4UP0A

Ternary crystal structure of the pygo2 phd finger in complex with the b9l hd1 domain and a h3k4me2 peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
85
Chain Sequence
GVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCVYVFTTHLANTAAEAVLQGRADSILAYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords PYGOPUS HOMOLOG 2, B-CELL CLL/LYMPHOMA 9-LIKE PROTEIN
publication title Competitive Binding of a Benzimidazole to the Histone-Binding Pocket of the Pygo Phd Finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 85
sequence length 98
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4up0A00
3ZVYA 2C2LA 2YREA 3MHHA 5AIUA 1HYIA 3O34A 5B76A 3SOWA 4AYCA 5D1MB 2E6RA 4LLBA 2FSAA 4A0CD 4W4UA 3KNVA 2MA6A 2LQ6A 5TDRA 3RPGB 2LV9A 1WEMA 3L1XA 4L58A 4LK9A 5JG6A 2M3HA 1WEPA 4WZ2A 4QF3A 2G43A 4AUQB 3LRQA 2ECIA 1WESA 2VPBA 4S3OB 1WE9A 2L75A 2ECNA 3L1ZB 3NG2A 4XI1A 3N9OA 1VYXA 4I7CA 2KIZA 2EGPA 2C2VS 2YQMA 4L7XA 1E4UA 5DKAA 2VJEB 4ZUXU 2XB1A 2CSZA 1X4UA 2LGLA 3VK6A 2K16A 5TDWA 2MNZA 1VFYA 3KV6A 4F52B 3MHSA 3M62A 4P5OB 4Q6FA 3GL6A 1K2FA 2JRJA 2YHNA 3U5OA 2NAAA 4MVTA 5TABA 4N4FA 1VD4A 2L43A 4PTBA 2Y43A 3M99A 2YW8A 2ECTA 2LXPC 2E6SA 1X4IA 2XEUA 3DPLR 2Y1NA 3O70A 2YQLA 4FK5A 3V43A 1IYMA 1WFKA 3N9MA 3U5PA 1JOCA 1WEEA 3ZNIA 2VPEA 3U5NA 3FL2A 2VP7A 2QIZA 3HCUA 5EYAF 5B77A 5KH9A 2CKLA 4YBMA 4GNGA 4N3WA 5DINA 2RSDA 3N9QA 5G04B 5AITA 4R8PK 5LKXA 3N9NA 4YADA 3LQIA 3L11A 1BORA 1MM2A 5D1LB 1LDJB 1N87A 4YAXA 1WIMA 2F6NA 3EB5A 3LQHA 4UP0A 2DX8A 5KH7A 2IDAA 5I3LA 4A4CA 2KR4A 2OXQC 5H1UA 3C6WA 3QZVA 2LGVA 1JM7A 3SOUA 5KH3A 2MIQA 2UZGA 2M85A 4LKAA 3IHPA 4FIPA 3M63A 5J3XA 4YBSA 3I2DA 2LDRA 1HYJA 5B79A 2YYRA 5LKZA 2MNYA 4B86C 2LXHC 3HCTA 5FERA 4TKPB 4YBTA 1WEUA 4FO9A 1CHCA 2ECWA 3O33A 4IC2A 2EA6A 2JMJA 2KE1A 3DQVR 2JMDA 2K1JA 2KWJA 3C5KA 4WZ3B 2QICA 1LDKC 1WEWA 5B8DA 2BAYA 2Y1MA 4WA6A 2L0BA 3HTKC 4R7EA 4AYCB 2FUUA 3RTRB 2KWKA 4IC3A 2KGGA 5H1VA 1X4JA 3LQJA 5FEYA 3PURA 2VNFA 1WILA 2PNXA 3O35A 1ZBDB 4V3LC 2F6JA 4A49A 2D8SA 4UI9B 2HYED 4O64A 1DVPA 2YT5A 2AN6A 4YABA 4LJNA 3O37A 2VJEA 3RPGC 4BBQA 4X3GA 3GV4A 2L5UA 2F42A 5B78A 2EODA 3N9PA 5D1KB 4B7YC 4YATA 2G6QA 2M1RA 4S3OC 5FB0A 3N9LA 2HDPA 5C13A 4I7DA 4BHWA 3O7AA 3SOXA 1Z2QA 3ZPV1 3KV5A 1U6GB 2MA5A 1WENA 1F62A 1FBVA 1WGMA 1WEOA 4UP5A 1MM3A 1Z60A 3KQIA 2RI7A 4GNFA 1FP0A 2YUCA 4AP4A 2KU3A 2MUMA 3ASLA 2VPDA 4GB0A 3HCSA 2H0DB 4AVXA 2L80A 2YHOA 2VJFB 1XWHA 4A4BA 