3T6RA

Structure of uhrf1 in complex with unmodified h3 n-terminal tail
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
APEFGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title UHRF1 double tudor domain and the adjacent PHD finger act together to recognize K9me3-containing histone H3 tail
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase UHRF1
total genus 10
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3t6rA00
2MUMA 3QZVA 1CHCA 3C6WA 4AYCB 3IHPA 4A4CA 2FSAA 3EB6A 1X4JA 3N9OA 1WEWA 2YSJA 2Y1MA 5TDWA 2C2LA 1MM3A 3O7AA 4UP0A 2EODA 1E4UA 2ECIA 2M1RA 2XEUA 5AITA 3VK6A 4PTBA 2ECJA 2KU3A 2L0BA 2CKLA 1JOCA 4R8PK 5TDRA 1WE9A 2ECWA 4YBTA 1K2FA 1HYIA 2M85A 4W4UA 4I7DA 2RI7A 3SOWA 2ECNA 2HYED 4YBMA 5FB0A 2LGKA 1BORA 5B79A 2EA6A 2G43A 2CT2A 2LGGA 5H9MA 2JRJA 1WEMA 5JG6A 3ZVYA 1WILA 4FIPA 4YC9A 2L75A 2E6RA 5DINA 2YQMA 1DVPA 2D8SA 2LQ6A 4ZDTA 3N9QA 5D1MB 4WZ2A 4A4BA 4FK5A 2YYRA 3U5OA 2VPEA 3ZVZB 2LRIC 4AP4A 1ZBDB 4GNFA 2HDPA 2MNYA 2H0DB 3HTKC 5G0FA 2YHOA 4WZ0A 1WEQA 5J3XA 3M63A 4YADA 4TKPB 3HCTA 2LXHC 4GNDA 4QF3A 3SOUA 1VD4A 2KWOA 2CSYA 2UZGA 4L58A 1WEEA 4GNEA 1JM7A 5B76A 2L5UA 3KV6A 2LV9A 5G04B 2KGIA 3LQHA 2VJEB 4A49A 5KH3A 2ZETC 2VJEA 3L1XA 3N9NA 5I3LA 3DPLR 2VPGA 3O34A 2L43A 4V3KC 3U5PA 2QICA 1Z6UA 1N87A 2E6SA 3L1ZB 3RPGB 4BBQA 3O37A 4S3OC 5TABA 1WENA 1U6GB 1WEOA 1V87A 5LKTA 3N9MA 5H1VA 2G6QA 2M3HA 4I7BA 3ZNIA 4YATA 5TRBA 4GB0A 4MSXA 1WEPA 2DX8A 3DQVR 3HCUA 2VPDA 4S3OB 2KGGA 2YU4A 2ECGA 4YBSA 4C9ZA 2CSZA 2QIZA 1G25A 2LXPC 2LGLA 1LDKC 4O64A 3PURA 5B78A 2KFTA 3LRQA 4F52B 1RMDA 3M99A 2LDRA 2KREA 2XB1A 3RPGC 2KR4A 4N3WA 2F42A 3GL6A 2YQLA 2IDAA 4CCGX 1X4IA 3V43A 4B7YC 2C2VS 2MA6A 2FUIA 5B8DA 4WZ3B 2H0DA 4R2YA 4IC3A 4AVXA 1MM2A 4UI9B 3MHHA 4Q6FA 4YAXA 4P5OB 3PUQA 4ZUXU 2Y43A 1LDJB 3ZPV1 3O70A 3ASLA 4I7CA 2K16A 2VNFA 4MVTA 2KWJA 2Y1NA 4AYCA 5FEYA 4R7EA 2VP7A 5LCWB 3SHBA 2RSDA 4FJCA 3N9LA 5B77A 5LKZA 2JMDA 3SOXA 2L80A 1WGMA 2PNXA 3LQIA 5C13A 2MIQA 3FL2A 1VYXA 3EB5A 1X4UA 5FB1A 1FP0A 1T1HA 3KNVA 2M6MA 5LKUA 2KIZA 3O33A 4AUQB 2VPBA 1WEUA 2CKLB 1F62A 3O36A 2ECVA 2LN0A 1JM7B 2KWKA 3ZTGA 3U5MA 2JMJA 2OXQC 2I50A 2K4DA 5D1LB 2AN6A 1WEVA 3T7LA 1VFYA 5KH7A 2YHNA 4LJNA 2YUCA 4ZQLA 2NAAA 1FBVA 4X3GA 3MHSA 1Z2QA 5C11A 4IC2A 2YREA 3I2DA 1HYJA 4B86C 5AIUA 4LLBA 5FERA 4V3LC 5D1KB 2BAYA 2PUYA 2MNZA 2MT5A 4YABA 5H1TA 4FO9A 4UP5A 4LKAA 3N9PA 4GNGA 3T6RA 2YURA 2VJFA 3O35A 3ZPVE 