4UP0A

Ternary crystal structure of the pygo2 phd finger in complex with the b9l hd1 domain and a h3k4me2 peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
85
Chain Sequence
GVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCVYVFTTHLANTAAEAVLQGRADSILAYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PYGOPUS HOMOLOG 2, B-CELL CLL/LYMPHOMA 9-LIKE PROTEIN
publication title Competitive Binding of a Benzimidazole to the Histone-Binding Pocket of the Pygo Phd Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 27
structure length 85
sequence length 98
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4up0A00
4L58A 2QIZA 2K16A 4WZ0A 1JM7A 2KIZA 3DPLR 4V3LC 2Y43A 2FSAA 1MM3A 2YUCA 2ZETC 1WIMA 4R2YA 2LQ6A 3SHBA 2MA6A 4W4UA 2PNXA 4LADB 4A0CD 1K2FA 2G43A 3IHPA 2MD8C 2G6QA 2ECJA 3LQIA 2EGPA 4AYCB 4I7BA 4V3KC 1ZBDB 2KWOA 4A4BA 4Q6FA 2KWNA 2JMJA 2LGVA 1MM2A 1N87A 3LRQA 4UP0A 4P5OB 2VJFB 3NG2A 2Y1MA 2CT2A 2LGGA 4GNGA 3M62A 2M85A 5KH3A 3O34A 2ECVA 1F62A 3O7AA 4WZ3B 1X4JA 5G0FA 2H0DB 3KV6A 5TDWA 3RPGB 4LJNA 2ECWA 1WEOA 4GNEA 1WENA 5D1KB 3N9LA 4IC2A 4MVTA 1DVPA 4YATA 2MT5A 1BORA 1WEWA 4C9ZA 1WESA 1LDJB 2KWKA 5B79A 4WZ2A 3EB5A 3RTRB 2VJEB 3ASLA 4MSXA 4GNFA 4I7CA 3KV5A 4YABA 3U5PA 1X4IA 2KR4A 3PUQA 4NN2A 2L5UA 3O37A 3VK6A 2KGGA 2L75A 4ZUXU 1E4UA 4AUQB 2IDAA 3M99A 4R8PK 4QF2A 4AVXA 5DINA 4N4FA 4XI1A 1CHCA 2XEUA 4FIPA 4ZDTA 4BBQA 2LGKA 3L1ZB 4LLBA 1VFYA 5AITA 2XB1A 5EYAF 2VPEA 2KYUA 5D1MB 5TABA 3RPGC 1WILA 4S3OB 5KH9A 3ZVZB 4WA6A 1HYIA 4YBTA 1WEUA 1FP0A 2YQMA 5C13A 3HCSA 2YW8A 4YC9A 2FUUA 3ZPV1 3KQIA 2KU3A 2YREA 2YQLA 5G04B 5H1VA 1XWHA 2DX8A 3N9NA 2K4DA 2OXQC 3ZNIA 3SOXA 2JMDA 3N9MA 4ZQLA 3O33A 1HYJA 3U5OA 2KE1A 3SOUA 2FUIA 2I50A 5LCWB 5FB1A 4LK9A 1Z6UA 4AYCA 2NAAA 1WEVA 2QJ0A 5I3LA 3U5NA 5B76A 4UP5A 3O70A 5LKUA 2VJFA 3PURA 4FJCA 4YBSA 5AIUA 3PHDA 4FO9A 4YBMA 5TBNA 2PUYA 1V87A 3LQJA 3T6RA 2MD7B 5JG6A 5FB0A 3L1XA 3M63A 4IC3A 2LXHC 4B86C 2L80A 2LRIC 3HTKC 3HCTA 3U5MA 5LKXA 1WFKA 2CKLA 2VP7A 5C11A 2ECTA 2HDPA 5H1TA 2YT5A 3HCUA 5B77A 1U6GB 4YADA 2LN0A 2VPGA 2F6JA 3QZVA 2M3HA 2MA5A 5DKAA 3LQHA 2YSJA 2M1RA 2UZGA 2Y1NA 3O35A 5B78A 1VD4A 5H9MA 2HYED 2VJEA 2ECGA 2QICA 4R7EA 3GV4A 5LKZA 3L11A 2VPDA 2KREA 4PPEA 1JM7B 2EA6A 1X4UA 1T1HA 3N9OA 2BAYA 3ZYQA 3O36A 3C6WA 4A49A 3GL6A 2ECNA 1RMDA 1JOCA 4O64A 4N3WA 3ZPVE 2LV9A 2L0BA 2YSMA 3MHHA 2F6NA 4X3GA 5H1UA 2AN6A 2K17A 1FBVA 2MNZA 5KH7A 4L7XA 2C2LA 2K1JA 4LKAA 