2QJ0A 4R2YA 2ZETC 3T6RA 1Z6UA 4ZQLA 2YU4A 2K4DA 1G25A 4QF2A 4ZDTA 3PUQA 3ZVZB 4FJCA 2LGGA 4LADB 2MT5A 2ECGA 2MD8C 3PHDA 5FB1A 2FUIA 1RMDA 2K17A 1V87A 5B75A 5TRBA 3SHBA 1WEVA 2KWOA 2LN0A 2CT2A 4MSXA 2KFTA 2KYUA 3O36A 2MD7B 2KREA 3T7LA 2KGIA 2CKLB 4NN2A 2JMIA 2H0DA 2PUYA 2YSJA 2YURA 2KWNA 3ZYQA 2VJFA 2M6MA 4C9ZA 4V3KC 4WZ0A 2LGKA 4GNEA 3U5MA 5C11A 4PPEA 2CSYA 3EB6A 3ZTGA 5H9MA 1T1HA 2LRIC 2I50A 4CCGX 4YC9A 5TBNA 1WEQA 5H1TA 5LKUA 5LCWB 2G45A 2ECVA 3ZPVE 2YSMA 2VPGA 5G05B 5G0FA 2ECJA 5LKTA 4CA1A 1JM7B 4GNDA 4I7BA
chains in the Genus database with same CATH superfamily
5SVYA 3ZVYA 2C2LA 2YREA 3MHHA 5AIUA 1HYIA 2DSMA 3O34A 5B76A 3SOWA 4AYCA 5D1MB 2E6RA 1MBMA 4LLBA 2FSAA 3LJUX 4A0CD 4W4UA 3KNVA 2MA6A 2LQ6A 5TDRA 3RPGB 2LV9A 1WEMA 3L1XA 4L58A 4LK9A 5JG6A 2M3HA 1WEPA 4WZ2A 4QF3A 2G43A 4AUQB 3LRQA 2ECIA 1WESA 2VPBA 4S3OB 1WE9A 2L75A 2ECNA 3L1ZB 3NG2A 4XI1A 3LVQE 3N9OA 2FD4A 1VYXA 4I7CA 2KIZA 2EGPA 2C2VS 2YQMA 4L7XA 1E4UA 5DKAA 2VJEB 4ZUXU 2XB1A 2CSZA 2E61A 1X4UA 2LGLA 2EXUA 3VK6A 2K16A 5TDWA 2MNZA 2CONA 1VFYA 3KV6A 4F52B 3MHSA 3M62A 4P5OB 4Q6FA 3GL6A 1K2FA 1DCQA 2JRJA 3LVRE 2YHNA 3U5OA 2NAAA 4MVTA 5TABA 4N4FA 1VD4A 2DJAA 2L43A 4PTBA 2Y43A 3M99A 2LAUA 2YW8A 2ECTA 4Z0RA 2LXPC 2E6SA 1X4IA 2XEUA 3DPLR 2Y1NA 3O70A 2YQLA 4FK5A 3V43A 1IYMA 2M13A 1WFKA 3N9MA 3U5PA 1JOCA 1WEEA 3ZNIA 2VPEA 3U5NA 3FL2A 2VP7A 4OGEA 2XOCA 2QIZA 3FANA 3HCUA 5EYAF 2P57A 5B77A 5KH9A 2CKLA 4YBMA 4GNGA 4N3WA 5DINA 2RSDA 5K3QA 2KKYA 3FM8C 3N9QA 5G04B 5AITA 4R8PK 2XP0A 5LKXA 4Z0OA 3N9NA 4YADA 2IQJA 3LQIA 3L11A 1BORA 2EGMA 1MM2A 5D1LB 1LDJB 1N87A 4YAXA 1WIMA 2F6NA 2OWAA 3EB5A 3LQHA 4UP0A 2DX8A 2CSVA 4F1PA 5KH7A 2IDAA 5I3LA 3O47A 3FJUB 4A4CA 2KR4A 2OXQC 5H1UA 3C6WA 3QZVA 2LGVA 1JM7A 3SOUA 5KH3A 2MIQA 2UZGA 2M85A 4LKAA 3IHPA 4FIPA 2JUNA 3M63A 5J3XA 3T9KA 4YBSA 3I2DA 2LDRA 1HYJA 5B79A 2KKXA 2YYRA 5LKZA 2MNYA 4B86C 2LXHC 3HCTA 5FERA 4TKPB 4YBTA 1WEUA 4FO9A 1CHCA 2ECWA 3O33A 4IC2A 2EA6A 2JMJA 2KE1A 3DQVR 2JMDA 2K1JA 2KWJA 3C5KA 4WZ3B 2QICA 1LDKC 1WEWA 2FFWA 2JM3A 5B8DA 2BAYA 5SVIB 2Y1MA 2L0BA 3HTKC 4R7EA 4WA6A 4AYCB 2FUUA 3RTRB 2KWKA 4IC3A 2KGGA 5H1VA 1X4JA 3LQJA 5FEYA 2YVRA 3PURA 2VNFA 1WILA 2PNXA 3O35A 1ZBDB 4V3LC 2F6JA 4A49A 2D8SA 4UI9B 2HYED 4O64A 1DVPA 2YT5A 4O62A 2AN6A 4YABA 4LJNA 3O37A 2VJEA 3RPGC 4BBQA 4X3GA 3GV4A 2L5UA 2CRRA 2F42A 5B78A 2EODA 3N9PA 2RR4A 5D1KB 4B7YC 2CRWA 4YATA 2G6QA 2M1RA 2L7PA 4S3OC 5FB0A 3MDBC 3LDYA 3N9LA 2HDPA 