4Z0OA

Cw-type zinc finger of zcwpw2 with f78d mutation
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
b'NMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger CW-type PWWP domain protein 2
publication title CW-type zinc finger of ZCWPW2 with F78D mutation
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 4z0oA00
5SVYA 4Z0OA 5SVIB 4QQ4A 5SVIA 5SVXA 2L7PA 2RR4A 4Z0RA 2E61A 4O62A
chains in the Genus database with same CATH superfamily
4F52B 3KV6A 3C6WA 4A0CD 4WZ0A 2F6NA 3RPGB 4YABA 1XWHA 2LN0A 4GB0A 5H9MA 2KWNA 5G0FA 2ECGA 1V87A 2KWOA 2Y1NA 5KH3A 4IC2A 5C13A 3FAOA 4V3LC 3M99A 3FM8C 2E61A 3U5MA 2L80A 5B8DA 4BBQA 2M6MA 2K1JA 4N4FA 1JOCA 2EGPA 3O36A 3LQIA 2K16A 5G04B 3LQJA 2LQ6A 5DKAA 3PURA 2ZETC 4WZ2A 4PTBA 3H7HA 2F42A 2RR4A 3LRQA 2VPBA 5DINA 4FK5A 3ASLA 5SVYA 3MDBC 3ZNIA 2MIQA 3N9LA 2C2VS 3ZPVE 4F1PA 5TBNA 4YBMA 2DSMA 1CHCA 2XOCA 3DDTA 1E4UA 3HCUA 2VNFA 1WFKA 2KR4A 4L7XA 3DPLR 3ZTGA 1K2FA 3O35A 3N9PA 2EGMA 2MA5A 2EXUA 3LJUX 2CRRA 4CCGX 4AUQB 5J3XA 2XEUA 2RSDA 1LDKC 5H1TA 4I7BA 3RTRB 3EB6A 4ZQLA 2VPGA 2OXQC 4LK9A 1Z6UA 1WENA 2YQLA 2H0DB 3N9QA 2NAAA 2YHNA 2KFTA 2M85A 5TABA 4MSXA 5B78A 2FFWA 4BHWA 3HTKC 2ECJA 5TDRA 2IDAA 3NG2A 5TRBA 2PNXA 1WEPA 2CSYA 2H0DA 5H1UA 2ECTA 5LKTA 4H9DA 5G05B 4TKPB 2MT5A 2L43A 4A49A 3FANA 3U5PA 4Z0RA 4I7CA 4ZDTA 2HDPA 3O70A 4OGCA 2KIZA 2KYUA 4GNGA 1VYXA 5KH9A 1WILA 1FP0A 4FIPA 5AIUA 2ECVA 4LLBA 3M63A 1VD4A 3T9KA 1IYMA 3V43A 1X4JA 4X3GA 4YATA 5FB1A 2LGVA 2LAUA 4O64A 2CT2A 5I3LA 1WE9A 2KWJA 2MNYA 2LGGA 4N3WA 3LVRE 2G45A 2F6JA 3QZVA 1FBVA 1N87A 3KV5A 2YHOA 2KGIA 3PLWA 3FL2A 5TDWA 1WEUA 1WEQA 3LDYA 2Y43A 1F62A 2LGKA 1WIMA 4C9ZA 5LCWB 2FD4A 4A4CA 2JMDA 2QIZA 2YREA 2VPEA 2VP7A 2Y1MA 2VJEB 3LVQE 5AITA 4LJNA 3GL6A 4AVXA 2KREA 4R2YA 2M3HA 2I50A 2MUMA 3ZVZB 5SVXA 1WEVA 4UI9B 2JRJA 4GNDA 4UP5A 2KE1A 2QICA 4AP4A 2D8SA 3O33A 2DJAA 4O62A 1T1HA 2E6SA 2MD8C 3HCTA 2CKLB 4R7EA 2YURA 2LGLA 2E6RA 3SOXA 2VJFB 2YW8A 5B77A 3C5KA 2XP0A 1WEOA 3IHPA 2YVRA 3KDEC 4A4BA 2C2LA 1X4IA 2YQMA 3Q1DA 3ZYQA 4QF3A 3T6RA 2AN6A 2JMIA 4I7DA 1X4UA 1G25A 1ZBDB 3N9OA 2YUCA 4YBSA 2MA6A 2VJFA 5LKZA 1LDJB 3GV4A 3ZVYA 4YBTA 1HYIA 1DCQA 2K17A 3SOUA 3U5OA 1WGMA 