4Z0OA

Cw-type zinc finger of zcwpw2 with f78d mutation
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
NMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CW-type zinc finger of ZCWPW2 with F78D mutation
rcsb
molecule keywords Zinc finger CW-type PWWP domain protein 2
molecule tags Protein binding
source organism Homo sapiens
total genus 12
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 4z0oA00
4QQ4A 4Z0RA 5SVIA 4Z0OA 2L7PA 5SVIB 5SVYA 4O62A 5SVXA 2E61A 2RR4A
chains in the Genus database with same CATH superfamily
3U5MA 3U5PA 2VPGA 4WZ0A 3PUQA 2ECWA 2KU3A 2DX8A 4PPEA 2H0DA 2L80A 2M1RA 3MDBC 5LCWB 2G45A 4IC3A 1DCQA 2XB1A 5DINA 5C11A 2E6RA 4B86C 3SOXA 3ZPVE 2FFWA 2RSDA 4MVTA 3DDTA 2VJFB 4WZ2A 2ECVA 5SVYA 3U5NA 5LKXA 4TKPB 5G05B 4NN2A 2KWNA 5AITA 1WEMA 2JRJA 4L7XA 4QF3A 3SOWA 4YBTA 2K16A 3EB5A 2MA6A 4CA1A 3O36A 4F1PA 5H1VA 2CRRA 3GV4A 3O34A 4MSXA 2BAYA 2CSVA 3O47A 3PURA 3SHBA 1LDKC 4YADA 4QQ4A 1Z60A 1WEPA 2YSMA 5KH7A 2MA5A 3JUEA 2L75A 4GB0A 4I7CA 1X4IA 2FUIA 3C5KA 2C2VS 2VPDA 2F6JA 3L11A 4O64A 5TBNA 2ECIA 5FB1A 5I3LA 2KE1A 5K3QA 4LADB 3DPLR 2LAUA 2M85A 2HDPA 2YVRA 2Y1MA 1MM2A 2P57A 4FJCA 3H7HA 2FUUA 3FM8C 2OWAA 2EA6A 4BHWA 3FL2A 3LVQE 2E6SA 4H9DA 5KH3A 4UP0A 2MUMA 2LQ6A 4AYCB 2CRWA 3LVRE 3ZPV1 3ZTGA 3O35A 4R2YA 2EGPA 3ASLA 2ECTA 3M99A 1JM7B 1XWHA 5TDWA 2JMJA 4AVXA 3HTKC 3IHPA 3M63A 2VJEA 3MHHA 2MT5A 3FEHA 4XI1A 5LKZA 3I2DA 1WIMA 2YYRA 5B75A 1N87A 2XP0A 3ZYQA 3E2DA 2H0DB 2KREA 4I7BA 3QZVA 2VP7A 2LXPC 1WEUA 2OXQC 3DWDA 3SUBA 4CCGX 2MNZA 3LQIA 4A4BA 4YBSA 5SVIA 5H9MA 2C2LA 1WILA 5LKUA 4OGCA 4QF2A 1K2FA 2VPEA 2KGGA 2YURA 3C6WA 2KYUA 2LN0A 2IQJA 3RTRB 5B78A 1Z6UA 2CKLB 2G6QA 2CSYA 2YHNA 5TDRA 5AIUA 2KKXA 4A49A 3M7KA 2MIQA 3FANA 5DKAA 3T9KA 3SOUA 5JG6A 2IDAA 2CT2A 4FIPA 5TABA 3MHSA 2YU4A 1V87A 1WEQA 3LJUX 4LJNA 2QJ0A 5B76A 4UI9B 1WE9A 4LK9A 4YAXA 2JMDA 1X4JA 4YABA 3HCSA 4ZQLA 5B79A 4L58A 2QICA 3VK6A 2HYED 3LQHA 1FBVA 3O33A 3M62A 2MNYA 4AP4A 4PTBA 2LGKA 3KV6A 1VYXA 4WA6A 1MBMA 2JM3A 5G04B 3KDEC 4GNGA 2G43A 3LQJA 2QIZA 1MM3A 5D1LB 5FB0A 3O7AA 3N9OA 2DSMA 4X3GA 3KV5A 1IYMA 1G25A 1CHCA 2ECGA 4UP5A 4R8PK 3GL6A 3N9PA 2XOZA 4ZUXU 2KGIA 5H1TA 5G0FA 3EB6A 3V43A 2YSJA 2F6NA 