3E2DA 5C13A 4I7DA 4BHWA 3O7AA 3SOXA 1Z2QA 3ZPV1 4OGCA 3KV5A 1U6GB 2MA5A 1WENA 1F62A 1FBVA 1WGMA 1WEOA 3FAOA 4UP5A 1MM3A 3PLWA 1Z60A 4QQ4A 3KQIA 2RI7A 4GNFA 1FP0A 2YUCA 3DWDA 4AP4A 2KU3A 2MUMA 3ASLA 5SVIA 2VPDA 2XOYA 3FEHA 4GB0A 3HCSA 4H9DA 2H0DB 4AVXA 3H7HA 2L80A 2YHOA 2VJFB 1XWHA 4A4BA 2QJ0A 4R2YA 2ZETC 3T6RA 1Z6UA 2D8UA 2MKEA 4ZQLA 3KDEC 2YU4A 2K4DA 1G25A 4QF2A 4ZDTA 3PUQA 3ZVZB 4FJCA 2LGGA 4LADB 2MT5A 2ECGA 2MD8C 3PHDA 5FB1A 2FUIA 1RMDA 2K17A 1V87A 5B75A 5TRBA 3SHBA 1WEVA 2KWOA 2LN0A 3M7KA 2CT2A 4MSXA 2KFTA 2KYUA 3SUBA 3O36A 2MD7B 2KREA 5SVXA 3T7LA 2KGIA 2CKLB 4NN2A 2B0OE 3JUEA 2JMIA 2H0DA 2PUYA 2YSJA 2YURA 2KWNA 3ZYQA 2VJFA 2M6MA 4C9ZA 4V3KC 4WZ0A 3Q1DA 2LGKA 4GNEA 3U5MA 5C11A 4PPEA 2CSYA 3EB6A 3ZTGA 5H9MA 1T1HA 2LRIC 2I50A 4CCGX 4YC9A 5TBNA 1WEQA 5H1TA 5LKUA 5LCWB 2G45A 2ECVA 3ZPVE 2YSMA 2VPGA 5G05B 2XOZA 5G0FA 2ECJA 5LKTA 4CA1A 1JM7B 4GNDA 3DDTA 4I7BA
chains in the Genus database with same CATH topology
3ZVYA 2C2LA 2YREA 3MHHA 5AIUA 1HYIA 3O34A 5B76A 3SOWA 4AYCA 5D1MB 2E6RA 4LLBA 2FSAA 4A0CD 4W4UA 3KNVA 2MA6A 2LQ6A 5TDRA 3RPGB 2LV9A 1WEMA 3L1XA 4L58A 4LK9A 5JG6A 2M3HA 1WEPA 4WZ2A 4QF3A 2G43A 4AUQB 3LRQA 2ECIA 1WESA 2VPBA 4S3OB 1WE9A 2L75A 2ECNA 3L1ZB 3NG2A 4XI1A 3N9OA 1VYXA 4I7CA 2KIZA 2EGPA 2C2VS 2YQMA 4L7XA 1E4UA 5DKAA 2VJEB 4ZUXU 2XB1A 2CSZA 1X4UA 2LGLA 3VK6A 2K16A 5TDWA 2MNZA 1VFYA 3KV6A 4F52B 3MHSA 3M62A 4P5OB 4Q6FA 3GL6A 1K2FA 2JRJA 2YHNA 3U5OA 2NAAA 4MVTA 5TABA 4N4FA 1VD4A 2L43A 4PTBA 2Y43A 3M99A 2YW8A 2ECTA 2LXPC 2E6SA 1X4IA 2XEUA 3DPLR 2Y1NA 3O70A 2YQLA 4FK5A 3V43A 1IYMA 1WFKA 3N9MA 3U5PA 1JOCA 1WEEA 3ZNIA 2VPEA 3U5NA 3FL2A 2VP7A 2QIZA 3HCUA 5EYAF 5B77A 5KH9A 2CKLA 4YBMA 4GNGA 4N3WA 5DINA 2RSDA 3N9QA 5G04B 5AITA 4R8PK 5LKXA 3N9NA 4YADA 3LQIA 3L11A 1BORA 1MM2A 5D1LB 1LDJB 1N87A 4YAXA 1WIMA 2F6NA 3EB5A 3LQHA 4UP0A 2DX8A 5KH7A 2IDAA 5I3LA 4A4CA 2KR4A 2OXQC 5H1UA 3C6WA 3QZVA 2LGVA 1JM7A 3SOUA 5KH3A 2MIQA 2UZGA 2M85A 4LKAA 3IHPA 4FIPA 3M63A 5J3XA 4YBSA 3I2DA 2LDRA 1HYJA 5B79A 2YYRA 5LKZA 2MNYA 4B86C 2LXHC 3HCTA 5FERA 4TKPB 4YBTA 1WEUA 4FO9A 1CHCA 2ECWA 3O33A 4IC2A 2EA6A 2JMJA 2KE1A 3DQVR 2JMDA 2K1JA 2KWJA 3C5KA 4WZ3B 2QICA 1LDKC 1WEWA 5B8DA 2BAYA 2Y1MA 4WA6A 2L0BA 3HTKC 4R7EA 4AYCB 2FUUA 3RTRB 2KWKA 4IC3A 2KGGA 5H1VA 1X4JA 3LQJA 5FEYA 3PURA 2VNFA 1WILA 2PNXA 3O35A 1ZBDB 4V3LC 2F6JA 4A49A 2D8SA 4UI9B 2HYED 4O64A 1DVPA 2YT5A 2AN6A 4YABA 4LJNA 3O37A 2VJEA 3RPGC 4BBQA 4X3GA 3GV4A 2L5UA 