1G25A 4F52B 3SOWA 5FERA 5FEYA 2VPBA 2YURA 4UI9B 2MUMA 1Z60A 3N9PA 4I7DA 2ECIA 2YU4A 2EODA 3C5KA 1LDKC 2CSZA 4B7YC 4GB0A 3KNVA 2RI7A 5G05B 2G45A 1IYMA 4CCGX 2C2VS 4PTBA 2M6MA 2H0DA 2YYRA 3MHSA 2MNYA 5TDRA 4S3OC 2KGIA 4GNDA 2F42A 2CSYA 2E6SA 2JRJA 3ZTGA 3EB6A 4TKPB 2CKLB 4BHWA 3V43A 4QF3A 2KWJA 2YHNA 1WEPA 5J3XA 3ZVYA 1WEQA 4FK5A 4A4CA 2L43A 4YAXA 1WE9A 2LXPC 3FL2A 5TRBA 1WEEA 2JMIA 1WEMA 5B75A 2LDRA 2E6RA 2YHOA 5B8DA 2KFTA 3I2DA 1Z2QA 3N9QA 4CA1A 2D8SA 4AP4A 3T7LA 2RSDA 3DQVR 5D1LB 2LGLA 5LKTA 1VYXA 1WGMA 2MIQA 2VNFA
chains in the Genus database with same CATH superfamily
2CSVA 4L58A 2QIZA 2K16A 4WZ0A 1JM7A 3LDYA 2KIZA 3DPLR 3T9KA 4V3LC 3KDEC 2Y43A 3FEHA 2FSAA 1MM3A 3FM8C 2YUCA 2ZETC 1WIMA 4R2YA 2LQ6A 3SHBA 2MA6A 4W4UA 2PNXA 4LADB 4A0CD 1K2FA 2G43A 3M7KA 3O47A 3IHPA 2MD8C 2MKEA 2G6QA 2ECJA 3LQIA 2EGPA 4AYCB 2FD4A 4I7BA 1ZBDB 2KWOA 4V3KC 4A4BA 5SVIA 4Q6FA 2KWNA 2JMJA 2LGVA 1MM2A 1N87A 3LRQA 4UP0A 4P5OB 3SUBA 2VJFB 3NG2A 2Y1MA 2CT2A 2LGGA 4GNGA 3M62A 2M85A 5KH3A 3O34A 2EGMA 2ECVA 1F62A 3O7AA 4WZ3B 1X4JA 5G0FA 2H0DB 3KV6A 5TDWA 3RPGB 4LJNA 2ECWA 1WEOA 2DSMA 4GNEA 1WENA 5D1KB 3N9LA 4IC2A 3JUEA 4MVTA 4OGCA 5SVXA 1DVPA 4YATA 3LVRE 3DWDA 2MT5A 1BORA 1WEWA 4C9ZA 1WESA 4Z0OA 1LDJB 2KWKA 5B79A 2CONA 4WZ2A 3EB5A 3RTRB 2VJEB 3ASLA 2KKXA 4MSXA 4GNFA 4I7CA 3KV5A 4YABA 3U5PA 1X4IA 2KR4A 3PUQA 4NN2A 2IQJA 2L5UA 3O37A 3VK6A 2KGGA 4QQ4A 2L75A 4ZUXU 1E4UA 4AUQB 2IDAA 3M99A 4R8PK 4QF2A 4AVXA 5DINA 4N4FA 4XI1A 1CHCA 2XEUA 4FIPA 4ZDTA 4BBQA 3PLWA 2LGKA 3L1ZB 4LLBA 1VFYA 5AITA 2XB1A 5EYAF 2VPEA 2KKYA 2KYUA 5D1MB 5TABA 3RPGC 1WILA 4S3OB 5KH9A 3ZVZB 4WA6A 3LVQE 1HYIA 4YBTA 1WEUA 1FP0A 2YQMA 5C13A 3HCSA 2YW8A 4YC9A 2FUUA 3ZPV1 3KQIA 2D8UA 2EXUA 2KU3A 2YREA 2YQLA 5G04B 5H1VA 1XWHA 2DX8A 3N9NA 2K4DA 2OXQC 3ZNIA 3SOXA 2JMDA 3N9MA 4ZQLA 3DDTA 3O33A 1HYJA 3U5OA 2KE1A 5SVIB 2FUIA 2I50A 3SOUA 4OGEA 5LCWB 5FB1A 4LK9A 1Z6UA 4AYCA 2XP0A 2NAAA 1WEVA 2QJ0A 5I3LA 2P57A 3U5NA 5B76A 2E61A 4UP5A 4F1PA 3O70A 5LKUA 2VJFA 3FJUB 3PURA 4FJCA 4YBSA 5AIUA 3PHDA 4FO9A 4YBMA 5TBNA 2L7PA 2LAUA 2PUYA 2XOYA 1V87A 3LQJA 3T6RA 2MD7B 5JG6A 5FB0A 3L1XA 3M63A 4IC3A 2LXHC 4B86C 2L80A 2LRIC 3HTKC 3HCTA 3U5MA 5LKXA 1WFKA 2CKLA 3E2DA 4H9DA 2VP7A 5C11A 2ECTA 2HDPA 2RR4A 5H1TA 2YT5A 3HCUA 5B77A 1U6GB 4YADA 2LN0A 2VPGA 2F6JA 2JUNA 2XOCA 3QZVA 2M3HA 2MA5A 5DKAA 3LQHA 2OWAA 2YSJA 2M1RA 2UZGA 2Y1NA 3O35A 5B78A 1VD4A 5H9MA 2HYED 2VJEA 2ECGA 2QICA 4R7EA 3FAOA 