1MBMA 2CSZA 5B76A 2BAYA 3RPGC 3FJUB 2HYED 2VPDA 4AYCB 2FSAA 3U5NA 4S3OB 1WESA 3L1ZB 1JM7B 5KH7A 4OGEA 3O37A 2JM3A 5LKUA 5JG6A 1WEWA 3L1XA 4B86C 2KKYA 3O47A 5SVIB 3I2DA 1MM2A 4R8PK 5FERA 2RI7A 4FJCA 2CRWA 1RMDA 2K4DA 4V3KC 5D1LB 1JM7A 2P57A 3HCSA 2D8UA 2KU3A 1DVPA 3FEHA 2LXPC 4FO9A 2LXHC 3SHBA 2JUNA 5SVIA 2EODA 2L7PA 2PUYA 3DWDA 3PHDA 3DQVR 4QQ4A 2XOZA 2G6QA 2YT5A 2MD7B 3L11A 5K3QA 2M1RA 4PPEA 5LKXA 4WA6A 2LDRA 4B7YC 2MNZA 3VK6A 5B75A 4P5OB 2FUUA 4W4UA 5EYAF 4YC9A 5H1VA 5FEYA 4MVTA 2ECWA 2VJEA 2YYRA 2B0OE 1Z2QA 2UZGA 2M13A 2IQJA 4ZUXU 2DX8A 2L0BA 3KNVA 1WEEA 2ECNA 4Q6FA 3SUBA 1WEMA 2XOYA 2KKXA 4GNEA 3PUQA 3JUEA 2XB1A 2LV9A 3LQHA 3EB5A 5FB0A 2EA6A 5D1KB 4LADB 2KGGA 4LKAA 2L5UA 4IC3A 4UP0A 2CKLA 2KWKA 1Z60A 4L58A 2YSJA 5C11A 1MM3A 3ZPV1 2JMJA 1HYJA 4S3OC 4NN2A 1VFYA 2LRIC 4XI1A 2ECIA 2OWAA 3O34A 4QF2A 3O7AA 3MHHA 4YAXA 3M7KA 4CA1A 4WZ3B 1U6GB 1BORA 3T7LA 3KQIA 2QJ0A 3N9NA 3MHSA 5B79A 3SOWA 3E2DA 3N9MA 3M62A 5D1MB 2CONA 4GNFA 4AYCA 4YADA 2FUIA 2L75A 4Z0OA 2YSMA 2G43A 2CSVA 2YU4A 2MKEA
chains in the Genus database with same CATH topology
5SVYA 2B0OE 3MDBC 3LVQE 2M13A 3T9KA 2D8UA 4OGEA 2CSVA 2IQJA 3FEHA 3PLWA 1DCQA 2JUNA 2LAUA 3SUBA 5SVIA 4F1PA 3E2DA 2JM3A 2L7PA 2XP0A 5SVXA 2XOYA 2KKXA 2YVRA 4H9DA 3JUEA 3LDYA 3KDEC 2OWAA 2XOCA 3DDTA 3DWDA 2CONA 2KKYA 3O47A 5SVIB 4QQ4A 2XOZA 2FD4A 4O62A 3Q1DA 3M7KA 4Z0RA 2CRWA 4OGCA 3FJUB 4Z0OA 2EGMA 2YREA 2EXUA 3LJUX 2CRRA 5K3QA 2FFWA 3H7HA 2RR4A 2DJAA 3FM8C 3LVRE 2E61A 2P57A 2MKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SVY A;  4Z0O A;  5SVI B;  4QQ4 A;  5SVI A;  5SVX A;  2L7P A;  2RR4 A;  4Z0R A;  2E61 A;  4O62 A; 
#chains in the Genus database with same CATH topology
 4F52 B;  3KV6 A;  3C6W A;  4A0C D;  4WZ0 A;  2F6N A;  3RPG B;  4YAB A;  1XWH A;  2LN0 A;  4GB0 A;  5H9M A;  2KWN A;  5G0F A;  2ECG A;  1V87 A;  2KWO A;  2Y1N A;  5KH3 A;  4IC2 A;  5C13 A;  3FAO A;  4V3L C;  3M99 A;  3FM8 C;  2E61 A;  3U5M A;  2L80 A;  5B8D A;  4BBQ A;  2M6M A;  2K1J A;  4N4F A;  1JOC A;  2EGP A;  3O36 A;  3LQI A;  2K16 A;  5G04 B;  3LQJ A;  2LQ6 A;  5DKA A;  3PUR A;  2ZET C;  4WZ2 A;  4PTB A;  3H7H A;  2F42 A;  2RR4 A;  3LRQ A;  