2QJ0A 4A0CD 1IYMA 1WFKA 2YSMA 3GV4A 4LK9A 3KQIA 2KWNA 5KH9A 1XWHA 4PPEA 2LGVA 3ZYQA 2KYUA 4CA1A 4XI1A 4WA6A 3HCSA 3LQJA 3PHDA 5G05B 2YT5A 2K1JA 2FUUA 4N4FA 5B75A 2KE1A 2JMIA 4L7XA 1WIMA 3KV5A 5TBNA 2MD8C 3L11A 4NN2A 2F6JA 4BHWA 5H1UA 3NG2A 2VJFB 3U5NA 2ECTA 4QF2A 5DKAA 4LADB 1WESA 2G45A 2MD7B 5EYAF 2EGPA 3M62A 1Z60A 2MA5A 2K17A 3RTRB 2F6NA 5LKXA 2YW8A 3C5KA
chains in the Genus database with same CATH superfamily
2XOCA 2MUMA 5SVXA 3O47A 3QZVA 1CHCA 3C6WA 4AYCB 3IHPA 4A4CA 2FSAA 2RR4A 3EB6A 1X4JA 3N9OA 1WEWA 3LVRE 2E61A 2YSJA 3DWDA 2Y1MA 5TDWA 2C2LA 1MM3A 3O7AA 3FJUB 4UP0A 2EODA 1E4UA 2ECIA 2D8UA 2M1RA 2XEUA 5AITA 3VK6A 3JUEA 4PTBA 2ECJA 2KU3A 2L0BA 2CKLA 1JOCA 4R8PK 5TDRA 1WE9A 2ECWA 4YBTA 1K2FA 1HYIA 2M85A 2LAUA 4W4UA 2EGMA 4I7DA 2RI7A 3SOWA 2ECNA 2HYED 4YBMA 3LDYA 5FB0A 2LGKA 1BORA 5B79A 2EA6A 2G43A 2CT2A 2LGGA 5H9MA 2JRJA 3Q1DA 1WEMA 5JG6A 3ZVYA 1WILA 3DDTA 4FIPA 4YC9A 2L75A 2E6RA 3FAOA 5DINA 2YQMA 3E2DA 1DVPA 2D8SA 2LQ6A 4ZDTA 3FANA 3N9QA 5D1MB 4WZ2A 4A4BA 4FK5A 2YYRA 3U5OA 2VPEA 3ZVZB 2LRIC 4AP4A 1ZBDB 4GNFA 2HDPA 3T9KA 2MNYA 2H0DB 2CRRA 3HTKC 5G0FA 2YHOA 4WZ0A 1WEQA 5J3XA 3M63A 4YADA 4TKPB 2DSMA 3HCTA 2LXHC 4GNDA 4QF3A 3SOUA 1VD4A 2KWOA 2CSYA 2P57A 2UZGA 4L58A 1WEEA 4GNEA 1JM7A 5B76A 2L5UA 2DJAA 2LV9A 3KV6A 5G04B 2KGIA 5SVIB 3M7KA 3LQHA 2VJEB 2FFWA 4A49A 5KH3A 2ZETC 2VJEA 3L1XA 3N9NA 5I3LA 3DPLR 2VPGA 3O34A 2CRWA 2L43A 4V3KC 3U5PA 2QICA 1Z6UA 1N87A 2E6SA 3L1ZB 3RPGB 4BBQA 3O37A 4S3OC 5TABA 1WENA 1U6GB 1WEOA 1V87A 1MBMA 5LKTA 3N9MA 5H1VA 2G6QA 2M3HA 4I7BA 3ZNIA 4YATA 5TRBA 4GB0A 4MSXA 1WEPA 2DX8A 2KKXA 3DQVR 3HCUA 2VPDA 4S3OB 2KGGA 2YU4A 2ECGA 4YBSA 4C9ZA 2CSZA 2QIZA 5K3QA 1G25A 2LXPC 4OGCA 2LGLA 1LDKC 4O64A 3PURA 5B78A 2KFTA 3LRQA 4F52B 1RMDA 3M99A 2LDRA 2KREA 4H9DA 3LVQE 2XB1A 3RPGC 2KR4A 4N3WA 2F42A 3GL6A 2YQLA 2IDAA 4CCGX 1X4IA 3V43A 4B7YC 2C2VS 2MA6A 2FUIA 5B8DA 4WZ3B 2H0DA 4R2YA 4IC3A 4AVXA 1MM2A 4UI9B 3MHHA 4OGEA 4Q6FA 4YAXA 4P5OB 3PUQA 4ZUXU 2Y43A 1LDJB 3ZPV1 3O70A 3ASLA 4I7CA 3LJUX 3H7HA 2K16A 3KDEC 4F1PA 2VNFA 4MVTA 2JUNA 2KWJA 2Y1NA 4AYCA 5FEYA 4R7EA 2VP7A 5LCWB 2IQJA 4Z0RA 3SHBA 2RSDA 4FJCA 3N9LA 5B77A 5LKZA 2JMDA 3SOXA 2L80A 1WGMA 2PNXA 3LQIA 2CONA 5C13A 2MIQA 3FL2A 1VYXA 3EB5A 1X4UA 5FB1A 3PLWA 2FD4A 1FP0A 1T1HA 3KNVA 2JM3A 2M6MA 5LKUA 2KIZA 3O33A 4AUQB 2VPBA 1WEUA 2MKEA 2CKLB 1F62A 3O36A 2ECVA 2XOYA 2LN0A 1JM7B 2KWKA 5SVIA 3ZTGA 3SUBA 2JMJA 2OXQC 