3GV4A 5LKZA 3L11A 2VPDA 2KREA 4PPEA 1JM7B 2EA6A 1X4UA 1T1HA 3N9OA 2BAYA 3ZYQA 3O36A 3C6WA 4A49A 5K3QA 3GL6A 2ECNA 1RMDA 1JOCA 4O64A 4N3WA 3ZPVE 2LV9A 2L0BA 2YSMA 3MHHA 2F6NA 4X3GA 5H1UA 2AN6A 2K17A 1FBVA 2DJAA 2MNZA 2XOZA 5KH7A 4Z0RA 4L7XA 2C2LA 2K1JA 4LKAA 1G25A 4F52B 3SOWA 5FERA 5FEYA 1MBMA 2VPBA 2YURA 2JM3A 4UI9B 3LJUX 2MUMA 1Z60A 3N9PA 2FFWA 4I7DA 2ECIA 2YU4A 2EODA 3C5KA 1LDKC 2CSZA 4B7YC 4GB0A 3KNVA 2RI7A 5G05B 2G45A 1IYMA 4CCGX 2C2VS 4PTBA 2M6MA 2H0DA 2YYRA 3MHSA 2CRWA 2MNYA 5TDRA 3MDBC 2KGIA 4S3OC 4GNDA 2F42A 2CSYA 2E6SA 3FANA 2JRJA 3ZTGA 4O62A 3EB6A 4TKPB 2CKLB 4BHWA 2B0OE 3Q1DA 3V43A 4QF3A 2KWJA 2YHNA 1WEPA 5J3XA 3ZVYA 1WEQA 4FK5A 4A4CA 2L43A 4YAXA 2M13A 1WE9A 2LXPC 3FL2A 1WEEA 2JMIA 5TRBA 1WEMA 5B75A 2LDRA 5SVYA 2E6RA 2YHOA 5B8DA 2CRRA 2KFTA 3I2DA 1DCQA 1Z2QA 3N9QA 4CA1A 2D8SA 4AP4A 3T7LA 2RSDA 3DQVR 5D1LB 2YVRA 3H7HA 2LGLA 5LKTA 1VYXA 1WGMA 2MIQA 2VNFA
chains in the Genus database with same CATH topology
4L58A 2QIZA 2K16A 4WZ0A 1JM7A 2KIZA 3DPLR 4V3LC 2Y43A 2FSAA 1MM3A 2YUCA 2ZETC 1WIMA 4R2YA 2LQ6A 3SHBA 2MA6A 4W4UA 2PNXA 4LADB 4A0CD 1K2FA 2G43A 3IHPA 2MD8C 2G6QA 2ECJA 3LQIA 2EGPA 4AYCB 4I7BA 4V3KC 1ZBDB 2KWOA 4A4BA 4Q6FA 2KWNA 2JMJA 2LGVA 1MM2A 1N87A 3LRQA 4UP0A 4P5OB 2VJFB 3NG2A 2Y1MA 2CT2A 2LGGA 4GNGA 3M62A 2M85A 5KH3A 3O34A 2ECVA 1F62A 3O7AA 4WZ3B 1X4JA 5G0FA 2H0DB 3KV6A 5TDWA 3RPGB 4LJNA 2ECWA 1WEOA 4GNEA 1WENA 5D1KB 3N9LA 4IC2A 4MVTA 1DVPA 4YATA 2MT5A 1BORA 1WEWA 4C9ZA 1WESA 1LDJB 2KWKA 5B79A 4WZ2A 3EB5A 3RTRB 2VJEB 3ASLA 4MSXA 4GNFA 4I7CA 3KV5A 4YABA 3U5PA 1X4IA 2KR4A 3PUQA 4NN2A 2L5UA 3O37A 3VK6A 2KGGA 2L75A 4ZUXU 1E4UA 4AUQB 2IDAA 3M99A 4R8PK 4QF2A 4AVXA 5DINA 4N4FA 4XI1A 1CHCA 2XEUA 4FIPA 4ZDTA 4BBQA 2LGKA 3L1ZB 4LLBA 1VFYA 5AITA 2XB1A 5EYAF 2VPEA 2KYUA 5D1MB 5TABA 3RPGC 1WILA 4S3OB 5KH9A 3ZVZB 4WA6A 1HYIA 4YBTA 1WEUA 1FP0A 2YQMA 5C13A 3HCSA 2YW8A 4YC9A 2FUUA 3ZPV1 3KQIA 2KU3A 2YREA 2YQLA 5G04B 5H1VA 1XWHA 2DX8A 3N9NA 2K4DA 2OXQC 3ZNIA 3SOXA 2JMDA 3N9MA 4ZQLA 3O33A 1HYJA 3U5OA 2KE1A 3SOUA 2FUIA 2I50A 5LCWB 5FB1A 4LK9A 1Z6UA 4AYCA 2NAAA 1WEVA 2QJ0A 5I3LA 3U5NA 5B76A 4UP5A 3O70A 5LKUA 2VJFA 3PURA 4FJCA 4YBSA 5AIUA 3PHDA 4FO9A 4YBMA 5TBNA 2PUYA 1V87A 3LQJA 3T6RA 2MD7B 5JG6A 5FB0A 3L1XA 3M63A 4IC3A 2LXHC 4B86C 2L80A 2LRIC 3HTKC 3HCTA 3U5MA 5LKXA 1WFKA 2CKLA 2VP7A 5C11A 2ECTA 2HDPA 5H1TA 2YT5A 3HCUA 5B77A 1U6GB 4YADA 2LN0A 2VPGA 2F6JA 3QZVA 2M3HA 2MA5A 5DKAA 3LQHA 2YSJA 