4Z0OA

Cw-type zinc finger of zcwpw2 with f78d mutation
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
NMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger CW-type PWWP domain protein 2
publication title CW-type zinc finger of ZCWPW2 with F78D mutation
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 4z0oA00
4Z0RA 5SVYA 5SVXA 4QQ4A 4O62A 2RR4A 4Z0OA 5SVIB 5SVIA 2L7PA 2E61A
chains in the Genus database with same CATH superfamily
2MIQA 2KKXA 4YAXA 1WIMA 5AITA 2LXPC 2PUYA 3KV6A 2YU4A 2MD8C 2E6RA 5LKUA 2FUUA 4YABA 2YSMA 1Z6UA 3O33A 3M62A 4ZQLA 2L0BA 1HYJA 4IC3A 2KU3A 4YBMA 2LV9A 3NG2A 5SVXA 3ZTGA 2BAYA 3PLWA 3C5KA 4FIPA 3DDTA 2L7PA 2XEUA 3LQIA 2YUCA 4V3LC 3LRQA 2CRWA 5TDRA 3L1ZB 5D1LB 2C2LA 2JMJA 2RR4A 1FBVA 4AUQB 2CT2A 2F6NA 3VK6A 1WFKA 1VYXA 2CSZA 2KWKA 4YATA 3N9PA 2QIZA 2KWNA 2E61A 2D8SA 2KFTA 2VJFA 3KDEC 2FD4A 1V87A 4OGCA 3PURA 3LJUX 4B7YC 2LQ6A 5FB1A 3HCTA 2L80A 3U5MA 1JM7B 3KV5A 5SVYA 1WGMA 3N9MA 4V3KC 4A4CA 2VPGA 5TBNA 3RPGB 4I7BA 1JM7A 4H9DA 2RI7A 3GL6A 2KYUA 5AIUA 1MM3A 2DJAA 1T1HA 5TRBA 4YBSA 5KH7A 3SOWA 4GNFA 3O70A 5FERA 1DCQA 4L7XA 3LDYA 3LVQE 4L58A 2ZETC 5G04B 3MHSA 5FEYA 3V43A 2L5UA 3N9QA 5D1MB 4W4UA 4A0CD 2MT5A 2Y1NA 1LDKC 4X3GA 3SHBA 2CRRA 4WA6A 2LRIC 3SUBA 2OWAA 4R7EA 2ECVA 3O47A 5I3LA 2G43A 2NAAA 3O7AA 3ZYQA 5B79A 2DX8A 3LQHA 5H1VA 1WILA 3ZVYA 3LVRE 3PHDA 5KH9A 1XWHA 4PTBA 3DWDA 2K17A 4Z0RA 2M1RA 4I7CA 3U5NA 2VPEA 2KWJA 4YADA 5B77A 4O62A 4PPEA 4UP0A 4FJCA 3U5OA 4S3OC 4NN2A 5G0FA 1WEVA 1DVPA 4AVXA 3T9KA 5H1UA 2K16A 3H7HA 1E4UA 1X4UA 3C6WA 5TDWA 2YREA 5B75A 2YW8A 3EB6A 4Q6FA 2YHOA 2YSJA 2MD7B 2LGKA 1X4JA 2YQLA 2HYED 3SOXA 3MDBC 2XP0A 2LN0A 4ZUXU 2RSDA 3FAOA 3IHPA 4UI9B 5EYAF 3T6RA 3HCUA 2EODA 2LDRA 5C13A 5J3XA 5H9MA 3FM8C 2JM3A 4LKAA 5KH3A 4F52B 4B86C 2XOZA 2F6JA 1JOCA 3O36A 3DQVR 4R8PK 3QZVA 2M3HA 2FFWA 3ZPVE 3LQJA 4YC9A 2C2VS 4C9ZA 1WEQA 1U6GB 1RMDA 3FEHA 5LCWB 3N9OA 4BHWA 1WEEA 2QJ0A 2XOYA 3KQIA 2IDAA 4QF3A 4GNGA 1WEPA 2K1JA 2LAUA 2KIZA 1F62A 2VP7A 1WEOA 2M13A 2VPDA 4AP4A 1WESA 2QICA 4QF2A 2ECIA 3O34A 5SVIB 1WEMA 2JMDA 4MVTA 3ZPV1 4A4BA 1WEUA 2D8UA 1BORA 3FANA 3N9NA 2MNYA 1CHCA 2PNXA 3ASLA 1WEWA 5G05B 3M63A 2ECNA 1FP0A 