2I50A 3U5MA 2K4DA 5D1LB 2AN6A 1WEVA 3T7LA 1VFYA 2KKYA 5KH7A 2YHNA 4LJNA 2YUCA 5SVYA 4ZQLA 2NAAA 1FBVA 4X3GA 3MHSA 1Z2QA 5C11A 4IC2A 2YREA 3I2DA 4Z0OA 3FEHA 1HYJA 4B86C 5AIUA 4LLBA 5FERA 4V3LC 5D1KB 2BAYA 2PUYA 2MNZA 2MT5A 4YABA 5H1TA 4FO9A 4UP5A 4LKAA 3N9PA 4GNGA 3FM8C 3T6RA 2YURA 2VJFA 2OWAA 3O35A 3ZPVE 2EXUA 2QJ0A 4A0CD 1IYMA 3MDBC 1WFKA 2YSMA 3GV4A 4LK9A 3KQIA 2KWNA 5KH9A 1XWHA 4PPEA 2LGVA 3ZYQA 2KYUA 4CA1A 4XI1A 2CSVA 4WA6A 3HCSA 3LQJA 3PHDA 5G05B 2YT5A 1DCQA 2K1JA 2FUUA 4N4FA 4O62A 5B75A 2KE1A 2JMIA 2YVRA 4L7XA 1WIMA 4QQ4A 2XP0A 3KV5A 2M13A 5TBNA 2MD8C 3L11A 4NN2A 2F6JA 2L7PA 4BHWA 5H1UA 3NG2A 2VJFB 3U5NA 2ECTA 4QF2A 5DKAA 4LADB 1WESA 2G45A 2MD7B 5EYAF 2EGPA 3M62A 1Z60A 2MA5A 2K17A 3RTRB 2F6NA 2XOZA 5LKXA 2YW8A 2B0OE 3C5KA
chains in the Genus database with same CATH topology
2MUMA 3QZVA 1CHCA 3C6WA 4AYCB 3IHPA 4A4CA 2FSAA 3EB6A 1X4JA 3N9OA 1WEWA 2YSJA 2Y1MA 5TDWA 2C2LA 1MM3A 3O7AA 4UP0A 2EODA 1E4UA 2ECIA 2M1RA 2XEUA 5AITA 3VK6A 4PTBA 2ECJA 2KU3A 2L0BA 2CKLA 1JOCA 4R8PK 5TDRA 1WE9A 2ECWA 4YBTA 1K2FA 1HYIA 2M85A 4W4UA 4I7DA 2RI7A 3SOWA 2ECNA 2HYED 4YBMA 5FB0A 2LGKA 1BORA 5B79A 2EA6A 2G43A 2CT2A 2LGGA 5H9MA 2JRJA 1WEMA 5JG6A 3ZVYA 1WILA 4FIPA 4YC9A 2L75A 2E6RA 5DINA 2YQMA 1DVPA 2D8SA 2LQ6A 4ZDTA 3N9QA 5D1MB 4WZ2A 4A4BA 4FK5A 2YYRA 3U5OA 2VPEA 3ZVZB 2LRIC 4AP4A 1ZBDB 4GNFA 2HDPA 2MNYA 2H0DB 3HTKC 5G0FA 2YHOA 4WZ0A 1WEQA 5J3XA 3M63A 4YADA 4TKPB 3HCTA 2LXHC 4GNDA 4QF3A 3SOUA 1VD4A 2KWOA 2CSYA 2UZGA 4L58A 1WEEA 4GNEA 1JM7A 5B76A 2L5UA 3KV6A 2LV9A 5G04B 2KGIA 3LQHA 2VJEB 4A49A 5KH3A 2ZETC 2VJEA 3L1XA 3N9NA 5I3LA 3DPLR 2VPGA 3O34A 2L43A 4V3KC 3U5PA 2QICA 1Z6UA 1N87A 2E6SA 3L1ZB 3RPGB 4BBQA 3O37A 4S3OC 5TABA 1WENA 1U6GB 1WEOA 1V87A 5LKTA 3N9MA 5H1VA 2G6QA 2M3HA 4I7BA 3ZNIA 4YATA 5TRBA 4GB0A 4MSXA 1WEPA 2DX8A 3DQVR 3HCUA 2VPDA 4S3OB 2KGGA 2YU4A 2ECGA 4YBSA 4C9ZA 2CSZA 2QIZA 1G25A 2LXPC 2LGLA 1LDKC 4O64A 3PURA 5B78A 2KFTA 3LRQA 4F52B 1RMDA 3M99A 2LDRA 2KREA 2XB1A 3RPGC 2KR4A 4N3WA 2F42A 3GL6A 2YQLA 2IDAA 4CCGX 1X4IA 3V43A 4B7YC 2C2VS 2MA6A 2FUIA 5B8DA 4WZ3B 2H0DA 4R2YA 4IC3A 4AVXA 1MM2A 4UI9B 3MHHA 4Q6FA 4YAXA 4P5OB 3PUQA 4ZUXU 2Y43A 1LDJB 3ZPV1 3O70A 3ASLA 4I7CA 2K16A 2VNFA 4MVTA 2KWJA 2Y1NA 4AYCA 5FEYA 4R7EA 2VP7A 5LCWB 3SHBA 2RSDA 4FJCA 3N9LA 5B77A 5LKZA 2JMDA 3SOXA 2L80A 1WGMA 2PNXA 3LQIA 5C13A 2MIQA 3FL2A 1VYXA 3EB5A 1X4UA 5FB1A 1FP0A 1T1HA 3KNVA 2M6MA 5LKUA 2KIZA 3O33A 