2M1RA 2UZGA 2Y1NA 3O35A 5B78A 1VD4A 5H9MA 2HYED 2VJEA 2ECGA 2QICA 4R7EA 3GV4A 5LKZA 3L11A 2VPDA 2KREA 4PPEA 1JM7B 2EA6A 1X4UA 1T1HA 3N9OA 2BAYA 3ZYQA 3O36A 3C6WA 4A49A 3GL6A 2ECNA 1RMDA 1JOCA 4O64A 4N3WA 3ZPVE 2LV9A 2L0BA 2YSMA 3MHHA 2F6NA 4X3GA 5H1UA 2AN6A 2K17A 1FBVA 2MNZA 5KH7A 4L7XA 2C2LA 2K1JA 4LKAA 1G25A 4F52B 3SOWA 5FERA 5FEYA 2VPBA 2YURA 4UI9B 2MUMA 1Z60A 3N9PA 4I7DA 2ECIA 2YU4A 2EODA 3C5KA 1LDKC 2CSZA 4B7YC 4GB0A 3KNVA 2RI7A 5G05B 2G45A 1IYMA 4CCGX 2C2VS 4PTBA 2M6MA 2H0DA 2YYRA 3MHSA 2MNYA 5TDRA 4S3OC 2KGIA 4GNDA 2F42A 2CSYA 2E6SA 2JRJA 3ZTGA 3EB6A 4TKPB 2CKLB 4BHWA 3V43A 4QF3A 2KWJA 2YHNA 1WEPA 5J3XA 3ZVYA 1WEQA 4FK5A 4A4CA 2L43A 4YAXA 1WE9A 2LXPC 3FL2A 5TRBA 1WEEA 2JMIA 1WEMA 5B75A 2LDRA 2E6RA 2YHOA 5B8DA 2KFTA 3I2DA 1Z2QA 3N9QA 4CA1A 2D8SA 4AP4A 3T7LA 2RSDA 3DQVR 5D1LB 2LGLA 5LKTA 1VYXA 1WGMA 2MIQA 2VNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L58 A;  2QIZ A;  2K16 A;  4WZ0 A;  1JM7 A;  2KIZ A;  3DPL R;  4V3L C;  2Y43 A;  2FSA A;  1MM3 A;  2YUC A;  2ZET C;  1WIM A;  4R2Y A;  2LQ6 A;  3SHB A;  2MA6 A;  4W4U A;  2PNX A;  4LAD B;  4A0C D;  1K2F A;  2G43 A;  3IHP A;  2MD8 C;  2G6Q A;  2ECJ A;  3LQI A;  2EGP A;  4AYC B;  4I7B A;  4V3K C;  1ZBD B;  2KWO A;  4A4B A;  4Q6F A;  2KWN A;  2JMJ A;  2LGV A;  1MM2 A;  1N87 A;  3LRQ A;  4UP0 A;  4P5O B;  2VJF B;  3NG2 A;  2Y1M A;  2CT2 A;  2LGG A;  4GNG A;  3M62 A;  2M85 A;  5KH3 A;  3O34 A;  2ECV A;  1F62 A;  3O7A A;  4WZ3 B;  1X4J A;  5G0F A;  2H0D B;  3KV6 A;  5TDW A;  3RPG B;  4LJN A;  2ECW A;  1WEO A;  4GNE A;  1WEN A;  5D1K B;  3N9L A;  4IC2 A;  4MVT A;  1DVP A;  4YAT A;  2MT5 A;  1BOR A;  1WEW A;  4C9Z A;  1WES A;  1LDJ B;  2KWK A;  5B79 A;  4WZ2 A;  3EB5 A;  3RTR B;  2VJE B;  3ASL A;  4MSX A;  4GNF A;  4I7C A;  3KV5 A;  4YAB A;  3U5P A;  1X4I A;  2KR4 A;  3PUQ A;  4NN2 A;  2L5U A;  3O37 A;  3VK6 A;  2KGG A;  2L75 A;  4ZUX U;  1E4U A;  4AUQ B;  2IDA A;  3M99 A;  4R8P K;  4QF2 A;  4AVX A;  5DIN A;  4N4F A;  4XI1 A;  1CHC A;  2XEU A;  4FIP A;  4ZDT A;  4BBQ A;  2LGK A;  3L1Z B;  4LLB A;  1VFY A;  5AIT A;  2XB1 A;  5EYA F;  2VPE A;  2KYU A;  5D1M B;  5TAB A;  3RPG C;  1WIL A;  4S3O B;  5KH9 A;  3ZVZ B;  4WA6 A;  1HYI A;  4YBT A;  1WEU A;  1FP0 A;  2YQM A;  5C13 A;  3HCS A;  2YW8 A;  4YC9 A;  2FUU A;  3ZPV 1;  3KQI A;  2KU3 A;  2YRE A;  2YQL A;  5G04 B;  5H1V A;  1XWH A;  2DX8 A;  3N9N A;  2K4D A;  2OXQ C;  3ZNI A;  3SOX A;  2JMD A;  