3O37 A;  4B86 C;  1MM2 A;  2QIC A;  2MD7 B;  2YT5 A;  4IC3 A;  2YUC A;  4XI1 A;  4PPE A;  4MSX A;  1Z6U A;  3ZNI A;  5TRB A;  1DVP A;  1WIL A;  2VPG A;  3N9L A;  4FO9 A;  1X4U A;  2M85 A;  1XWH A;  5B8D A;  2HDP A;  3ZVY A;  4YAB A;  5AIU A;  2MT5 A;  4L58 A;  5D1K B;  3T7L A;  2KWO A;  3PUQ A;  1WEM A;  2KGG A;  2G45 A;  4V3L C;  2YU4 A;  1Z60 A;  2VJE A;  2FUI A;  3ZVZ B;  2C2L A;  2K1J A;  4LLB A;  3U5O A;  2M6M A;  5B75 A;  2MIQ A;  1WES A;  3ZTG A;  2XEU A;  4YBM A;  2F6J A;  2ECN A;  5D1M B;  4A0C D;  1IYM A;  2VJF A;  5C13 A;  1HYI A;  2LXP C;  4L7X A;  2ECJ A;  4QF3 A;  4NN2 A;  4AYC B;  2LGK A;  5KH7 A;  1ZBD B;  2F42 A;  3C6W A;  4Q6F A;  3O34 A;  3DQV R;  4F52 B;  2CSZ A;  4GNE A;  3MHS A;  4S3O B;  5DIN A;  4O64 A;  1T1H A;  4LJN A;  5FEY A;  1E4U A;  1RMD A;  2AN6 A;  4GNF A;  4ZUX U;  2VJF B;  2YHO A;  2EA6 A;  3M63 A;  2MA6 A;  3KV5 A;  1N87 A;  5KH3 A;  2VNF A;  4YAT A;  5H1T A;  2L43 A;  4UI9 B;  2JMI A;  2YUR A;  1F62 A;  4AVX A;  1X4I A;  1X4J A;  3ASL A;  3O70 A;  2VPB A;  5J3X A;  2Y1N A;  1V87 A;  2MNZ A;  1JOC A;  1G25 A;  4IC2 A;  5TDR A;  5TAB A;  5G0F A;  2YQL A;  2QJ0 A;  2K17 A;  1WEW A;  3QZV A;  2E6S A;  4YC9 A;  5LKT A;  2KRE A;  2ECG A;  2DX8 A;  4GNG A;  4A4C A;  2M3H A;  2UZG A;  2I50 A;  1JM7 B;  4CCG X;  3ZYQ A;  5JG6 A;  3GV4 A;  2VPE A;  1WFK A;  1U6G B;  5B78 A;  2L5U A;  4X3G A;  3L11 A;  3NG2 A;  2VPD A;  3U5P A;  4YAD A;  1CHC A;  3GL6 A;  4C9Z A;  2K16 A;  4R8P K;  1LDK C;  5FB1 A;  2KIZ A;  1Z2Q A;  2KFT A;  5H9M A;  2QIZ A;  1VYX A;  2KU3 A;  5C11 A;  2Y43 A;  4AYC A;  3O35 A;  2KGI A;  3ZPV 1;  3HCT A;  5H1V A;  2YYR A;  3O7A A;  1WEE A;  5LCW B;  5TDW A;  4GND A;  5I3L A;  4UP0 A;  1WEU A;  3IHP A;  4WZ0 A;  2PUY A;  2ECI A;  5B77 A;  4CA1 A;  3HCS A;  2KWK A;  3SOX A;  2H0D B;  5FER A;  4WA6 A;  2G43 A;  4TKP B;  2LGG A;  2XB1 A;  4FIP A;  4W4U A;  3LQI A;  4YBS A;  3SOU A;  4I7D A;  4QF2 A;  2ECW A;  5KH9 A;  5TBN A;  3O33 A;  3RPG C;  2L0B A;  3ZPV E;  2YSJ A;  3HCU A;  3M99 A;  4A4B A;  2LXH C;  1JM7 A;  3EB6 A;  4BBQ A;  1HYJ A;  3SHB A;  2HYE D;  1VFY A;  2RSD A;  4R7E A;  3VK6 A;  2F6N A;  2NAA A;  1WE9 A; 
#chains in the Genus database with same CATH topology