4AUQB 2VPBA 1WEUA 2CKLB 1F62A 3O36A 2ECVA 2LN0A 1JM7B 2KWKA 3ZTGA 3U5MA 2JMJA 2OXQC 2I50A 2K4DA 5D1LB 2AN6A 1WEVA 3T7LA 1VFYA 5KH7A 2YHNA 4LJNA 2YUCA 4ZQLA 2NAAA 1FBVA 4X3GA 3MHSA 1Z2QA 5C11A 4IC2A 2YREA 3I2DA 1HYJA 4B86C 5AIUA 4LLBA 5FERA 4V3LC 5D1KB 2BAYA 2PUYA 2MNZA 2MT5A 4YABA 5H1TA 4FO9A 4UP5A 4LKAA 3N9PA 4GNGA 3T6RA 2YURA 2VJFA 3O35A 3ZPVE 2QJ0A 4A0CD 1IYMA 1WFKA 2YSMA 3GV4A 4LK9A 3KQIA 2KWNA 5KH9A 1XWHA 4PPEA 2LGVA 3ZYQA 2KYUA 4CA1A 4XI1A 4WA6A 3HCSA 3LQJA 3PHDA 5G05B 2YT5A 2K1JA 2FUUA 4N4FA 5B75A 2KE1A 2JMIA 4L7XA 1WIMA 3KV5A 5TBNA 2MD8C 3L11A 4NN2A 2F6JA 4BHWA 5H1UA 3NG2A 2VJFB 3U5NA 2ECTA 4QF2A 5DKAA 4LADB 1WESA 2G45A 2MD7B 5EYAF 2EGPA 3M62A 1Z60A 2MA5A 2K17A 3RTRB 2F6NA 5LKXA 2YW8A 3C5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MUM A;  3QZV A;  1CHC A;  3C6W A;  4AYC B;  3IHP A;  4A4C A;  2FSA A;  3EB6 A;  1X4J A;  3N9O A;  1WEW A;  2YSJ A;  2Y1M A;  5TDW A;  2C2L A;  1MM3 A;  3O7A A;  4UP0 A;  2EOD A;  1E4U A;  2ECI A;  2M1R A;  2XEU A;  5AIT A;  3VK6 A;  4PTB A;  2ECJ A;  2KU3 A;  2L0B A;  2CKL A;  1JOC A;  4R8P K;  5TDR A;  1WE9 A;  2ECW A;  4YBT A;  1K2F A;  1HYI A;  2M85 A;  4W4U A;  4I7D A;  2RI7 A;  3SOW A;  2ECN A;  2HYE D;  4YBM A;  5FB0 A;  2LGK A;  1BOR A;  5B79 A;  2EA6 A;  2G43 A;  2CT2 A;  2LGG A;  5H9M A;  2JRJ A;  1WEM A;  5JG6 A;  3ZVY A;  1WIL A;  4FIP A;  4YC9 A;  2L75 A;  2E6R A;  5DIN A;  2YQM A;  1DVP A;  2D8S A;  2LQ6 A;  4ZDT A;  3N9Q A;  5D1M B;  4WZ2 A;  4A4B A;  4FK5 A;  2YYR A;  3U5O A;  2VPE A;  3ZVZ B;  2LRI C;  4AP4 A;  1ZBD B;  4GNF A;  2HDP A;  2MNY A;  2H0D B;  3HTK C;  5G0F A;  2YHO A;  4WZ0 A;  1WEQ A;  5J3X A;  3M63 A;  4YAD A;  4TKP B;  3HCT A;  2LXH C;  4GND A;  4QF3 A;  3SOU A;  1VD4 A;  2KWO A;  2CSY A;  2UZG A;  4L58 A;  1WEE A;  4GNE A;  1JM7 A;  5B76 A;  2L5U A;  3KV6 A;  2LV9 A;  5G04 B;  2KGI A;  3LQH A;  2VJE B;  4A49 A;  5KH3 A;  2ZET C;  2VJE A;  3L1X A;  3N9N A;  5I3L A;  3DPL R;  2VPG A;  3O34 A;  2L43 A;  4V3K C;  3U5P A;  2QIC A;  1Z6U A;  1N87 A;  2E6S A;  3L1Z B;  3RPG B;  4BBQ A;  3O37 A;  4S3O C;  5TAB A;  1WEN A;  1U6G B;  1WEO A;  1V87 A;  5LKT A;  3N9M A;  5H1V A;  2G6Q A;  2M3H A;  4I7B A;  3ZNI A;  4YAT A;  5TRB A;  4GB0 A;  4MSX A;  1WEP A;  2DX8 A;  3DQV R;  3HCU A;  2VPD A;  4S3O B;  2KGG A;  2YU4 A;  2ECG A;  4YBS A;  4C9Z A;  2CSZ A;  2QIZ A;  1G25 A;  2LXP C;  2LGL A;  1LDK C;  