3N9M A;  4ZQL A;  3O33 A;  1HYJ A;  3U5O A;  2KE1 A;  3SOU A;  2FUI A;  2I50 A;  5LCW B;  5FB1 A;  4LK9 A;  1Z6U A;  4AYC A;  2NAA A;  1WEV A;  2QJ0 A;  5I3L A;  3U5N A;  5B76 A;  4UP5 A;  3O70 A;  5LKU A;  2VJF A;  3PUR A;  4FJC A;  4YBS A;  5AIU A;  3PHD A;  4FO9 A;  4YBM A;  5TBN A;  2PUY A;  1V87 A;  3LQJ A;  3T6R A;  2MD7 B;  5JG6 A;  5FB0 A;  3L1X A;  3M63 A;  4IC3 A;  2LXH C;  4B86 C;  2L80 A;  2LRI C;  3HTK C;  3HCT A;  3U5M A;  5LKX A;  1WFK A;  2CKL A;  2VP7 A;  5C11 A;  2ECT A;  2HDP A;  5H1T A;  2YT5 A;  3HCU A;  5B77 A;  1U6G B;  4YAD A;  2LN0 A;  2VPG A;  2F6J A;  3QZV A;  2M3H A;  2MA5 A;  5DKA A;  3LQH A;  2YSJ A;  2M1R A;  2UZG A;  2Y1N A;  3O35 A;  5B78 A;  1VD4 A;  5H9M A;  2HYE D;  2VJE A;  2ECG A;  2QIC A;  4R7E A;  3GV4 A;  5LKZ A;  3L11 A;  2VPD A;  2KRE A;  4PPE A;  1JM7 B;  2EA6 A;  1X4U A;  1T1H A;  3N9O A;  2BAY A;  3ZYQ A;  3O36 A;  3C6W A;  4A49 A;  3GL6 A;  2ECN A;  1RMD A;  1JOC A;  4O64 A;  4N3W A;  3ZPV E;  2LV9 A;  2L0B A;  2YSM A;  3MHH A;  2F6N A;  4X3G A;  5H1U A;  2AN6 A;  2K17 A;  1FBV A;  2MNZ A;  5KH7 A;  4L7X A;  2C2L A;  2K1J A;  4LKA A;  1G25 A;  4F52 B;  3SOW A;  5FER A;  5FEY A;  2VPB A;  2YUR A;  4UI9 B;  2MUM A;  1Z60 A;  3N9P A;  4I7D A;  2ECI A;  2YU4 A;  2EOD A;  3C5K A;  1LDK C;  2CSZ A;  4B7Y C;  4GB0 A;  3KNV A;  2RI7 A;  5G05 B;  2G45 A;  1IYM A;  4CCG X;  2C2V S;  4PTB A;  2M6M A;  2H0D A;  2YYR A;  3MHS A;  2MNY A;  5TDR A;  4S3O C;  2KGI A;  4GND A;  2F42 A;  2CSY A;  2E6S A;  2JRJ A;  3ZTG A;  3EB6 A;  4TKP B;  2CKL B;  4BHW A;  3V43 A;  4QF3 A;  2KWJ A;  2YHN A;  1WEP A;  5J3X A;  3ZVY A;  1WEQ A;  4FK5 A;  4A4C A;  2L43 A;  4YAX A;  1WE9 A;  2LXP C;  3FL2 A;  5TRB A;  1WEE A;  2JMI A;  1WEM A;  5B75 A;  2LDR A;  2E6R A;  2YHO A;  5B8D A;  2KFT A;  3I2D A;  1Z2Q A;  3N9Q A;  4CA1 A;  2D8S A;  4AP4 A;  3T7L A;  2RSD A;  3DQV R;  5D1L B;  2LGL A;  5LKT A;  1VYX A;  1WGM A;  2MIQ A;  2VNF A; 
#chains in the Genus database with same CATH topology
 2CSV A;  4L58 A;  2QIZ A;  2K16 A;  4WZ0 A;  1JM7 A;  3LDY A;  2KIZ A;  3DPL R;  3T9K A;  4V3L C;  3KDE C;  2Y43 A;  3FEH A;  2FSA A;  1MM3 A;  3FM8 C;  2YUC A;  2ZET C;  1WIM A;  4R2Y A;  2LQ6 A;  3SHB A;  2MA6 A;  4W4U A;  2PNX A;  4LAD B;  4A0C D;  1K2F A;  2G43 A;  3M7K A;  3O47 A;  3IHP A;  2MD8 C;  2MKE A;  2G6Q A;  2ECJ A;  3LQI A;  2EGP A;  4AYC B;  2FD4 A;  4I7B A;  1ZBD B;  2KWO