 3LRQ A;  2MUM A;  2BAY A;  4FJC A;  1K2F A;  5LKX A;  1MM3 A;  4I7B A;  3DDT A;  1FBV A;  4R2Y A;  3N9M A;  3RTR B;  1BOR A;  5DKA A;  4AUQ B;  3SOW A;  2M1R A;  4Z0O A;  2YQM A;  2JMJ A;  2EGP A;  5H1U A;  2LDR A;  2KYU A;  4B7Y C;  5LKZ A;  3KNV A;  2YSM A;  3LQH A;  1WEV A;  3MHH A;  4V3K C;  2B0O E;  4PTB A;  3N9Q A;  1WEQ A;  4P5O B;  4UP5 A;  2MD8 C;  2YRE A;  2OXQ C;  1WEN A;  3FL2 A;  3KV6 A;  5G05 B;  5B76 A;  2CSY A;  1FP0 A;  2KE1 A;  2JRJ A;  4I7C A;  3M62 A;  2CKL A;  2YHN A;  1WEO A;  1VD4 A;  4YBT A;  4FK5 A;  2CT2 A;  2H0D A;  3FAO A;  2KR4 A;  2E6R A;  3N9O A;  3O36 A;  2L7P A;  2ECT A;  1LDJ B;  3KQI A;  2IDA A;  3EB5 A;  2YW8 A;  3FM8 C;  4YAX A;  3PHD A;  3V43 A;  3L1X A;  2CKL B;  2XOZ A;  4BHW A;  2MNY A;  4ZQL A;  2PNX A;  2CON A;  3U5M A;  2L80 A;  2K4D A;  2LAU A;  3N9P A;  3T6R A;  5EYA F;  2YVR A;  2VJE B;  4N3W A;  4S3O C;  3N9N A;  2KWN A;  2ZET C;  1WEP A;  2EOD A;  4ZDT A;  2LGL A;  4F1P A;  2CSV A;  2C2V S;  2VP7 A;  2Y1M A;  4A49 A;  3PUR A;  3MDB C;  4WZ2 A;  2FSA A;  4LK9 A;  5FB0 A;  2LRI C;  3LQJ A;  3RPG B;  2L75 A;  2RI7 A;  2JUN A;  2LN0 A;  2MKE A;  3LVQ E;  2RR4 A;  4WZ3 B;  4LAD B;  5K3Q A;  3SUB A;  3U5N A;  2XOC A;  3HTK C;  1WIM A;  4OGE A;  4GB0 A;  2D8S A;  2MA5 A;  3DPL R;  3I2D A;  4N4F A;  5LKU A;  2ECV A;  5AIT A;  2FUU A;  2LV9 A;  1WGM A;  3PLW A;  2LGV A;  5G04 B;  4AP4 A;  3C5K A;  2JMD A;  2G6Q A;  5B79 A;  2KWJ A;  5D1L B;  3L1Z B;  4MVT A;  2CRW A;  4LKA A;  2LQ6 A;  3O37 A;  4B86 C;  1MM2 A;  2QIC A;  2MD7 B;  2YT5 A;  4IC3 A;  2KKY A;  2YUC A;  3T9K A;  4XI1 A;  4PPE A;  4MSX A;  1Z6U A;  3ZNI A;  5TRB A;  1DVP A;  3DWD A;  1WIL A;  4OGC A;  2VPG A;  3N9L A;  4FO9 A;  1X4U A;  2M85 A;  1XWH A;  5B8D A;  2HDP A;  3ZVY A;  3JUE A;  4YAB A;  5AIU A;  2OWA A;  2MT5 A;  4L58 A;  5D1K B;  3T7L A;  2KWO A;  2IQJ A;  3PUQ A;  1WEM A;  2KGG A;  2G45 A;  4V3L C;  2YU4 A;  1Z60 A;  2VJE A;  2FUI A;  3ZVZ B;  2C2L A;  2K1J A;  4LLB A;  3FAN A;  3U5O A;  2M6M A;  2EGM A;  5B75 A;  2MIQ A;  2DJA A;  1WES A;  3ZTG A;  2XEU A;  4YBM A;  2F6J A;  2ECN A;  3LDY A;  5D1M B;  4A0C D;  1IYM A;  2VJF A;  5C13 A;  1HYI A;  2LXP C;  4L7X A;  2ECJ A;  4QF3 A;  4NN2 A;  2DSM A;  4AYC B;  2LGK A;  5KH7 A;  1ZBD B;  2KKX A;  3C6W A;  4Q6F A;  3O34 A;  3DQV R;  4F52 B;  2CSZ A;  4GNE A;  3MHS A;  4S3O B;  5DIN A;  4O64 A;  1T1H A;  4LJN A;  5FEY A;  1E4U A;  1RMD A;  1WE9 A;  2AN6 A;  3E2D A;  4GNF A;  4ZUX U;  2VJF B;  2YHO A;  2EA6 A;  3M63 A;  3KDE C;  2MA6 A;  3KV5 A;  1N87 A;  1MBM A;  5KH3 A;  2VNF A;  4YAT A;  5H1T A;  2L43 A;  5SVY A;  4UI9 B;  2JMI A;  2YUR A;  1F62 A;  4AVX A;  1X4I A;  1X4J A;  2XOY A;  3ASL A;  3O70 A;  2JM3 