4O64 A;  3PUR A;  5B78 A;  2KFT A;  3LRQ A;  4F52 B;  1RMD A;  3M99 A;  2LDR A;  2KRE A;  2XB1 A;  3RPG C;  2KR4 A;  4N3W A;  2F42 A;  3GL6 A;  2YQL A;  2IDA A;  4CCG X;  1X4I A;  3V43 A;  4B7Y C;  2C2V S;  2MA6 A;  2FUI A;  5B8D A;  4WZ3 B;  2H0D A;  4R2Y A;  4IC3 A;  4AVX A;  1MM2 A;  4UI9 B;  3MHH A;  4Q6F A;  4YAX A;  4P5O B;  3PUQ A;  4ZUX U;  2Y43 A;  1LDJ B;  3ZPV 1;  3O70 A;  3ASL A;  4I7C A;  2K16 A;  2VNF A;  4MVT A;  2KWJ A;  2Y1N A;  4AYC A;  5FEY A;  4R7E A;  2VP7 A;  5LCW B;  3SHB A;  2RSD A;  4FJC A;  3N9L A;  5B77 A;  5LKZ A;  2JMD A;  3SOX A;  2L80 A;  1WGM A;  2PNX A;  3LQI A;  5C13 A;  2MIQ A;  3FL2 A;  1VYX A;  3EB5 A;  1X4U A;  5FB1 A;  1FP0 A;  1T1H A;  3KNV A;  2M6M A;  5LKU A;  2KIZ A;  3O33 A;  4AUQ B;  2VPB A;  1WEU A;  2CKL B;  1F62 A;  3O36 A;  2ECV A;  2LN0 A;  1JM7 B;  2KWK A;  3ZTG A;  3U5M A;  2JMJ A;  2OXQ C;  2I50 A;  2K4D A;  5D1L B;  2AN6 A;  1WEV A;  3T7L A;  1VFY A;  5KH7 A;  2YHN A;  4LJN A;  2YUC A;  4ZQL A;  2NAA A;  1FBV A;  4X3G A;  3MHS A;  1Z2Q A;  5C11 A;  4IC2 A;  2YRE A;  3I2D A;  1HYJ A;  4B86 C;  5AIU A;  4LLB A;  5FER A;  4V3L C;  5D1K B;  2BAY A;  2PUY A;  2MNZ A;  2MT5 A;  4YAB A;  5H1T A;  4FO9 A;  4UP5 A;  4LKA A;  3N9P A;  4GNG A;  3T6R A;  2YUR A;  2VJF A;  3O35 A;  3ZPV E;  2QJ0 A;  4A0C D;  1IYM A;  1WFK A;  2YSM A;  3GV4 A;  4LK9 A;  3KQI A;  2KWN A;  5KH9 A;  1XWH A;  4PPE A;  2LGV A;  3ZYQ A;  2KYU A;  4CA1 A;  4XI1 A;  4WA6 A;  3HCS A;  3LQJ A;  3PHD A;  5G05 B;  2YT5 A;  2K1J A;  2FUU A;  4N4F A;  5B75 A;  2KE1 A;  2JMI A;  4L7X A;  1WIM A;  3KV5 A;  5TBN A;  2MD8 C;  3L11 A;  4NN2 A;  2F6J A;  4BHW A;  5H1U A;  3NG2 A;  2VJF B;  3U5N A;  2ECT A;  4QF2 A;  5DKA A;  4LAD B;  1WES A;  2G45 A;  2MD7 B;  5EYA F;  2EGP A;  3M62 A;  1Z60 A;  2MA5 A;  2K17 A;  3RTR B;  2F6N A;  5LKX A;  2YW8 A;  3C5K A; 
#chains in the Genus database with same CATH topology
 2XOC A;  2MUM A;  5SVX A;  3O47 A;  3QZV A;  1CHC A;  3C6W A;  4AYC B;  3IHP A;  4A4C A;  2FSA A;  2RR4 A;  3EB6 A;  1X4J A;  3N9O A;  1WEW A;  3LVR E;  2E61 A;  2YSJ A;  3DWD A;  2Y1M A;  5TDW A;  2C2L A;  1MM3 A;  3O7A A;  3FJU B;  4UP0 A;  2EOD A;  1E4U A;  2ECI A;  2D8U A;  2M1R A;  2XEU A;  5AIT A;  3VK6 A;  3JUE A;  4PTB A;  2ECJ A;  2KU3 A;  2L0B A;  2CKL A;  1JOC A;  4R8P K;  5TDR A;  1WE9 A;  2ECW A;  4YBT A;  1K2F A;  1HYI A;  2M85 A;  2LAU A;  4W4U