A;  4V3K C;  4A4B A;  5SVI A;  4Q6F A;  2KWN A;  2JMJ A;  2LGV A;  1MM2 A;  1N87 A;  3LRQ A;  4UP0 A;  4P5O B;  3SUB A;  2VJF B;  3NG2 A;  2Y1M A;  2CT2 A;  2LGG A;  4GNG A;  3M62 A;  2M85 A;  5KH3 A;  3O34 A;  2EGM A;  2ECV A;  1F62 A;  3O7A A;  4WZ3 B;  1X4J A;  5G0F A;  2H0D B;  3KV6 A;  5TDW A;  3RPG B;  4LJN A;  2ECW A;  1WEO A;  2DSM A;  4GNE A;  1WEN A;  5D1K B;  3N9L A;  4IC2 A;  3JUE A;  4MVT A;  4OGC A;  5SVX A;  1DVP A;  4YAT A;  3LVR E;  3DWD A;  2MT5 A;  1BOR A;  1WEW A;  4C9Z A;  1WES A;  4Z0O A;  1LDJ B;  2KWK A;  5B79 A;  2CON A;  4WZ2 A;  3EB5 A;  3RTR B;  2VJE B;  3ASL A;  2KKX A;  4MSX A;  4GNF A;  4I7C A;  3KV5 A;  4YAB A;  3U5P A;  1X4I A;  2KR4 A;  3PUQ A;  4NN2 A;  2IQJ A;  2L5U A;  3O37 A;  3VK6 A;  2KGG A;  4QQ4 A;  2L75 A;  4ZUX U;  1E4U A;  4AUQ B;  2IDA A;  3M99 A;  4R8P K;  4QF2 A;  4AVX A;  5DIN A;  4N4F A;  4XI1 A;  1CHC A;  2XEU A;  4FIP A;  4ZDT A;  4BBQ A;  3PLW A;  2LGK A;  3L1Z B;  4LLB A;  1VFY A;  5AIT A;  2XB1 A;  5EYA F;  2VPE A;  2KKY A;  2KYU A;  5D1M B;  5TAB A;  3RPG C;  1WIL A;  4S3O B;  5KH9 A;  3ZVZ B;  4WA6 A;  3LVQ E;  1HYI A;  4YBT A;  1WEU A;  1FP0 A;  2YQM A;  5C13 A;  3HCS A;  2YW8 A;  4YC9 A;  2FUU A;  3ZPV 1;  3KQI A;  2D8U A;  2EXU A;  2KU3 A;  2YRE A;  2YQL A;  5G04 B;  5H1V A;  1XWH A;  2DX8 A;  3N9N A;  2K4D A;  2OXQ C;  3ZNI A;  3SOX A;  2JMD A;  3N9M A;  4ZQL A;  3DDT A;  3O33 A;  1HYJ A;  3U5O A;  2KE1 A;  5SVI B;  2FUI A;  2I50 A;  3SOU A;  4OGE A;  5LCW B;  5FB1 A;  4LK9 A;  1Z6U A;  4AYC A;  2XP0 A;  2NAA A;  1WEV A;  2QJ0 A;  5I3L A;  2P57 A;  3U5N A;  5B76 A;  2E61 A;  4UP5 A;  4F1P A;  3O70 A;  5LKU A;  2VJF A;  3FJU B;  3PUR A;  4FJC A;  4YBS A;  5AIU A;  3PHD A;  4FO9 A;  4YBM A;  5TBN A;  2L7P A;  2LAU A;  2PUY A;  2XOY A;  1V87 A;  3LQJ A;  3T6R A;  2MD7 B;  5JG6 A;  5FB0 A;  3L1X A;  3M63 A;  4IC3 A;  2LXH C;  4B86 C;  2L80 A;  2LRI C;  3HTK C;  3HCT A;  3U5M A;  5LKX A;  1WFK A;  2CKL A;  3E2D A;  4H9D A;  2VP7 A;  5C11 A;  2ECT A;  2HDP A;  2RR4 A;  5H1T A;  2YT5 A;  3HCU A;  5B77 A;  1U6G B;  4YAD A;  2LN0 A;  2VPG A;  2F6J A;  2JUN A;  2XOC A;  3QZV A;  2M3H A;  2MA5 A;  5DKA A;  3LQH A;  2OWA A;  2YSJ A;  2M1R A;  2UZG A;  2Y1N A;  3O35 A;  5B78 A;  1VD4 A;  5H9M A;  2HYE D;  2VJE A;  2ECG A;  2QIC A;  4R7E A;  3FAO A;  3GV4 A;  5LKZ A;  3L11 A;  2VPD A;  2KRE A;  4PPE A;  1JM7 B;  2EA6 A;  1X4U A;  1T1H A;  3N9O