A;  2VPB A;  2M13 A;  5J3X A;  2Y1N A;  1V87 A;  2MNZ A;  4H9D A;  1JOC A;  1G25 A;  2P57 A;  4IC2 A;  3O47 A;  5TDR A;  5TAB A;  5G0F A;  2XP0 A;  2YQL A;  2FD4 A;  2K17 A;  2QJ0 A;  1WEW A;  3QZV A;  2D8U A;  2E6S A;  4YC9 A;  5LKT A;  2KRE A;  2ECG A;  2CRR A;  2DX8 A;  4GNG A;  4A4C A;  3FEH A;  2M3H A;  2UZG A;  2I50 A;  1JM7 B;  4CCG X;  3ZYQ A;  5JG6 A;  1DCQ A;  3GV4 A;  2VPE A;  1WFK A;  1U6G B;  5B78 A;  2L5U A;  4X3G A;  3L11 A;  3NG2 A;  4Z0R A;  2VPD A;  3LVR E;  3U5P A;  4YAD A;  1CHC A;  3GL6 A;  4C9Z A;  2K16 A;  5SVI A;  4R8P K;  3M7K A;  1LDK C;  5FB1 A;  2KIZ A;  1Z2Q A;  2KFT A;  5H9M A;  2QIZ A;  1VYX A;  2KU3 A;  5C11 A;  2Y43 A;  2EXU A;  4AYC A;  3O35 A;  2KGI A;  3FJU B;  3ZPV 1;  3HCT A;  5H1V A;  2YYR A;  3O7A A;  1WEE A;  5LCW B;  2E61 A;  5TDW A;  4GND A;  5I3L A;  5SVI B;  4UP0 A;  1WEU A;  3IHP A;  3LJU X;  4WZ0 A;  2PUY A;  2ECI A;  5B77 A;  4CA1 A;  3HCS A;  4QQ4 A;  2KWK A;  2FFW A;  3SOX A;  2H0D B;  5FER A;  4WA6 A;  5SVX A;  2G43 A;  4TKP B;  2LGG A;  2XB1 A;  4FIP A;  4W4U A;  3Q1D A;  3LQI A;  4YBS A;  3SOU A;  4I7D A;  4O62 A;  4QF2 A;  2ECW A;  5KH9 A;  5TBN A;  3O33 A;  3RPG C;  2L0B A;  3ZPV E;  2YSJ A;  3HCU A;  3M99 A;  3H7H A;  4A4B A;  2LXH C;  1JM7 A;  3EB6 A;  4BBQ A;  1HYJ A;  3SHB A;  2HYE D;  1VFY A;  2RSD A;  4R7E A;  3VK6 A;  2F6N A;  2NAA A;  2F42 A; 
#chains in the Genus database with same CATH homology
 3LRQ A;  2MUM A;  2BAY A;  4FJC A;  1K2F A;  5LKX A;  1MM3 A;  4I7B A;  1FBV A;  4R2Y A;  3RTR B;  3N9M A;  1BOR A;  5DKA A;  4AUQ B;  3SOW A;  2M1R A;  2YQM A;  2JMJ A;  2EGP A;  5H1U A;  2LDR A;  2KYU A;  4B7Y C;  5LKZ A;  3KNV A;  2YSM A;  3LQH A;  1WEV A;  3MHH A;  4V3K C;  4PTB A;  3N9Q A;  1WEQ A;  4P5O B;  4UP5 A;  2MD8 C;  2YRE A;  2OXQ C;  1WEN A;  3FL2 A;  3KV6 A;  5G05 B;  5B76 A;  2CSY A;  1FP0 A;  2KE1 A;  2JRJ A;  4I7C A;  3M62 A;  2CKL A;  2YHN A;  1WEO A;  1VD4 A;  4YBT A;  4FK5 A;  2CT2 A;  2H0D A;  2KR4 A;  2E6R A;  3N9O A;  3O36 A;  2ECT A;  1LDJ B;  3KQI A;  2IDA A;  3EB5 A;  2YW8 A;  4YAX A;  3PHD A;  3V43 A;  3L1X A;  2CKL B;  4BHW A;  2MNY A;  4ZQL A;  2PNX A;  3U5M A;  2L80 A;  2K4D A;  3N9P A;  3T6R A;  5EYA F;  2VJE B;  4N3W A;  4S3O C;  3N9N A;  2KWN A;  2ZET C;  1WEP A;  2EOD A;  4ZDT A;  2LGL A;  2C2V S;  2VP7 A;  2Y1M A;  4A49 A;  3PUR A;  4WZ2 A;  2FSA A;  4LK9 A;  5FB0 A;  2LRI C;  3LQJ A;  3RPG B;  2L75 A;  2RI7 A;  2LN0 A;  4WZ3 B;  4LAD B;  3U5N A;  3HTK