1RMDA 4GNDA 3N9MA 2Y43A 1Z2QA 3N9NA 3ZNIA 4OGEA 3HCUA 4I7DA 2VJEB 2LGLA 4WZ3B 1WEWA 2M13A 1T1HA 4ZDTA 4F52B 2YHOA 2MKEA 2ECNA 4Q6FA 1WEEA 3O70A 4C9ZA 3N9QA 1ZBDB 2I50A 4FK5A 1WFKA 2AN6A 2LRIC 4S3OC 5SVXA 4YC9A 5D1KB 5KH9A 5TRBA 5SVIB 3RPGB 2FD4A 4YATA 5FEYA 2K4DA 1LDJB 2D8UA 5B77A 2LGVA 3Q1DA 1WEVA 3L1ZB 2K17A 5EYAF 4BBQA 2LV9A 2XOCA 1VFYA 2MD7B 2E61A 3T7LA 3PLWA 1JOCA 4LKAA 2Y1NA 2UZGA 2CSZA 4IC2A 2XOYA 3FAOA 4O62A 1E4UA 2RR4A 3N9LA 2MD8C 2JMIA 4P5OB 4N4FA 2ECJA 4A4CA 2L5UA 4GNEA 2D8SA 2CKLA 2JUNA 2VJFA 3RPGC 5FERA 5D1MB 2KWJA 1WESA 1U6GB 2YT5A 3O37A 2YUCA 3PHDA 4V3LC 1FP0A 2FSAA 2B0OE 2K1JA 3HCTA 3L1XA 3ZVYA 2M6MA 4A0CD 2L7PA 4R7EA 4AUQB 2KFTA 4S3OB 2L0BA 3ZVZB 2YW8A 2KR4A 3U5OA 2L43A 2XEUA 2ZETC 3NG2A 2VNFA 4FO9A 2PNXA 2KWOA 3KNVA 3T6RA 5H1UA 1WENA 3FJUB 5C13A 1X4UA 3LDYA 3KQIA 2YQMA 2YREA 2DJAA 2PUYA 2KWKA 1HYJA 4Z0OA 2YQLA 4YBMA 4LLBA 2LGGA 2KIZA 1BORA 2EXUA 2EODA 1DVPA 5B8DA 1VD4A 2CONA 4B7YC 5J3XA 2VPBA 1F62A 4AYCA 3LRQA 5LKTA 3DQVR 1WEOA 2M3HA 2RI7A 4V3KC 4N3WA 1WGMA 4W4UA 2F42A 1HYIA 2LXHC 1JM7A 2KKYA 4Z0RA 2EGMA 2NAAA 4GNFA 2LDRA
chains in the Genus database with same CATH topology
2IQJA 2XP0A 3E2DA 2CONA 2CRWA 3LVRE 2CSVA 2L7PA 3DDTA 3O47A 2XOCA 2JM3A 5SVYA 5SVXA 5K3QA 2E61A 3KDEC 2JUNA 4QQ4A 2LAUA 3PLWA 2YREA 5SVIB 4OGEA 2DJAA 3DWDA 2FD4A 2KKXA 3SUBA 2YVRA 3M7KA 3T9KA 3MDBC 2M13A 5SVIA 3JUEA 4Z0OA 2P57A 2XOYA 2D8UA 3H7HA 4OGCA 4O62A 1DCQA 3FEHA 2KKYA 2MKEA 4Z0RA 3FM8C 2EGMA 2RR4A 2OWAA 3Q1DA 2B0OE 2EXUA 2XOZA 3LVQE 4H9DA 3LJUX 4F1PA 3FJUB 3LDYA 2CRRA 2FFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QQ4 A;  4Z0R A;  5SVI A;  4Z0O A;  2L7P A;  5SVI B;  5SVY A;  4O62 A;  5SVX A;  2E61 A;  2RR4 A; 
#chains in the Genus database with same CATH topology
 3U5M A;  3U5P A;  2VPG A;  4WZ0 A;  3PUQ A;  2ECW A;  2KU3 A;  2DX8 A;  4PPE A;  2H0D A;  2L80 A;  2M1R A;  3MDB C;  5LCW B;  2G45 A;  4IC3 A;  1DCQ A;  2XB1 A;  5DIN A;  5C11 A;  2E6R A;  4B86 C;  3SOX A;  3ZPV E;  2FFW A;  2RSD A;  4MVT A;  3DDT A;  2VJF B;  4WZ2 A;  2ECV A;  5SVY A;  3U5N A;  5LKX A;  4TKP B;  5G05 B;  4NN2 A;  2KWN A;  5AIT A;  1WEM A;  2JRJ A;  4L7X A;  4QF3 A;  3SOW A;  4YBT A;  2K16 