2F42A 5B78A 2EODA 3N9PA 5D1KB 4B7YC 4YATA 2G6QA 2M1RA 4S3OC 5FB0A 3N9LA 2HDPA 5C13A 4I7DA 4BHWA 3O7AA 3SOXA 1Z2QA 3ZPV1 3KV5A 1U6GB 2MA5A 1WENA 1F62A 1FBVA 1WGMA 1WEOA 4UP5A 1MM3A 1Z60A 3KQIA 2RI7A 4GNFA 1FP0A 2YUCA 4AP4A 2KU3A 2MUMA 3ASLA 2VPDA 4GB0A 3HCSA 2H0DB 4AVXA 2L80A 2YHOA 2VJFB 1XWHA 4A4BA 2QJ0A 4R2YA 2ZETC 3T6RA 1Z6UA 4ZQLA 2YU4A 2K4DA 1G25A 4QF2A 4ZDTA 3PUQA 3ZVZB 4FJCA 2LGGA 4LADB 2MT5A 2ECGA 2MD8C 3PHDA 5FB1A 2FUIA 1RMDA 2K17A 1V87A 5B75A 5TRBA 3SHBA 1WEVA 2KWOA 2LN0A 2CT2A 4MSXA 2KFTA 2KYUA 3O36A 2MD7B 2KREA 3T7LA 2KGIA 2CKLB 4NN2A 2JMIA 2H0DA 2PUYA 2YSJA 2YURA 2KWNA 3ZYQA 2VJFA 2M6MA 4C9ZA 4V3KC 4WZ0A 2LGKA 4GNEA 3U5MA 5C11A 4PPEA 2CSYA 3EB6A 3ZTGA 5H9MA 1T1HA 2LRIC 2I50A 4CCGX 4YC9A 5TBNA 1WEQA 5H1TA 5LKUA 5LCWB 2G45A 2ECVA 3ZPVE 2YSMA 2VPGA 5G05B 5G0FA 2ECJA 5LKTA 4CA1A 1JM7B 4GNDA 4I7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZVY A;  2C2L A;  2YRE A;  3MHH A;  5AIU A;  1HYI A;  3O34 A;  5B76 A;  3SOW A;  4AYC A;  5D1M B;  2E6R A;  4LLB A;  2FSA A;  4A0C D;  4W4U A;  3KNV A;  2MA6 A;  2LQ6 A;  5TDR A;  3RPG B;  2LV9 A;  1WEM A;  3L1X A;  4L58 A;  4LK9 A;  5JG6 A;  2M3H A;  1WEP A;  4WZ2 A;  4QF3 A;  2G43 A;  4AUQ B;  3LRQ A;  2ECI A;  1WES A;  2VPB A;  4S3O B;  1WE9 A;  2L75 A;  2ECN A;  3L1Z B;  3NG2 A;  4XI1 A;  3N9O A;  1VYX A;  4I7C A;  2KIZ A;  2EGP A;  2C2V S;  2YQM A;  4L7X A;  1E4U A;  5DKA A;  2VJE B;  4ZUX U;  2XB1 A;  2CSZ A;  1X4U A;  2LGL A;  3VK6 A;  2K16 A;  5TDW A;  2MNZ A;  1VFY A;  3KV6 A;  4F52 B;  3MHS A;  3M62 A;  4P5O B;  4Q6F A;  3GL6 A;  1K2F A;  2JRJ A;  2YHN A;  3U5O A;  2NAA A;  4MVT A;  5TAB A;  4N4F A;  1VD4 A;  2L43 A;  4PTB A;  2Y43 A;  3M99 A;  2YW8 A;  2ECT A;  2LXP C;  2E6S A;  1X4I A;  2XEU A;  3DPL R;  2Y1N A;  3O70 A;  2YQL A;  4FK5 A;  3V43 A;  1IYM A;  1WFK A;  3N9M A;  3U5P A;  1JOC A;  1WEE A;  3ZNI A;  2VPE A;  3U5N A;  3FL2 A;  2VP7 A;  2QIZ A;  3HCU A;  5EYA F;  5B77 A;  5KH9 A;  2CKL A;  4YBM A;  4GNG A;  4N3W A;  5DIN A;  2RSD A;  3N9Q A;  5G04 B;  5AIT A;  4R8P K;  5LKX A;  3N9N A;  4YAD A;  3LQI A;  3L11 A;  1BOR A;  1MM2 A;  5D1L B;  1LDJ B;  1N87 A;  4YAX A;  1WIM A;  2F6N A;  3EB5 A;  3LQH A;  4UP0 A;  2DX8 A;  5KH7 A;  2IDA A;  5I3L A;  4A4C A;  2KR4 A;  2OXQ C;  5H1U A;  3C6W A;  3QZV A;  2LGV A;  1JM7 A;  3SOU A;  5KH3 A;  2MIQ A;  2UZG A;  2M85 A;  4LKA A;  3IHP A;  4FIP A;  3M63 A;  5J3X A;  4YBS A;  3I2D