3T6RA

Structure of uhrf1 in complex with unmodified h3 n-terminal tail
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
APEFGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title UHRF1 double tudor domain and the adjacent PHD finger act together to recognize K9me3-containing histone H3 tail
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3t6rA00
3C6WA 3SHBA 2MNYA 2ECWA 2L5UA 3LQIA 5KH3A 3O7AA 4A49A 5LKUA 2VJEB 2L0BA 3C5KA 5B8DA 3U5MA 3L1ZB 4L7XA 3LQHA 4YBSA 2Y1MA 3VK6A 4CCGX 2NAAA 3ZVYA 4IC2A 3LRQA 1CHCA 2MA5A 1HYJA 2LGKA 5J3XA 4P5OB 1LDKC 1WEEA 2KIZA 2VPEA 1WEVA 2K17A 5B79A 4AP4A 4GNGA 3ZYQA 3O33A 5FEYA 2G6QA 3T7LA 4FK5A 4O64A 1JM7A 4F52B 2JMIA 2QICA 2ECJA 1Z60A 3M99A 1MM2A 4S3OB 3N9OA 5TABA 2F6NA 2L80A 2ECTA 1HYIA 1X4UA 2MUMA 1K2FA 1V87A 4B86C 2YURA 4GNDA 2YU4A 1BORA 5B78A 2YYRA 4R7EA 5H1UA 2M1RA 4YABA 1FP0A 1X4JA 2VPDA 5LCWB 3N9LA 1VD4A 4LLBA 3ZPV1 1JOCA 1WEWA 2JRJA 4ZDTA 3SOWA 2RSDA 4ZQLA 2VPGA 5C11A 2KGGA 5D1MB 2YW8A 5KH9A 2YQLA 1JM7B 2YT5A 2LXPC 4LJNA 5DINA 2EA6A 2KWKA 3KV6A 2E6RA 2VP7A 5FERA 4WA6A 4NN2A 2I50A 4R8PK 2Y43A 1WGMA 5G0FA 4BHWA 2YHOA 5JG6A 5LKZA 2LDRA 2Y1NA 4GNEA 4S3OC 2MNZA 2KFTA 3I2DA 3RTRB 3PHDA 5TDRA 2E6SA 4QF2A 3SOXA 2H0DA 3ZTGA 3EB6A 4AYCA 4UP0A 2OXQC 2PUYA 5AIUA 1WESA 1WILA 2VJFA 2CSZA 1WIMA 2QIZA 4Q6FA 2XEUA 3N9QA 2UZGA 3RPGB 4MSXA 3V43A 2ECIA 2G43A 3GL6A 4L58A 1XWHA 4FJCA 4FO9A 1DVPA 2K16A 4YADA 2CKLA 3N9PA 5B76A 2CT2A 2ECGA 2YHNA 2KWOA 2BAYA 5D1LB 2K4DA 2L75A 1N87A 1Z6UA 2M3HA 5H9MA 2KWNA 4MVTA 2JMJA 5FB0A 5EYAF 4YBMA 4C9ZA 4AVXA 3LQJA 4IC3A 5TRBA 2LGLA 2FUIA 2KWJA 1WENA 1WFKA 4LK9A 4GNFA 2VJFB 1WEPA 3NG2A 2LRIC 2MD8C 5LKTA 2VJEA 4AUQB 2LXHC 5LKXA 2LQ6A 2FUUA 1WEQA 4W4UA 3HCUA 1X4IA 4R2YA 3O36A 2M85A 3N9NA 2ZETC 1WE9A 4X3GA 3KQIA 3O70A 2CKLB 1WEUA 4I7CA 2KE1A 3IHPA 4PTBA 4BBQA 4ZUXU 1VFYA 5H1VA 2YREA 2MD7B 2FSAA 3RPGC 4XI1A 4YBTA 3O34A 5B77A 2C2LA 2AN6A 4A4CA 3PURA 3ZVZB 2F42A 3L1XA 4YC9A 2L43A 4WZ0A 2YSJA 3KNVA 5TDWA 2KR4A 5KH7A 2YSMA 4YATA 2QJ0A 2JMDA 4PPEA 4FIPA 3M62A 5FB1A 2KREA 4LADB 3MHHA 4V3LC 1Z2QA 2CSYA 2PNXA 3N9MA 1G25A 1WEMA 3M63A 4TKPB 3ASLA 3U5NA 3MHSA 3U5OA 2LN0A 4WZ2A 4I7BA 1T1HA 4B7YC 4N3WA 