2ECTA 5SVIA 4CCGX 4XI1A 2IQJA 1HYIA 3MHHA 1K2FA 3E2DA 2ECGA 2Y43A 3EB5A 2G45A 3JUEA 2M85A 2JMIA 2K4DA 1N87A 2YVRA 5LKZA 2LGGA 4N4FA 4LK9A 5B8DA 2MNZA 5H1TA 2EXUA 2DSMA 4GB0A 2B0OE 3O35A 3U5PA 2JUNA 1VFYA 3HCSA 5DINA 2KGGA 3ZNIA 1WE9A 2FUIA 1WENA 3KNVA 2KWOA 2E6SA 2CSYA 2KREA 4QQ4A 3N9LA 4R2YA 1ZBDB 2KE1A 2EA6A 4WZ0A 5B78A 4WZ3B 4BBQA 2G6QA 3M7KA 2L43A 2VJEB 2VJFB 1Z2QA 1X4IA 2ECWA 2CSVA 2EGMA 2H0DB 1G25A 3RTRB 5JG6A 5DKAA 3GV4A 2XB1A 2VNFA 4N3WA 4OGEA 4GNEA 2MKEA 5LKXA 2VJEA 2CKLB 2H0DA 3O37A 2LGVA 2CONA 2MUMA 5D1KB 4CA1A 3DPLR 5FB0A 3SOUA 3PUQA 2HDPA 2YHNA 4O64A 2KKYA 2CKLA 1VD4A 2Y1MA 4TKPB 3L1XA 1IYMA 4P5OB 4FK5A 2P57A 3I2DA 4YBTA 5LKTA 3T7LA 2YYRA 2VPBA 4AYCB 4LJNA 1MM2A 4MSXA 4IC2A 2ECJA 2AN6A 2F42A 5C11A 4LLBA 2MA6A 2KGIA 2L75A 4A49A 2I50A 4AYCA 3L11A 3Q1DA 3HTKC 2XOCA 5K3QA 2EGPA 4I7DA 4S3OB 2YQMA 2OXQC 5TABA 3FL2A 4WZ2A 3M99A 2YURA 3FJUB 5B76A 3RPGC 4Z0OA 1Z60A 2FSAA 4LADB 2UZGA 2KR4A 4F1PA 2LXHC 4FO9A 4UP5A 2M6MA 1LDJB 4ZDTA 2LGLA 1MBMA 4GNDA 2JRJA 2MA5A 3ZVZB 2YT5A
chains in the Genus database with same CATH topology
2JM3A 4OGEA 3FEHA 2MKEA 2KKXA 4QQ4A 5SVXA 2EXUA 2XOZA 2D8UA 3PLWA 3DDTA 2L7PA 4H9DA 2XOYA 3MDBC 2XP0A 3KDEC 2FD4A 2CONA 3FJUB 3T9KA 2B0OE 4OGCA 3LJUX 3LVRE 2LAUA 2CRWA 2DJAA 4Z0OA 5SVIA 3H7HA 2JUNA 2CRRA 3DWDA 2IQJA 4Z0RA 3E2DA 4F1PA 2M13A 3M7KA 2RR4A 3JUEA 2KKYA 2FFWA 2EGMA 2CSVA 2YREA 3Q1DA 5SVYA 1DCQA 2YVRA 2XOCA 3SUBA 3LDYA 2OWAA 5K3QA 3LVQE 4O62A 5SVIB 2P57A 3O47A 3FM8C 2E61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z0R A;  5SVY A;  5SVX A;  4QQ4 A;  4O62 A;  2RR4 A;  4Z0O A;  5SVI B;  5SVI A;  2L7P A;  2E61 A; 
#chains in the Genus database with same CATH topology
 2MIQ A;  2KKX A;  4YAX A;  1WIM A;  5AIT A;  2LXP C;  2PUY A;  3KV6 A;  2YU4 A;  2MD8 C;  2E6R A;  5LKU A;  2FUU A;  4YAB A;  2YSM A;  1Z6U A;  3O33 A;  3M62 A;  4ZQL A;  2L0B A;  1HYJ A;  4IC3 A;  2KU3 A;  4YBM A;  2LV9 A;  3NG2 A;  5SVX A;  3ZTG A;  2BAY A;  3PLW A;  3C5K A;  4FIP A;  3DDT A;  2L7P A;  2XEU A;  3LQI A;  2YUC A;  4V3L C;  3LRQ A;  2CRW A;  5TDR A;  3L1Z B;  5D1L B;  2C2L A;  2JMJ A;  2RR4 A;  1FBV A;  4AUQ B;  2CT2 A;  2F6N A;  