A;  2LDR A;  1HYJ A;  5B79 A;  2YYR A;  5LKZ A;  2MNY A;  4B86 C;  2LXH C;  3HCT A;  5FER A;  4TKP B;  4YBT A;  1WEU A;  4FO9 A;  1CHC A;  2ECW A;  3O33 A;  4IC2 A;  2EA6 A;  2JMJ A;  2KE1 A;  3DQV R;  2JMD A;  2K1J A;  2KWJ A;  3C5K A;  4WZ3 B;  2QIC A;  1LDK C;  1WEW A;  5B8D A;  2BAY A;  2Y1M A;  4WA6 A;  2L0B A;  3HTK C;  4R7E A;  4AYC B;  2FUU A;  3RTR B;  2KWK A;  4IC3 A;  2KGG A;  5H1V A;  1X4J A;  3LQJ A;  5FEY A;  3PUR A;  2VNF A;  1WIL A;  2PNX A;  3O35 A;  1ZBD B;  4V3L C;  2F6J A;  4A49 A;  2D8S A;  4UI9 B;  2HYE D;  4O64 A;  1DVP A;  2YT5 A;  2AN6 A;  4YAB A;  4LJN A;  3O37 A;  2VJE A;  3RPG C;  4BBQ A;  4X3G A;  3GV4 A;  2L5U A;  2F42 A;  5B78 A;  2EOD A;  3N9P A;  5D1K B;  4B7Y C;  4YAT A;  2G6Q A;  2M1R A;  4S3O C;  5FB0 A;  3N9L A;  2HDP A;  5C13 A;  4I7D A;  4BHW A;  3O7A A;  3SOX A;  1Z2Q A;  3ZPV 1;  3KV5 A;  1U6G B;  2MA5 A;  1WEN A;  1F62 A;  1FBV A;  1WGM A;  1WEO A;  4UP5 A;  1MM3 A;  1Z60 A;  3KQI A;  2RI7 A;  4GNF A;  1FP0 A;  2YUC A;  4AP4 A;  2KU3 A;  2MUM A;  3ASL A;  2VPD A;  4GB0 A;  3HCS A;  2H0D B;  4AVX A;  2L80 A;  2YHO A;  2VJF B;  1XWH A;  4A4B A;  2QJ0 A;  4R2Y A;  2ZET C;  3T6R A;  1Z6U A;  4ZQL A;  2YU4 A;  2K4D A;  1G25 A;  4QF2 A;  4ZDT A;  3PUQ A;  3ZVZ B;  4FJC A;  2LGG A;  4LAD B;  2MT5 A;  2ECG A;  2MD8 C;  3PHD A;  5FB1 A;  2FUI A;  1RMD A;  2K17 A;  1V87 A;  5B75 A;  5TRB A;  3SHB A;  1WEV A;  2KWO A;  2LN0 A;  2CT2 A;  4MSX A;  2KFT A;  2KYU A;  3O36 A;  2MD7 B;  2KRE A;  3T7L A;  2KGI A;  2CKL B;  4NN2 A;  2JMI A;  2H0D A;  2PUY A;  2YSJ A;  2YUR A;  2KWN A;  3ZYQ A;  2VJF A;  2M6M A;  4C9Z A;  4V3K C;  4WZ0 A;  2LGK A;  4GNE A;  3U5M A;  5C11 A;  4PPE A;  2CSY A;  3EB6 A;  3ZTG A;  5H9M A;  1T1H A;  2LRI C;  2I50 A;  4CCG X;  4YC9 A;  5TBN A;  1WEQ A;  5H1T A;  5LKU A;  5LCW B;  2G45 A;  2ECV A;  3ZPV E;  2YSM A;  2VPG A;  5G05 B;  5G0F A;  2ECJ A;  5LKT A;  4CA1 A;  1JM7 B;  4GND A;  4I7B A; 
#chains in the Genus database with same CATH topology
 5SVY A;  3ZVY A;  2C2L A;  2YRE A;  3MHH A;  5AIU A;  1HYI A;  2DSM A;  3O34 A;  5B76 A;  3SOW A;  4AYC A;  5D1M B;  2E6R A;  1MBM A;  4LLB A;  2FSA A;  3LJU X;  4A0C D;  4W4U A;  3KNV A;  2MA6 A;  2LQ6 A;  5TDR A;  3RPG B;  2LV9 A;  1WEM A;  3L1X A;  4L58 A;  4LK9 A;  5JG6 A;  2M3H A;  1WEP A;  4WZ2 A;  4QF3 A;  2G43 A;  4AUQ B;  3LRQ A;  2ECI A;  1WES A;  2VPB A;  4S3O B;  1WE9 A;  2L75 A;  