A;  3EB5 A;  2MA6 A;  4CA1 A;  3O36 A;  4F1P A;  5H1V A;  2CRR A;  3GV4 A;  3O34 A;  4MSX A;  2BAY A;  2CSV A;  3O47 A;  3PUR A;  3SHB A;  1LDK C;  4YAD A;  4QQ4 A;  1Z60 A;  1WEP A;  2YSM A;  5KH7 A;  2MA5 A;  3JUE A;  2L75 A;  4GB0 A;  4I7C A;  1X4I A;  2FUI A;  3C5K A;  2C2V S;  2VPD A;  2F6J A;  3L11 A;  4O64 A;  5TBN A;  2ECI A;  5FB1 A;  5I3L A;  2KE1 A;  5K3Q A;  4LAD B;  3DPL R;  2LAU A;  2M85 A;  2HDP A;  2YVR A;  2Y1M A;  1MM2 A;  2P57 A;  4FJC A;  3H7H A;  2FUU A;  3FM8 C;  2OWA A;  2EA6 A;  4BHW A;  3FL2 A;  3LVQ E;  2E6S A;  4H9D A;  5KH3 A;  4UP0 A;  2MUM A;  2LQ6 A;  4AYC B;  2CRW A;  3LVR E;  3ZPV 1;  3ZTG A;  3O35 A;  4R2Y A;  2EGP A;  3ASL A;  2ECT A;  3M99 A;  1JM7 B;  1XWH A;  5TDW A;  2JMJ A;  4AVX A;  3HTK C;  3IHP A;  3M63 A;  2VJE A;  3MHH A;  2MT5 A;  3FEH A;  4XI1 A;  5LKZ A;  3I2D A;  1WIM A;  2YYR A;  5B75 A;  1N87 A;  2XP0 A;  3ZYQ A;  3E2D A;  2H0D B;  2KRE A;  4I7B A;  3QZV A;  2VP7 A;  2LXP C;  1WEU A;  2OXQ C;  3DWD A;  3SUB A;  4CCG X;  2MNZ A;  3LQI A;  4A4B A;  4YBS A;  5SVI A;  5H9M A;  2C2L A;  1WIL A;  5LKU A;  4OGC A;  4QF2 A;  1K2F A;  2VPE A;  2KGG A;  2YUR A;  3C6W A;  2KYU A;  2LN0 A;  2IQJ A;  3RTR B;  5B78 A;  1Z6U A;  2CKL B;  2G6Q A;  2CSY A;  2YHN A;  5TDR A;  5AIU A;  2KKX A;  4A49 A;  3M7K A;  2MIQ A;  3FAN A;  5DKA A;  3T9K A;  3SOU A;  5JG6 A;  2IDA A;  2CT2 A;  4FIP A;  5TAB A;  3MHS A;  2YU4 A;  1V87 A;  1WEQ A;  3LJU X;  4LJN A;  2QJ0 A;  5B76 A;  4UI9 B;  1WE9 A;  4LK9 A;  4YAX A;  2JMD A;  1X4J A;  4YAB A;  3HCS A;  4ZQL A;  5B79 A;  4L58 A;  2QIC A;  3VK6 A;  2HYE D;  3LQH A;  1FBV A;  3O33 A;  3M62 A;  2MNY A;  4AP4 A;  4PTB A;  2LGK A;  3KV6 A;  1VYX A;  4WA6 A;  1MBM A;  2JM3 A;  5G04 B;  3KDE C;  4GNG A;  2G43 A;  3LQJ A;  2QIZ A;  1MM3 A;  5D1L B;  5FB0 A;  3O7A A;  3N9O A;  2DSM A;  4X3G A;  3KV5 A;  1IYM A;  1G25 A;  1CHC A;  2ECG A;  4UP5 A;  4R8P K;  3GL6 A;  3N9P A;  2XOZ A;  4ZUX U;  2KGI A;  5H1T A;  5G0F A;  3EB6 A;  3V43 A;  2YSJ A;  2F6N A;  1RMD A;  4GND A;  3N9M A;  2Y43 A;  1Z2Q A;  3N9N A;  3ZNI A;  4OGE A;  3HCU A;  4I7D A;  2VJE B;  2LGL A;  4WZ3 B;  1WEW A;  2M13 A;  1T1H A;  4ZDT A;  4F52 