A;  2BAY A;  3ZYQ A;  3O36 A;  3C6W A;  4A49 A;  5K3Q A;  3GL6 A;  2ECN A;  1RMD A;  1JOC A;  4O64 A;  4N3W A;  3ZPV E;  2LV9 A;  2L0B A;  2YSM A;  3MHH A;  2F6N A;  4X3G A;  5H1U A;  2AN6 A;  2K17 A;  1FBV A;  2DJA A;  2MNZ A;  2XOZ A;  5KH7 A;  4Z0R A;  4L7X A;  2C2L A;  2K1J A;  4LKA A;  1G25 A;  4F52 B;  3SOW A;  5FER A;  5FEY A;  1MBM A;  2VPB A;  2YUR A;  2JM3 A;  4UI9 B;  3LJU X;  2MUM A;  1Z60 A;  3N9P A;  2FFW A;  4I7D A;  2ECI A;  2YU4 A;  2EOD A;  3C5K A;  1LDK C;  2CSZ A;  4B7Y C;  4GB0 A;  3KNV A;  2RI7 A;  5G05 B;  2G45 A;  1IYM A;  4CCG X;  2C2V S;  4PTB A;  2M6M A;  2H0D A;  2YYR A;  3MHS A;  2CRW A;  2MNY A;  5TDR A;  3MDB C;  2KGI A;  4S3O C;  4GND A;  2F42 A;  2CSY A;  2E6S A;  3FAN A;  2JRJ A;  3ZTG A;  4O62 A;  3EB6 A;  4TKP B;  2CKL B;  4BHW A;  2B0O E;  3Q1D A;  3V43 A;  4QF3 A;  2KWJ A;  2YHN A;  1WEP A;  5J3X A;  3ZVY A;  1WEQ A;  4FK5 A;  4A4C A;  2L43 A;  4YAX A;  2M13 A;  1WE9 A;  2LXP C;  3FL2 A;  1WEE A;  2JMI A;  5TRB A;  1WEM A;  5B75 A;  2LDR A;  5SVY A;  2E6R A;  2YHO A;  5B8D A;  2CRR A;  2KFT A;  3I2D A;  1DCQ A;  1Z2Q A;  3N9Q A;  4CA1 A;  2D8S A;  4AP4 A;  3T7L A;  2RSD A;  3DQV R;  5D1L B;  2YVR A;  3H7H A;  2LGL A;  5LKT A;  1VYX A;  1WGM A;  2MIQ A;  2VNF A; 
#chains in the Genus database with same CATH homology
 4L58 A;  2QIZ A;  2K16 A;  4WZ0 A;  1JM7 A;  2KIZ A;  3DPL R;  4V3L C;  2Y43 A;  2FSA A;  1MM3 A;  2YUC A;  2ZET C;  1WIM A;  4R2Y A;  2LQ6 A;  3SHB A;  2MA6 A;  4W4U A;  2PNX A;  4LAD B;  4A0C D;  1K2F A;  2G43 A;  3IHP A;  2MD8 C;  2G6Q A;  2ECJ A;  3LQI A;  2EGP A;  4AYC B;  4I7B A;  4V3K C;  1ZBD B;  2KWO A;  4A4B A;  4Q6F A;  2KWN A;  2JMJ A;  2LGV A;  1MM2 A;  1N87 A;  3LRQ A;  4UP0 A;  4P5O B;  2VJF B;  3NG2 A;  2Y1M A;  2CT2 A;  2LGG A;  4GNG A;  3M62 A;  2M85 A;  5KH3 A;  3O34 A;  2ECV A;  1F62 A;  3O7A A;  4WZ3 B;  1X4J A;  5G0F A;  2H0D B;  3KV6 A;  5TDW A;  3RPG B;  4LJN A;  2ECW A;  1WEO A;  4GNE A;  1WEN A;  5D1K B;  3N9L A;  4IC2 A;  4MVT A;  1DVP A;  4YAT A;  2MT5 A;  1BOR A;  1WEW A;  4C9Z A;  1WES A;  1LDJ B;  2KWK A;  5B79 A;  4WZ2 A;  3EB5 A;  3RTR B;  2VJE B;  3ASL A;  4MSX A;  4GNF A;  4I7C A;  3KV5 A;  4YAB A;  3U5P A;  1X4I A;  2KR4 A;  3PUQ A;  4NN2 A;  2L5U A;  3O37 A;  3VK6 A;  2KGG A;  2L75 A;  4ZUX U;  1E4U A;  4AUQ B;  2IDA A;  3M99 A;  4R8P K;  4QF2 A;  4AVX A;  5DIN A;  4N4F A;  4XI1 A;  1CHC A;  2XEU A;  4FIP