A;  2EGM A;  4I7D A;  2RI7 A;  3SOW A;  2ECN A;  2HYE D;  4YBM A;  3LDY A;  5FB0 A;  2LGK A;  1BOR A;  5B79 A;  2EA6 A;  2G43 A;  2CT2 A;  2LGG A;  5H9M A;  2JRJ A;  3Q1D A;  1WEM A;  5JG6 A;  3ZVY A;  1WIL A;  3DDT A;  4FIP A;  4YC9 A;  2L75 A;  2E6R A;  3FAO A;  5DIN A;  2YQM A;  3E2D A;  1DVP A;  2D8S A;  2LQ6 A;  4ZDT A;  3FAN A;  3N9Q A;  5D1M B;  4WZ2 A;  4A4B A;  4FK5 A;  2YYR A;  3U5O A;  2VPE A;  3ZVZ B;  2LRI C;  4AP4 A;  1ZBD B;  4GNF A;  2HDP A;  3T9K A;  2MNY A;  2H0D B;  2CRR A;  3HTK C;  5G0F A;  2YHO A;  4WZ0 A;  1WEQ A;  5J3X A;  3M63 A;  4YAD A;  4TKP B;  2DSM A;  3HCT A;  2LXH C;  4GND A;  4QF3 A;  3SOU A;  1VD4 A;  2KWO A;  2CSY A;  2P57 A;  2UZG A;  4L58 A;  1WEE A;  4GNE A;  1JM7 A;  5B76 A;  2L5U A;  2DJA A;  2LV9 A;  3KV6 A;  5G04 B;  2KGI A;  5SVI B;  3M7K A;  3LQH A;  2VJE B;  2FFW A;  4A49 A;  5KH3 A;  2ZET C;  2VJE A;  3L1X A;  3N9N A;  5I3L A;  3DPL R;  2VPG A;  3O34 A;  2CRW A;  2L43 A;  4V3K C;  3U5P A;  2QIC A;  1Z6U A;  1N87 A;  2E6S A;  3L1Z B;  3RPG B;  4BBQ A;  3O37 A;  4S3O C;  5TAB A;  1WEN A;  1U6G B;  1WEO A;  1V87 A;  1MBM A;  5LKT A;  3N9M A;  5H1V A;  2G6Q A;  2M3H A;  4I7B A;  3ZNI A;  4YAT A;  5TRB A;  4GB0 A;  4MSX A;  1WEP A;  2DX8 A;  2KKX A;  3DQV R;  3HCU A;  2VPD A;  4S3O B;  2KGG A;  2YU4 A;  2ECG A;  4YBS A;  4C9Z A;  2CSZ A;  2QIZ A;  5K3Q A;  1G25 A;  2LXP C;  4OGC A;  2LGL A;  1LDK C;  4O64 A;  3PUR A;  5B78 A;  2KFT A;  3LRQ A;  4F52 B;  1RMD A;  3M99 A;  2LDR A;  2KRE A;  4H9D A;  3LVQ E;  2XB1 A;  3RPG C;  2KR4 A;  4N3W A;  2F42 A;  3GL6 A;  2YQL A;  2IDA A;  4CCG X;  1X4I A;  3V43 A;  4B7Y C;  2C2V S;  2MA6 A;  2FUI A;  5B8D A;  4WZ3 B;  2H0D A;  4R2Y A;  4IC3 A;  4AVX A;  1MM2 A;  4UI9 B;  3MHH A;  4OGE A;  4Q6F A;  4YAX A;  4P5O B;  3PUQ A;  4ZUX U;  2Y43 A;  1LDJ B;  3ZPV 1;  3O70 A;  3ASL A;  4I7C A;  3LJU X;  3H7H A;  2K16 A;  3KDE C;  4F1P A;  2VNF A;  4MVT A;  2JUN A;  2KWJ A;  2Y1N A;  4AYC A;  5FEY A;  4R7E A;  2VP7 A;  5LCW B;  2IQJ A;  4Z0R A;  3SHB A;  2RSD A;  4FJC A;  3N9L A;  5B77 A;  5LKZ A;  2JMD A;  3SOX A;  2L80 A;  1WGM A;  2PNX A;  3LQI A;  2CON A;  5C13 A;  2MIQ A;  3FL2 A;  1VYX A;  3EB5 A;  1X4U A;  5FB1 A;  3PLW A;  2FD4 A;  1FP0 A;  1T1H A;  3KNV A;  2JM3 A;  2M6M A;  5LKU A;  2KIZ A;  3O33 A;  4AUQ B;  2VPB A;  1WEU A;  2MKE A;  2CKL B;  1F62 A;  3O36 A;  2ECV A;  2XOY A;  2LN0 A;  