2ECN A;  3L1Z B;  3NG2 A;  4XI1 A;  3LVQ E;  3N9O A;  2FD4 A;  1VYX A;  4I7C A;  2KIZ A;  2EGP A;  2C2V S;  2YQM A;  4L7X A;  1E4U A;  5DKA A;  2VJE B;  4ZUX U;  2XB1 A;  2CSZ A;  2E61 A;  1X4U A;  2LGL A;  2EXU A;  3VK6 A;  2K16 A;  5TDW A;  2MNZ A;  2CON A;  1VFY A;  3KV6 A;  4F52 B;  3MHS A;  3M62 A;  4P5O B;  4Q6F A;  3GL6 A;  1K2F A;  1DCQ A;  2JRJ A;  3LVR E;  2YHN A;  3U5O A;  2NAA A;  4MVT A;  5TAB A;  4N4F A;  1VD4 A;  2DJA A;  2L43 A;  4PTB A;  2Y43 A;  3M99 A;  2LAU A;  2YW8 A;  2ECT A;  4Z0R A;  2LXP C;  2E6S A;  1X4I A;  2XEU A;  3DPL R;  2Y1N A;  3O70 A;  2YQL A;  4FK5 A;  3V43 A;  1IYM A;  2M13 A;  1WFK A;  3N9M A;  3U5P A;  1JOC A;  1WEE A;  3ZNI A;  2VPE A;  3U5N A;  3FL2 A;  2VP7 A;  4OGE A;  2XOC A;  2QIZ A;  3FAN A;  3HCU A;  5EYA F;  2P57 A;  5B77 A;  5KH9 A;  2CKL A;  4YBM A;  4GNG A;  4N3W A;  5DIN A;  2RSD A;  5K3Q A;  2KKY A;  3FM8 C;  3N9Q A;  5G04 B;  5AIT A;  4R8P K;  2XP0 A;  5LKX A;  4Z0O A;  3N9N A;  4YAD A;  2IQJ A;  3LQI A;  3L11 A;  1BOR A;  2EGM A;  1MM2 A;  5D1L B;  1LDJ B;  1N87 A;  4YAX A;  1WIM A;  2F6N A;  2OWA A;  3EB5 A;  3LQH A;  4UP0 A;  2DX8 A;  2CSV A;  4F1P A;  5KH7 A;  2IDA A;  5I3L A;  3O47 A;  3FJU B;  4A4C A;  2KR4 A;  2OXQ C;  5H1U A;  3C6W A;  3QZV A;  2LGV A;  1JM7 A;  3SOU A;  5KH3 A;  2MIQ A;  2UZG A;  2M85 A;  4LKA A;  3IHP A;  4FIP A;  2JUN A;  3M63 A;  5J3X A;  3T9K A;  4YBS A;  3I2D A;  2LDR A;  1HYJ A;  5B79 A;  2KKX A;  2YYR A;  5LKZ A;  2MNY A;  4B86 C;  2LXH C;  3HCT A;  5FER A;  4TKP B;  4YBT A;  1WEU A;  4FO9 A;  1CHC A;  2ECW A;  3O33 A;  4IC2 A;  2EA6 A;  2JMJ A;  2KE1 A;  3DQV R;  2JMD A;  2K1J A;  2KWJ A;  3C5K A;  4WZ3 B;  2QIC A;  1LDK C;  1WEW A;  2FFW A;  2JM3 A;  5B8D A;  2BAY A;  5SVI B;  2Y1M A;  2L0B A;  3HTK C;  4R7E A;  4WA6 A;  4AYC B;  2FUU A;  3RTR B;  2KWK A;  4IC3 A;  2KGG A;  5H1V A;  1X4J A;  3LQJ A;  5FEY A;  2YVR A;  3PUR A;  2VNF A;  1WIL A;  2PNX A;  3O35 A;  1ZBD B;  4V3L C;  2F6J A;  4A49 A;  2D8S A;  4UI9 B;  2HYE D;  4O64 A;  1DVP A;  2YT5 A;  4O62 A;  2AN6 A;  4YAB A;  4LJN A;  3O37 A;  2VJE A;  3RPG C;  4BBQ A;  4X3G A;  3GV4 A;  2L5U A;  2CRR A;  2F42 A;  5B78 A;  2EOD A;  3N9P A;  2RR4 A;  5D1K B;  4B7Y C;  2CRW A;  4YAT A;  2G6Q A;  2M1R A;  2L7P A;  4S3O C;  5FB0 A;  3MDB C;  3LDY A;  3N9L A;  2HDP A;  3E2D A;  5C13 A;  4I7D A;  4BHW A;  3O7A A;  3SOX A;  1Z2Q A;  3ZPV 1;  4OGC A;  3KV5 A;  