B;  2YHO A;  2MKE A;  2ECN A;  4Q6F A;  1WEE A;  3O70 A;  4C9Z A;  3N9Q A;  1ZBD B;  2I50 A;  4FK5 A;  1WFK A;  2AN6 A;  2LRI C;  4S3O C;  5SVX A;  4YC9 A;  5D1K B;  5KH9 A;  5TRB A;  5SVI B;  3RPG B;  2FD4 A;  4YAT A;  5FEY A;  2K4D A;  1LDJ B;  2D8U A;  5B77 A;  2LGV A;  3Q1D A;  1WEV A;  3L1Z B;  2K17 A;  5EYA F;  4BBQ A;  2LV9 A;  2XOC A;  1VFY A;  2MD7 B;  2E61 A;  3T7L A;  3PLW A;  1JOC A;  4LKA A;  2Y1N A;  2UZG A;  2CSZ A;  4IC2 A;  2XOY A;  3FAO A;  4O62 A;  1E4U A;  2RR4 A;  3N9L A;  2MD8 C;  2JMI A;  4P5O B;  4N4F A;  2ECJ A;  4A4C A;  2L5U A;  4GNE A;  2D8S A;  2CKL A;  2JUN A;  2VJF A;  3RPG C;  5FER A;  5D1M B;  2KWJ A;  1WES A;  1U6G B;  2YT5 A;  3O37 A;  2YUC A;  3PHD A;  4V3L C;  1FP0 A;  2FSA A;  2B0O E;  2K1J A;  3HCT A;  3L1X A;  3ZVY A;  2M6M A;  4A0C D;  2L7P A;  4R7E A;  4AUQ B;  2KFT A;  4S3O B;  2L0B A;  3ZVZ B;  2YW8 A;  2KR4 A;  3U5O A;  2L43 A;  2XEU A;  2ZET C;  3NG2 A;  2VNF A;  4FO9 A;  2PNX A;  2KWO A;  3KNV A;  3T6R A;  5H1U A;  1WEN A;  3FJU B;  5C13 A;  1X4U A;  3LDY A;  3KQI A;  2YQM A;  2YRE A;  2DJA A;  2PUY A;  2KWK A;  1HYJ A;  4Z0O A;  2YQL A;  4YBM A;  4LLB A;  2LGG A;  2KIZ A;  1BOR A;  2EXU A;  2EOD A;  1DVP A;  5B8D A;  1VD4 A;  2CON A;  4B7Y C;  5J3X A;  2VPB A;  1F62 A;  4AYC A;  3LRQ A;  5LKT A;  3DQV R;  1WEO A;  2M3H A;  2RI7 A;  4V3K C;  4N3W A;  1WGM A;  4W4U A;  2F42 A;  1HYI A;  2LXH C;  1JM7 A;  2KKY A;  4Z0R A;  2EGM A;  2NAA A;  4GNF A;  2LDR A; 
#chains in the Genus database with same CATH homology
 2IQJ A;  2XP0 A;  3E2D A;  2CON A;  2CRW A;  3LVR E;  2CSV A;  2L7P A;  3DDT A;  3O47 A;  2XOC A;  2JM3 A;  5SVY A;  5SVX A;  5K3Q A;  2E61 A;  3KDE C;  2JUN A;  4QQ4 A;  2LAU A;  3PLW A;  2YRE A;  5SVI B;  4OGE A;  2DJA A;  3DWD A;  2FD4 A;  2KKX A;  3SUB A;  2YVR A;  3M7K A;  3T9K A;  3MDB C;  2M13 A;  5SVI A;  3JUE A;  4Z0O A;  2P57 A;  2XOY A;  2D8U A;  3H7H A;  4OGC A;  4O62 A;  1DCQ A;  3FEH A;  2KKY A;  2MKE A;  4Z0R A;  3FM8 C;  2EGM A;  2RR4 A;  2OWA A;  3Q1D A;  2B0O E;  2EXU A;  2XOZ A;  3LVQ E;  4H9D A;  3LJU X;  4F1P A;  3FJU B;  3LDY A;  2CRR A;  2FFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...