1JM7 B;  2KWK A;  5SVI A;  3ZTG A;  3SUB A;  2JMJ A;  2OXQ C;  2I50 A;  3U5M A;  2K4D A;  5D1L B;  2AN6 A;  1WEV A;  3T7L A;  1VFY A;  2KKY A;  5KH7 A;  2YHN A;  4LJN A;  2YUC A;  5SVY A;  4ZQL A;  2NAA A;  1FBV A;  4X3G A;  3MHS A;  1Z2Q A;  5C11 A;  4IC2 A;  2YRE A;  3I2D A;  4Z0O A;  3FEH A;  1HYJ A;  4B86 C;  5AIU A;  4LLB A;  5FER A;  4V3L C;  5D1K B;  2BAY A;  2PUY A;  2MNZ A;  2MT5 A;  4YAB A;  5H1T A;  4FO9 A;  4UP5 A;  4LKA A;  3N9P A;  4GNG A;  3FM8 C;  3T6R A;  2YUR A;  2VJF A;  2OWA A;  3O35 A;  3ZPV E;  2EXU A;  2QJ0 A;  4A0C D;  1IYM A;  3MDB C;  1WFK A;  2YSM A;  3GV4 A;  4LK9 A;  3KQI A;  2KWN A;  5KH9 A;  1XWH A;  4PPE A;  2LGV A;  3ZYQ A;  2KYU A;  4CA1 A;  4XI1 A;  2CSV A;  4WA6 A;  3HCS A;  3LQJ A;  3PHD A;  5G05 B;  2YT5 A;  1DCQ A;  2K1J A;  2FUU A;  4N4F A;  4O62 A;  5B75 A;  2KE1 A;  2JMI A;  2YVR A;  4L7X A;  1WIM A;  4QQ4 A;  2XP0 A;  3KV5 A;  2M13 A;  5TBN A;  2MD8 C;  3L11 A;  4NN2 A;  2F6J A;  2L7P A;  4BHW A;  5H1U A;  3NG2 A;  2VJF B;  3U5N A;  2ECT A;  4QF2 A;  5DKA A;  4LAD B;  1WES A;  2G45 A;  2MD7 B;  5EYA F;  2EGP A;  3M62 A;  1Z60 A;  2MA5 A;  2K17 A;  3RTR B;  2F6N A;  2XOZ A;  5LKX A;  2YW8 A;  2B0O E;  3C5K A; 
#chains in the Genus database with same CATH homology
 2MUM A;  3QZV A;  1CHC A;  3C6W A;  4AYC B;  3IHP A;  4A4C A;  2FSA A;  3EB6 A;  1X4J A;  3N9O A;  1WEW A;  2YSJ A;  2Y1M A;  5TDW A;  2C2L A;  1MM3 A;  3O7A A;  4UP0 A;  2EOD A;  1E4U A;  2ECI A;  2M1R A;  2XEU A;  5AIT A;  3VK6 A;  4PTB A;  2ECJ A;  2KU3 A;  2L0B A;  2CKL A;  1JOC A;  4R8P K;  5TDR A;  1WE9 A;  2ECW A;  4YBT A;  1K2F A;  1HYI A;  2M85 A;  4W4U A;  4I7D A;  2RI7 A;  3SOW A;  2ECN A;  2HYE D;  4YBM A;  5FB0 A;  2LGK A;  1BOR A;  5B79 A;  2EA6 A;  2G43 A;  2CT2 A;  2LGG A;  5H9M A;  2JRJ A;  1WEM A;  5JG6 A;  3ZVY A;  1WIL A;  4FIP A;  4YC9 A;  2L75 A;  2E6R A;  5DIN A;  2YQM A;  1DVP A;  2D8S A;  2LQ6 A;  4ZDT A;  3N9Q A;  5D1M B;  4WZ2 A;  4A4B A;  4FK5 A;  2YYR A;  3U5O A;  2VPE A;  3ZVZ B;  2LRI C;  4AP4 A;  1ZBD B;  4GNF A;  2HDP A;  2MNY A;  2H0D B;  3HTK C;  5G0F A;  2YHO A;  4WZ0 A;  1WEQ A;  5J3X A;  3M63 A;  4YAD A;  4TKP B;  3HCT A;  2LXH C;  4GND A;  4QF3 A;  3SOU A;  1VD4 A;  2KWO A;  2CSY A;  2UZG A;  4L58 A;  1WEE A;  4GNE A;  1JM7 A;  5B76 A;  2L5U A;  3KV6 A;  2LV9 A;  5G04 B;  2KGI A;  3LQH A;  2VJE B;  4A49 A;  5KH3 A;  2ZET C;  