C;  1WIM A;  4GB0 A;  2D8S A;  2MA5 A;  3DPL R;  3I2D A;  4N4F A;  5LKU A;  2ECV A;  5AIT A;  2FUU A;  2LV9 A;  1WGM A;  4AP4 A;  2LGV A;  5G04 B;  3C5K A;  2JMD A;  2G6Q A;  5B79 A;  2KWJ A;  5D1L B;  3L1Z B;  4MVT A;  4LKA A;  2LQ6 A;  3O37 A;  4B86 C;  1MM2 A;  2QIC A;  2MD7 B;  2YT5 A;  4IC3 A;  2YUC A;  4XI1 A;  4PPE A;  4MSX A;  1Z6U A;  3ZNI A;  5TRB A;  1DVP A;  1WIL A;  2VPG A;  3N9L A;  4FO9 A;  1X4U A;  2M85 A;  1XWH A;  5B8D A;  2HDP A;  3ZVY A;  4YAB A;  5AIU A;  2MT5 A;  4L58 A;  5D1K B;  3T7L A;  2KWO A;  3PUQ A;  1WEM A;  2KGG A;  2G45 A;  4V3L C;  2YU4 A;  1Z60 A;  2VJE A;  2FUI A;  3ZVZ B;  2C2L A;  2K1J A;  4LLB A;  3U5O A;  2M6M A;  5B75 A;  2MIQ A;  1WES A;  3ZTG A;  2XEU A;  4YBM A;  2F6J A;  2ECN A;  5D1M B;  4A0C D;  1IYM A;  2VJF A;  5C13 A;  1HYI A;  2LXP C;  4L7X A;  2ECJ A;  4QF3 A;  4NN2 A;  4AYC B;  2LGK A;  5KH7 A;  1ZBD B;  2F42 A;  3C6W A;  4Q6F A;  3O34 A;  3DQV R;  4F52 B;  2CSZ A;  4GNE A;  3MHS A;  4S3O B;  5DIN A;  4O64 A;  1T1H A;  4LJN A;  5FEY A;  1E4U A;  1RMD A;  2AN6 A;  4GNF A;  4ZUX U;  2VJF B;  2YHO A;  2EA6 A;  3M63 A;  2MA6 A;  3KV5 A;  1N87 A;  5KH3 A;  2VNF A;  4YAT A;  5H1T A;  2L43 A;  4UI9 B;  2JMI A;  2YUR A;  1F62 A;  4AVX A;  1X4I A;  1X4J A;  3ASL A;  3O70 A;  2VPB A;  5J3X A;  2Y1N A;  1V87 A;  2MNZ A;  1JOC A;  1G25 A;  4IC2 A;  5TDR A;  5TAB A;  5G0F A;  2YQL A;  2QJ0 A;  2K17 A;  1WEW A;  3QZV A;  2E6S A;  4YC9 A;  5LKT A;  2KRE A;  2ECG A;  2DX8 A;  4GNG A;  4A4C A;  2M3H A;  2UZG A;  2I50 A;  1JM7 B;  4CCG X;  3ZYQ A;  5JG6 A;  3GV4 A;  2VPE A;  1WFK A;  1U6G B;  5B78 A;  2L5U A;  4X3G A;  3L11 A;  3NG2 A;  2VPD A;  3U5P A;  4YAD A;  1CHC A;  3GL6 A;  4C9Z A;  2K16 A;  4R8P K;  1LDK C;  5FB1 A;  2KIZ A;  1Z2Q A;  2KFT A;  5H9M A;  2QIZ A;  1VYX A;  2KU3 A;  5C11 A;  2Y43 A;  4AYC A;  3O35 A;  2KGI A;  3ZPV 1;  3HCT A;  5H1V A;  2YYR A;  3O7A A;  1WEE A;  5LCW B;  5TDW A;  4GND A;  5I3L A;  4UP0 A;  1WEU A;  3IHP A;  4WZ0 A;  2PUY A;  2ECI A;  5B77 A;  4CA1 A;  3HCS A;  2KWK A;  3SOX A;  2H0D B;  5FER A;  4WA6 A;  2G43 A;  4TKP B;  2LGG A;  2XB1 A;  4FIP A;  4W4U A;  3LQI A;  4YBS A;  3SOU A;  4I7D A;  4QF2 A;  2ECW A;  5KH9 A;  5TBN A;  3O33 A;  3RPG C;  2L0B A;  3ZPV E;  2YSJ A;  3HCU A;  3M99 A;  4A4B A;  2LXH C;  1JM7 A;  3EB6 A;  4BBQ A;  1HYJ A;  3SHB A;  2HYE D;  1VFY A;  2RSD A;  4R7E A;  3VK6 A;  2F6N A;  2NAA A;  1WE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...