1U6G B;  2MA5 A;  1WEN A;  1F62 A;  1FBV A;  1WGM A;  1WEO A;  3FAO A;  4UP5 A;  1MM3 A;  3PLW A;  1Z60 A;  4QQ4 A;  3KQI A;  2RI7 A;  4GNF A;  1FP0 A;  2YUC A;  3DWD A;  4AP4 A;  2KU3 A;  2MUM A;  3ASL A;  5SVI A;  2VPD A;  2XOY A;  3FEH A;  4GB0 A;  3HCS A;  4H9D A;  2H0D B;  4AVX A;  3H7H A;  2L80 A;  2YHO A;  2VJF B;  1XWH A;  4A4B A;  2QJ0 A;  4R2Y A;  2ZET C;  3T6R A;  1Z6U A;  2D8U A;  2MKE A;  4ZQL A;  3KDE C;  2YU4 A;  2K4D A;  1G25 A;  4QF2 A;  4ZDT A;  3PUQ A;  3ZVZ B;  4FJC A;  2LGG A;  4LAD B;  2MT5 A;  2ECG A;  2MD8 C;  3PHD A;  5FB1 A;  2FUI A;  1RMD A;  2K17 A;  1V87 A;  5B75 A;  5TRB A;  3SHB A;  1WEV A;  2KWO A;  2LN0 A;  3M7K A;  2CT2 A;  4MSX A;  2KFT A;  2KYU A;  3SUB A;  3O36 A;  2MD7 B;  2KRE A;  5SVX A;  3T7L A;  2KGI A;  2CKL B;  4NN2 A;  2B0O E;  3JUE A;  2JMI A;  2H0D A;  2PUY A;  2YSJ A;  2YUR A;  2KWN A;  3ZYQ A;  2VJF A;  2M6M A;  4C9Z A;  4V3K C;  4WZ0 A;  3Q1D A;  2LGK A;  4GNE A;  3U5M A;  5C11 A;  4PPE A;  2CSY A;  3EB6 A;  3ZTG A;  5H9M A;  1T1H A;  2LRI C;  2I50 A;  4CCG X;  4YC9 A;  5TBN A;  1WEQ A;  5H1T A;  5LKU A;  5LCW B;  2G45 A;  2ECV A;  3ZPV E;  2YSM A;  2VPG A;  5G05 B;  2XOZ A;  5G0F A;  2ECJ A;  5LKT A;  4CA1 A;  1JM7 B;  4GND A;  3DDT A;  4I7B A; 
#chains in the Genus database with same CATH homology
 3ZVY A;  2C2L A;  2YRE A;  3MHH A;  5AIU A;  1HYI A;  3O34 A;  5B76 A;  3SOW A;  4AYC A;  5D1M B;  2E6R A;  4LLB A;  2FSA A;  4A0C D;  4W4U A;  3KNV A;  2MA6 A;  2LQ6 A;  5TDR A;  3RPG B;  2LV9 A;  1WEM A;  3L1X A;  4L58 A;  4LK9 A;  5JG6 A;  2M3H A;  1WEP A;  4WZ2 A;  4QF3 A;  2G43 A;  4AUQ B;  3LRQ A;  2ECI A;  1WES A;  2VPB A;  4S3O B;  1WE9 A;  2L75 A;  2ECN A;  3L1Z B;  3NG2 A;  4XI1 A;  3N9O A;  1VYX A;  4I7C A;  2KIZ A;  2EGP A;  2C2V S;  2YQM A;  4L7X A;  1E4U A;  5DKA A;  2VJE B;  4ZUX U;  2XB1 A;  2CSZ A;  1X4U A;  2LGL A;  3VK6 A;  2K16 A;  5TDW A;  2MNZ A;  1VFY A;  3KV6 A;  4F52 B;  3MHS A;  3M62 A;  4P5O B;  4Q6F A;  3GL6 A;  1K2F A;  2JRJ A;  2YHN A;  3U5O A;  2NAA A;  4MVT A;  5TAB A;  4N4F A;  1VD4 A;  2L43 A;  4PTB A;  2Y43 A;  3M99 A;  2YW8 A;  2ECT A;  2LXP C;  2E6S A;  1X4I A;  2XEU A;  3DPL R;  2Y1N A;  3O70 A;  2YQL A;  4FK5 A;  3V43 A;  1IYM A;  1WFK A;  3N9M A;  3U5P A;  1JOC A;  1WEE A;  3ZNI A;  2VPE A;  3U5N A;  3FL2 A;  2VP7 A;  2QIZ A;  3HCU A;  5EYA F;  5B77 A;  5KH9 A;  2CKL A;  4YBM A;  4GNG A;  4N3W A;  5DIN