2VPB A;  5DIN A;  4FK5 A;  3ASL A;  5SVY A;  3MDB C;  3ZNI A;  2MIQ A;  3N9L A;  2C2V S;  3ZPV E;  4F1P A;  5TBN A;  4YBM A;  2DSM A;  1CHC A;  2XOC A;  3DDT A;  1E4U A;  3HCU A;  2VNF A;  1WFK A;  2KR4 A;  4L7X A;  3DPL R;  3ZTG A;  1K2F A;  3O35 A;  3N9P A;  2EGM A;  2MA5 A;  2EXU A;  3LJU X;  2CRR A;  4CCG X;  4AUQ B;  5J3X A;  2XEU A;  2RSD A;  1LDK C;  5H1T A;  4I7B A;  3RTR B;  3EB6 A;  4ZQL A;  2VPG A;  2OXQ C;  4LK9 A;  1Z6U A;  1WEN A;  2YQL A;  2H0D B;  3N9Q A;  2NAA A;  2YHN A;  2KFT A;  2M85 A;  5TAB A;  4MSX A;  5B78 A;  2FFW A;  4BHW A;  3HTK C;  2ECJ A;  5TDR A;  2IDA A;  3NG2 A;  5TRB A;  2PNX A;  1WEP A;  2CSY A;  2H0D A;  5H1U A;  2ECT A;  5LKT A;  4H9D A;  5G05 B;  4TKP B;  2MT5 A;  2L43 A;  4A49 A;  3FAN A;  3U5P A;  4Z0R A;  4I7C A;  4ZDT A;  2HDP A;  3O70 A;  4OGC A;  2KIZ A;  2KYU A;  4GNG A;  1VYX A;  5KH9 A;  1WIL A;  1FP0 A;  4FIP A;  5AIU A;  2ECV A;  4LLB A;  3M63 A;  1VD4 A;  3T9K A;  1IYM A;  3V43 A;  1X4J A;  4X3G A;  4YAT A;  5FB1 A;  2LGV A;  2LAU A;  4O64 A;  2CT2 A;  5I3L A;  1WE9 A;  2KWJ A;  2MNY A;  2LGG A;  4N3W A;  3LVR E;  2G45 A;  2F6J A;  3QZV A;  1FBV A;  1N87 A;  3KV5 A;  2YHO A;  2KGI A;  3PLW A;  3FL2 A;  5TDW A;  1WEU A;  1WEQ A;  3LDY A;  2Y43 A;  1F62 A;  2LGK A;  1WIM A;  4C9Z A;  5LCW B;  2FD4 A;  4A4C A;  2JMD A;  2QIZ A;  2YRE A;  2VPE A;  2VP7 A;  2Y1M A;  2VJE B;  3LVQ E;  5AIT A;  4LJN A;  3GL6 A;  4AVX A;  2KRE A;  4R2Y A;  2M3H A;  2I50 A;  2MUM A;  3ZVZ B;  5SVX A;  1WEV A;  4UI9 B;  2JRJ A;  4GND A;  4UP5 A;  2KE1 A;  2QIC A;  4AP4 A;  2D8S A;  3O33 A;  2DJA A;  4O62 A;  1T1H A;  2E6S A;  2MD8 C;  3HCT A;  2CKL B;  4R7E A;  2YUR A;  2LGL A;  2E6R A;  3SOX A;  2VJF B;  2YW8 A;  5B77 A;  3C5K A;  2XP0 A;  1WEO A;  3IHP A;  2YVR A;  3KDE C;  4A4B A;  2C2L A;  1X4I A;  2YQM A;  3Q1D A;  3ZYQ A;  4QF3 A;  3T6R A;  2AN6 A;  2JMI A;  4I7D A;  1X4U A;  1G25 A;  1ZBD B;  3N9O A;  2YUC A;  4YBS A;  2MA6 A;  2VJF A;  5LKZ A;  1LDJ B;  3GV4 A;  3ZVY A;  4YBT A;  1HYI A;  1DCQ A;  2K17 A;  3SOU A;  3U5O A;  1WGM A;  1MBM A;  2CSZ A;  5B76 A;  2BAY A;  3RPG C;  3FJU B;  2HYE D;  2VPD A;  4AYC B;  2FSA A;  