2VJE A;  3L1X A;  3N9N A;  5I3L A;  3DPL R;  2VPG A;  3O34 A;  2L43 A;  4V3K C;  3U5P A;  2QIC A;  1Z6U A;  1N87 A;  2E6S A;  3L1Z B;  3RPG B;  4BBQ A;  3O37 A;  4S3O C;  5TAB A;  1WEN A;  1U6G B;  1WEO A;  1V87 A;  5LKT A;  3N9M A;  5H1V A;  2G6Q A;  2M3H A;  4I7B A;  3ZNI A;  4YAT A;  5TRB A;  4GB0 A;  4MSX A;  1WEP A;  2DX8 A;  3DQV R;  3HCU A;  2VPD A;  4S3O B;  2KGG A;  2YU4 A;  2ECG A;  4YBS A;  4C9Z A;  2CSZ A;  2QIZ A;  1G25 A;  2LXP C;  2LGL A;  1LDK C;  4O64 A;  3PUR A;  5B78 A;  2KFT A;  3LRQ A;  4F52 B;  1RMD A;  3M99 A;  2LDR A;  2KRE A;  2XB1 A;  3RPG C;  2KR4 A;  4N3W A;  2F42 A;  3GL6 A;  2YQL A;  2IDA A;  4CCG X;  1X4I A;  3V43 A;  4B7Y C;  2C2V S;  2MA6 A;  2FUI A;  5B8D A;  4WZ3 B;  2H0D A;  4R2Y A;  4IC3 A;  4AVX A;  1MM2 A;  4UI9 B;  3MHH A;  4Q6F A;  4YAX A;  4P5O B;  3PUQ A;  4ZUX U;  2Y43 A;  1LDJ B;  3ZPV 1;  3O70 A;  3ASL A;  4I7C A;  2K16 A;  2VNF A;  4MVT A;  2KWJ A;  2Y1N A;  4AYC A;  5FEY A;  4R7E A;  2VP7 A;  5LCW B;  3SHB A;  2RSD A;  4FJC A;  3N9L A;  5B77 A;  5LKZ A;  2JMD A;  3SOX A;  2L80 A;  1WGM A;  2PNX A;  3LQI A;  5C13 A;  2MIQ A;  3FL2 A;  1VYX A;  3EB5 A;  1X4U A;  5FB1 A;  1FP0 A;  1T1H A;  3KNV A;  2M6M A;  5LKU A;  2KIZ A;  3O33 A;  4AUQ B;  2VPB A;  1WEU A;  2CKL B;  1F62 A;  3O36 A;  2ECV A;  2LN0 A;  1JM7 B;  2KWK A;  3ZTG A;  3U5M A;  2JMJ A;  2OXQ C;  2I50 A;  2K4D A;  5D1L B;  2AN6 A;  1WEV A;  3T7L A;  1VFY A;  5KH7 A;  2YHN A;  4LJN A;  2YUC A;  4ZQL A;  2NAA A;  1FBV A;  4X3G A;  3MHS A;  1Z2Q A;  5C11 A;  4IC2 A;  2YRE A;  3I2D A;  1HYJ A;  4B86 C;  5AIU A;  4LLB A;  5FER A;  4V3L C;  5D1K B;  2BAY A;  2PUY A;  2MNZ A;  2MT5 A;  4YAB A;  5H1T A;  4FO9 A;  4UP5 A;  4LKA A;  3N9P A;  4GNG A;  3T6R A;  2YUR A;  2VJF A;  3O35 A;  3ZPV E;  2QJ0 A;  4A0C D;  1IYM A;  1WFK A;  2YSM A;  3GV4 A;  4LK9 A;  3KQI A;  2KWN A;  5KH9 A;  1XWH A;  4PPE A;  2LGV A;  3ZYQ A;  2KYU A;  4CA1 A;  4XI1 A;  4WA6 A;  3HCS A;  3LQJ A;  3PHD A;  5G05 B;  2YT5 A;  2K1J A;  2FUU A;  4N4F A;  5B75 A;  2KE1 A;  2JMI A;  4L7X A;  1WIM A;  3KV5 A;  5TBN A;  2MD8 C;  3L11 A;  4NN2 A;  2F6J A;  4BHW A;  5H1U A;  3NG2 A;  2VJF B;  3U5N A;  2ECT A;  4QF2 A;  5DKA A;  4LAD B;  1WES A;  2G45 A;  2MD7 B;  5EYA F;  2EGP A;  3M62 A;  1Z60 A;  2MA5 A;  2K17 A;  3RTR B;  2F6N A;  5LKX A;  2YW8 A;  3C5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...