A;  2RSD A;  3N9Q A;  5G04 B;  5AIT A;  4R8P K;  5LKX A;  3N9N A;  4YAD A;  3LQI A;  3L11 A;  1BOR A;  1MM2 A;  5D1L B;  1LDJ B;  1N87 A;  4YAX A;  1WIM A;  2F6N A;  3EB5 A;  3LQH A;  4UP0 A;  2DX8 A;  5KH7 A;  2IDA A;  5I3L A;  4A4C A;  2KR4 A;  2OXQ C;  5H1U A;  3C6W A;  3QZV A;  2LGV A;  1JM7 A;  3SOU A;  5KH3 A;  2MIQ A;  2UZG A;  2M85 A;  4LKA A;  3IHP A;  4FIP A;  3M63 A;  5J3X A;  4YBS A;  3I2D A;  2LDR A;  1HYJ A;  5B79 A;  2YYR A;  5LKZ A;  2MNY A;  4B86 C;  2LXH C;  3HCT A;  5FER A;  4TKP B;  4YBT A;  1WEU A;  4FO9 A;  1CHC A;  2ECW A;  3O33 A;  4IC2 A;  2EA6 A;  2JMJ A;  2KE1 A;  3DQV R;  2JMD A;  2K1J A;  2KWJ A;  3C5K A;  4WZ3 B;  2QIC A;  1LDK C;  1WEW A;  5B8D A;  2BAY A;  2Y1M A;  4WA6 A;  2L0B A;  3HTK C;  4R7E A;  4AYC B;  2FUU A;  3RTR B;  2KWK A;  4IC3 A;  2KGG A;  5H1V A;  1X4J A;  3LQJ A;  5FEY A;  3PUR A;  2VNF A;  1WIL A;  2PNX A;  3O35 A;  1ZBD B;  4V3L C;  2F6J A;  4A49 A;  2D8S A;  4UI9 B;  2HYE D;  4O64 A;  1DVP A;  2YT5 A;  2AN6 A;  4YAB A;  4LJN A;  3O37 A;  2VJE A;  3RPG C;  4BBQ A;  4X3G A;  3GV4 A;  2L5U A;  2F42 A;  5B78 A;  2EOD A;  3N9P A;  5D1K B;  4B7Y C;  4YAT A;  2G6Q A;  2M1R A;  4S3O C;  5FB0 A;  3N9L A;  2HDP A;  5C13 A;  4I7D A;  4BHW A;  3O7A A;  3SOX A;  1Z2Q A;  3ZPV 1;  3KV5 A;  1U6G B;  2MA5 A;  1WEN A;  1F62 A;  1FBV A;  1WGM A;  1WEO A;  4UP5 A;  1MM3 A;  1Z60 A;  3KQI A;  2RI7 A;  4GNF A;  1FP0 A;  2YUC A;  4AP4 A;  2KU3 A;  2MUM A;  3ASL A;  2VPD A;  4GB0 A;  3HCS A;  2H0D B;  4AVX A;  2L80 A;  2YHO A;  2VJF B;  1XWH A;  4A4B A;  2QJ0 A;  4R2Y A;  2ZET C;  3T6R A;  1Z6U A;  4ZQL A;  2YU4 A;  2K4D A;  1G25 A;  4QF2 A;  4ZDT A;  3PUQ A;  3ZVZ B;  4FJC A;  2LGG A;  4LAD B;  2MT5 A;  2ECG A;  2MD8 C;  3PHD A;  5FB1 A;  2FUI A;  1RMD A;  2K17 A;  1V87 A;  5B75 A;  5TRB A;  3SHB A;  1WEV A;  2KWO A;  2LN0 A;  2CT2 A;  4MSX A;  2KFT A;  2KYU A;  3O36 A;  2MD7 B;  2KRE A;  3T7L A;  2KGI A;  2CKL B;  4NN2 A;  2JMI A;  2H0D A;  2PUY A;  2YSJ A;  2YUR A;  2KWN A;  3ZYQ A;  2VJF A;  2M6M A;  4C9Z A;  4V3K C;  4WZ0 A;  2LGK A;  4GNE A;  3U5M A;  5C11 A;  4PPE A;  2CSY A;  3EB6 A;  3ZTG A;  5H9M A;  1T1H A;  2LRI C;  2I50 A;  4CCG X;  4YC9 A;  5TBN A;  1WEQ A;  5H1T A;  5LKU A;  5LCW B;  2G45 A;  2ECV A;  3ZPV E;  2YSM A;  2VPG A;  5G05 B;  5G0F A;  2ECJ A;  5LKT A;  4CA1 A;  1JM7 B;  4GND A;  4I7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...