3U5N A;  4S3O B;  1WES A;  3L1Z B;  1JM7 B;  5KH7 A;  4OGE A;  3O37 A;  2JM3 A;  5LKU A;  5JG6 A;  1WEW A;  3L1X A;  4B86 C;  2KKY A;  3O47 A;  5SVI B;  3I2D A;  1MM2 A;  4R8P K;  5FER A;  2RI7 A;  4FJC A;  2CRW A;  1RMD A;  2K4D A;  4V3K C;  5D1L B;  1JM7 A;  2P57 A;  3HCS A;  2D8U A;  2KU3 A;  1DVP A;  3FEH A;  2LXP C;  4FO9 A;  2LXH C;  3SHB A;  2JUN A;  5SVI A;  2EOD A;  2L7P A;  2PUY A;  3DWD A;  3PHD A;  3DQV R;  4QQ4 A;  2XOZ A;  2G6Q A;  2YT5 A;  2MD7 B;  3L11 A;  5K3Q A;  2M1R A;  4PPE A;  5LKX A;  4WA6 A;  2LDR A;  4B7Y C;  2MNZ A;  3VK6 A;  5B75 A;  4P5O B;  2FUU A;  4W4U A;  5EYA F;  4YC9 A;  5H1V A;  5FEY A;  4MVT A;  2ECW A;  2VJE A;  2YYR A;  2B0O E;  1Z2Q A;  2UZG A;  2M13 A;  2IQJ A;  4ZUX U;  2DX8 A;  2L0B A;  3KNV A;  1WEE A;  2ECN A;  4Q6F A;  3SUB A;  1WEM A;  2XOY A;  2KKX A;  4GNE A;  3PUQ A;  3JUE A;  2XB1 A;  2LV9 A;  3LQH A;  3EB5 A;  5FB0 A;  2EA6 A;  5D1K B;  4LAD B;  2KGG A;  4LKA A;  2L5U A;  4IC3 A;  4UP0 A;  2CKL A;  2KWK A;  1Z60 A;  4L58 A;  2YSJ A;  5C11 A;  1MM3 A;  3ZPV 1;  2JMJ A;  1HYJ A;  4S3O C;  4NN2 A;  1VFY A;  2LRI C;  4XI1 A;  2ECI A;  2OWA A;  3O34 A;  4QF2 A;  3O7A A;  3MHH A;  4YAX A;  3M7K A;  4CA1 A;  4WZ3 B;  1U6G B;  1BOR A;  3T7L A;  3KQI A;  2QJ0 A;  3N9N A;  3MHS A;  5B79 A;  3SOW A;  3E2D A;  3N9M A;  3M62 A;  5D1M B;  2CON A;  4GNF A;  4AYC A;  4YAD A;  2FUI A;  2L75 A;  4Z0O A;  2YSM A;  2G43 A;  2CSV A;  2YU4 A;  2MKE A; 
#chains in the Genus database with same CATH homology
 5SVY A;  2B0O E;  3MDB C;  3LVQ E;  2M13 A;  3T9K A;  2D8U A;  4OGE A;  2CSV A;  2IQJ A;  3FEH A;  3PLW A;  1DCQ A;  2JUN A;  2LAU A;  3SUB A;  5SVI A;  4F1P A;  3E2D A;  2JM3 A;  2L7P A;  2XP0 A;  5SVX A;  2XOY A;  2KKX A;  2YVR A;  4H9D A;  3JUE A;  3LDY A;  3KDE C;  2OWA A;  2XOC A;  3DDT A;  3DWD A;  2CON A;  2KKY A;  3O47 A;  5SVI B;  4QQ4 A;  2XOZ A;  2FD4 A;  4O62 A;  3Q1D A;  3M7K A;  4Z0R A;  2CRW A;  4OGC A;  3FJU B;  4Z0O A;  2EGM A;  2YRE A;  2EXU A;  3LJU X;  2CRR A;  5K3Q A;  2FFW A;  3H7H A;  2RR4 A;  2DJA A;  3FM8 C;  3LVR E;  2E61 A;  2P57 A;  2MKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...