3VK6 A;  1WFK A;  1VYX A;  2CSZ A;  2KWK A;  4YAT A;  3N9P A;  2QIZ A;  2KWN A;  2E61 A;  2D8S A;  2KFT A;  2VJF A;  3KDE C;  2FD4 A;  1V87 A;  4OGC A;  3PUR A;  3LJU X;  4B7Y C;  2LQ6 A;  5FB1 A;  3HCT A;  2L80 A;  3U5M A;  1JM7 B;  3KV5 A;  5SVY A;  1WGM A;  3N9M A;  4V3K C;  4A4C A;  2VPG A;  5TBN A;  3RPG B;  4I7B A;  1JM7 A;  4H9D A;  2RI7 A;  3GL6 A;  2KYU A;  5AIU A;  1MM3 A;  2DJA A;  1T1H A;  5TRB A;  4YBS A;  5KH7 A;  3SOW A;  4GNF A;  3O70 A;  5FER A;  1DCQ A;  4L7X A;  3LDY A;  3LVQ E;  4L58 A;  2ZET C;  5G04 B;  3MHS A;  5FEY A;  3V43 A;  2L5U A;  3N9Q A;  5D1M B;  4W4U A;  4A0C D;  2MT5 A;  2Y1N A;  1LDK C;  4X3G A;  3SHB A;  2CRR A;  4WA6 A;  2LRI C;  3SUB A;  2OWA A;  4R7E A;  2ECV A;  3O47 A;  5I3L A;  2G43 A;  2NAA A;  3O7A A;  3ZYQ A;  5B79 A;  2DX8 A;  3LQH A;  5H1V A;  1WIL A;  3ZVY A;  3LVR E;  3PHD A;  5KH9 A;  1XWH A;  4PTB A;  3DWD A;  2K17 A;  4Z0R A;  2M1R A;  4I7C A;  3U5N A;  2VPE A;  2KWJ A;  4YAD A;  5B77 A;  4O62 A;  4PPE A;  4UP0 A;  4FJC A;  3U5O A;  4S3O C;  4NN2 A;  5G0F A;  1WEV A;  1DVP A;  4AVX A;  3T9K A;  5H1U A;  2K16 A;  3H7H A;  1E4U A;  1X4U A;  3C6W A;  5TDW A;  2YRE A;  5B75 A;  2YW8 A;  3EB6 A;  4Q6F A;  2YHO A;  2YSJ A;  2MD7 B;  2LGK A;  1X4J A;  2YQL A;  2HYE D;  3SOX A;  3MDB C;  2XP0 A;  2LN0 A;  4ZUX U;  2RSD A;  3FAO A;  3IHP A;  4UI9 B;  5EYA F;  3T6R A;  3HCU A;  2EOD A;  2LDR A;  5C13 A;  5J3X A;  5H9M A;  3FM8 C;  2JM3 A;  4LKA A;  5KH3 A;  4F52 B;  4B86 C;  2XOZ A;  2F6J A;  1JOC A;  3O36 A;  3DQV R;  4R8P K;  3QZV A;  2M3H A;  2FFW A;  3ZPV E;  3LQJ A;  4YC9 A;  2C2V S;  4C9Z A;  1WEQ A;  1U6G B;  1RMD A;  3FEH A;  5LCW B;  3N9O A;  4BHW A;  1WEE A;  2QJ0 A;  2XOY A;  3KQI A;  2IDA A;  4QF3 A;  4GNG A;  1WEP A;  2K1J A;  2LAU A;  2KIZ A;  1F62 A;  2VP7 A;  1WEO A;  2M13 A;  2VPD A;  4AP4 A;  1WES A;  2QIC A;  4QF2 A;  2ECI A;  3O34 A;  5SVI B;  1WEM A;  2JMD A;  4MVT A;  3ZPV 1;  4A4B A;  1WEU A;  2D8U A;  1BOR A;  3FAN A;  3N9N A;  2MNY A;  1CHC A;  2PNX A;  3ASL A;  1WEW A;  5G05 B;  3M63 A;  2ECN A;  1FP0 A;  2ECT A;  5SVI A;  4CCG X;  4XI1 A;  2IQJ A;  1HYI A;  3MHH A;  1K2F A;  3E2D A;  