A;  4ZDT A;  4BBQ A;  2LGK A;  3L1Z B;  4LLB A;  1VFY A;  5AIT A;  2XB1 A;  5EYA F;  2VPE A;  2KYU A;  5D1M B;  5TAB A;  3RPG C;  1WIL A;  4S3O B;  5KH9 A;  3ZVZ B;  4WA6 A;  1HYI A;  4YBT A;  1WEU A;  1FP0 A;  2YQM A;  5C13 A;  3HCS A;  2YW8 A;  4YC9 A;  2FUU A;  3ZPV 1;  3KQI A;  2KU3 A;  2YRE A;  2YQL A;  5G04 B;  5H1V A;  1XWH A;  2DX8 A;  3N9N A;  2K4D A;  2OXQ C;  3ZNI A;  3SOX A;  2JMD A;  3N9M A;  4ZQL A;  3O33 A;  1HYJ A;  3U5O A;  2KE1 A;  3SOU A;  2FUI A;  2I50 A;  5LCW B;  5FB1 A;  4LK9 A;  1Z6U A;  4AYC A;  2NAA A;  1WEV A;  2QJ0 A;  5I3L A;  3U5N A;  5B76 A;  4UP5 A;  3O70 A;  5LKU A;  2VJF A;  3PUR A;  4FJC A;  4YBS A;  5AIU A;  3PHD A;  4FO9 A;  4YBM A;  5TBN A;  2PUY A;  1V87 A;  3LQJ A;  3T6R A;  2MD7 B;  5JG6 A;  5FB0 A;  3L1X A;  3M63 A;  4IC3 A;  2LXH C;  4B86 C;  2L80 A;  2LRI C;  3HTK C;  3HCT A;  3U5M A;  5LKX A;  1WFK A;  2CKL A;  2VP7 A;  5C11 A;  2ECT A;  2HDP A;  5H1T A;  2YT5 A;  3HCU A;  5B77 A;  1U6G B;  4YAD A;  2LN0 A;  2VPG A;  2F6J A;  3QZV A;  2M3H A;  2MA5 A;  5DKA A;  3LQH A;  2YSJ A;  2M1R A;  2UZG A;  2Y1N A;  3O35 A;  5B78 A;  1VD4 A;  5H9M A;  2HYE D;  2VJE A;  2ECG A;  2QIC A;  4R7E A;  3GV4 A;  5LKZ A;  3L11 A;  2VPD A;  2KRE A;  4PPE A;  1JM7 B;  2EA6 A;  1X4U A;  1T1H A;  3N9O A;  2BAY A;  3ZYQ A;  3O36 A;  3C6W A;  4A49 A;  3GL6 A;  2ECN A;  1RMD A;  1JOC A;  4O64 A;  4N3W A;  3ZPV E;  2LV9 A;  2L0B A;  2YSM A;  3MHH A;  2F6N A;  4X3G A;  5H1U A;  2AN6 A;  2K17 A;  1FBV A;  2MNZ A;  5KH7 A;  4L7X A;  2C2L A;  2K1J A;  4LKA A;  1G25 A;  4F52 B;  3SOW A;  5FER A;  5FEY A;  2VPB A;  2YUR A;  4UI9 B;  2MUM A;  1Z60 A;  3N9P A;  4I7D A;  2ECI A;  2YU4 A;  2EOD A;  3C5K A;  1LDK C;  2CSZ A;  4B7Y C;  4GB0 A;  3KNV A;  2RI7 A;  5G05 B;  2G45 A;  1IYM A;  4CCG X;  2C2V S;  4PTB A;  2M6M A;  2H0D A;  2YYR A;  3MHS A;  2MNY A;  5TDR A;  4S3O C;  2KGI A;  4GND A;  2F42 A;  2CSY A;  2E6S A;  2JRJ A;  3ZTG A;  3EB6 A;  4TKP B;  2CKL B;  4BHW A;  3V43 A;  4QF3 A;  2KWJ A;  2YHN A;  1WEP A;  5J3X A;  3ZVY A;  1WEQ A;  4FK5 A;  4A4C A;  2L43 A;  4YAX A;  1WE9 A;  2LXP C;  3FL2 A;  5TRB A;  1WEE A;  2JMI A;  1WEM A;  5B75 A;  2LDR A;  2E6R A;  2YHO A;  5B8D A;  2KFT A;  3I2D A;  1Z2Q A;  3N9Q A;  4CA1 A;  2D8S A;  4AP4 A;  3T7L A;  2RSD A;  3DQV R;  5D1L B;  2LGL A;  5LKT A;  1VYX A;  1WGM A;  2MIQ A;  2VNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...