2ECG A;  2Y43 A;  3EB5 A;  2G45 A;  3JUE A;  2M85 A;  2JMI A;  2K4D A;  1N87 A;  2YVR A;  5LKZ A;  2LGG A;  4N4F A;  4LK9 A;  5B8D A;  2MNZ A;  5H1T A;  2EXU A;  2DSM A;  4GB0 A;  2B0O E;  3O35 A;  3U5P A;  2JUN A;  1VFY A;  3HCS A;  5DIN A;  2KGG A;  3ZNI A;  1WE9 A;  2FUI A;  1WEN A;  3KNV A;  2KWO A;  2E6S A;  2CSY A;  2KRE A;  4QQ4 A;  3N9L A;  4R2Y A;  1ZBD B;  2KE1 A;  2EA6 A;  4WZ0 A;  5B78 A;  4WZ3 B;  4BBQ A;  2G6Q A;  3M7K A;  2L43 A;  2VJE B;  2VJF B;  1Z2Q A;  1X4I A;  2ECW A;  2CSV A;  2EGM A;  2H0D B;  1G25 A;  3RTR B;  5JG6 A;  5DKA A;  3GV4 A;  2XB1 A;  2VNF A;  4N3W A;  4OGE A;  4GNE A;  2MKE A;  5LKX A;  2VJE A;  2CKL B;  2H0D A;  3O37 A;  2LGV A;  2CON A;  2MUM A;  5D1K B;  4CA1 A;  3DPL R;  5FB0 A;  3SOU A;  3PUQ A;  2HDP A;  2YHN A;  4O64 A;  2KKY A;  2CKL A;  1VD4 A;  2Y1M A;  4TKP B;  3L1X A;  1IYM A;  4P5O B;  4FK5 A;  2P57 A;  3I2D A;  4YBT A;  5LKT A;  3T7L A;  2YYR A;  2VPB A;  4AYC B;  4LJN A;  1MM2 A;  4MSX A;  4IC2 A;  2ECJ A;  2AN6 A;  2F42 A;  5C11 A;  4LLB A;  2MA6 A;  2KGI A;  2L75 A;  4A49 A;  2I50 A;  4AYC A;  3L11 A;  3Q1D A;  3HTK C;  2XOC A;  5K3Q A;  2EGP A;  4I7D A;  4S3O B;  2YQM A;  2OXQ C;  5TAB A;  3FL2 A;  4WZ2 A;  3M99 A;  2YUR A;  3FJU B;  5B76 A;  3RPG C;  4Z0O A;  1Z60 A;  2FSA A;  4LAD B;  2UZG A;  2KR4 A;  4F1P A;  2LXH C;  4FO9 A;  4UP5 A;  2M6M A;  1LDJ B;  4ZDT A;  2LGL A;  1MBM A;  4GND A;  2JRJ A;  2MA5 A;  3ZVZ B;  2YT5 A; 
#chains in the Genus database with same CATH homology
 2JM3 A;  4OGE A;  3FEH A;  2MKE A;  2KKX A;  4QQ4 A;  5SVX A;  2EXU A;  2XOZ A;  2D8U A;  3PLW A;  3DDT A;  2L7P A;  4H9D A;  2XOY A;  3MDB C;  2XP0 A;  3KDE C;  2FD4 A;  2CON A;  3FJU B;  3T9K A;  2B0O E;  4OGC A;  3LJU X;  3LVR E;  2LAU A;  2CRW A;  2DJA A;  4Z0O A;  5SVI A;  3H7H A;  2JUN A;  2CRR A;  3DWD A;  2IQJ A;  4Z0R A;  3E2D A;  4F1P A;  2M13 A;  3M7K A;  2RR4 A;  3JUE A;  2KKY A;  2FFW A;  2EGM A;  2CSV A;  2YRE A;  3Q1D A;  5SVY A;  1DCQ A;  2YVR A;  2XOC A;  3SUB A;  3LDY A;  2OWA A;  5K3Q A;  3LVQ E;  4O62 A;  5SVI B;  2P57 A;  3O47 A;  3FM8 C;  2E61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...