4QF3A 2HDPA 4UP5A 3HCTA 3L11A 1RMDA 2KYUA 1LDJB 2EODA 3O37A 5G04B 3FL2A 1IYMA 4YAXA 2KGIA 4I7DA 2IDAA 2KU3A 4WZ3B 5B75A 2MT5A 5I3LA 5H1TA 5D1KB 2MA6A 4N4FA 5C13A 2H0DB 4AYCB 3KV5A 3HCSA 1U6GB 1WEOA 2LGVA 2ECNA 3DPLR 3SOUA 2ECVA 2C2VS 4V3KC 2LGGA 2YUCA 1MM3A 2DX8A 3QZVA 4A4BA 2K1JA 2HYED 1E4UA 4A0CD 1F62A 2LV9A 2RI7A 5DKAA 3ZNIA 3ZPVE 4GB0A 4UI9B 2XB1A 2YQMA 2MIQA 4LKAA 2F6JA 3GV4A 2D8SA 3PUQA 1ZBDB 2EGPA 3DQVR 3O35A 3T6RA 3EB5A 2VPBA 5AITA 2VNFA 4CA1A 5G05B 2G45A 2M6MA 3U5PA 3HTKC 5TBNA 1VYXA 1FBVA
chains in the Genus database with same CATH superfamily
3C6WA 3SHBA 2MNYA 2ECWA 2L5UA 3LQIA 5KH3A 3O7AA 3Q1DA 4A49A 5LKUA 2VJEB 3E2DA 2L0BA 3C5KA 2OWAA 5B8DA 3FEHA 3FAOA 3U5MA 3L1ZB 2KKXA 4L7XA 3LQHA 4YBSA 2Y1MA 3VK6A 2P57A 4CCGX 2NAAA 3ZVYA 4IC2A 3LRQA 1CHCA 3SUBA 2MA5A 1HYJA 2LGKA 5J3XA 4P5OB 1LDKC 5SVYA 1WEEA 2KIZA 2VPEA 1WEVA 2K17A 5B79A 2KKYA 2CSVA 4GNGA 4AP4A 3ZYQA 3O33A 5FEYA 2G6QA 3T7LA 4FK5A 4F1PA 4O64A 1JM7A 4F52B 2JMIA 2QICA 2ECJA 1Z60A 3M99A 4H9DA 1MM2A 4S3OB 2LAUA 3N9OA 5TABA 2F6NA 2L80A 2ECTA 1HYIA 1X4UA 2MUMA 1K2FA 1V87A 4B86C 2YURA 4GNDA 2YU4A 1BORA 5B78A 4Z0RA 2YYRA 4R7EA 5H1UA 2M1RA 4YABA 1FP0A 1X4JA 2VPDA 5LCWB 3JUEA 3N9LA 1VD4A 3LJUX 4LLBA 3ZPV1 1JOCA 1WEWA 2JRJA 4ZDTA 3SOWA 2RSDA 4ZQLA 2YVRA 2B0OE 2VPGA 5C11A 2KGGA 5D1MB 2FD4A 2YW8A 5KH9A 2DJAA 2YQLA 1JM7B 2YT5A 2LXPC 4LJNA 5DINA 5K3QA 2EA6A 2KWKA 3KV6A 2E6RA 2JUNA 2VP7A 5FERA 4WA6A 2M13A 3DWDA 4NN2A 2I50A 4R8PK 2Y43A 1WGMA 5G0FA 4BHWA 2YHOA 5JG6A 2XP0A 5LKZA 1DCQA 2LDRA 2Y1NA 4GNEA 4S3OC 2MNZA 2KFTA 3I2DA 3RTRB 3PHDA 5TDRA 2E6SA 4QF2A 3SOXA 2H0DA 3ZTGA 3EB6A 4AYCA 4UP0A 2OXQC 3KDEC 2PUYA 5AIUA 1WESA 1WILA 2VJFA 2CSZA 1WIMA 2QIZA 4Q6FA 2XOYA 2XEUA 3N9QA 2XOCA 2UZGA 3RPGB 4MSXA 3V43A 1MBMA 2ECIA 2G43A 3GL6A 4L58A 1XWHA 4FJCA 4FO9A 1DVPA 2K16A 4YADA 2CKLA 3N9PA 3PLWA 5B76A 2CT2A 2ECGA 2YHNA 2KWOA 2BAYA 5D1LB 2K4DA 2L75A 1N87A 1Z6UA 2XOZA 2M3HA 5SVXA 5H9MA 2KWNA 2JM3A 4MVTA 2JMJA 5FB0A 4OGEA 5EYAF 4YBMA 4C9ZA 4AVXA 3LQJA 4IC3A 5TRBA 3FJUB 2LGLA 3LDYA 2FUIA 2KWJA 1WENA 1WFKA 4LK9A 3FM8C 4GNFA 2VJFB 1WEPA 3NG2A 2LRIC 2MD8C 2D8UA 5LKTA 2VJEA 4AUQB 2LXHC 5LKXA 2LQ6A 2FUUA 1WEQA 4W4UA 3T9KA 3HCUA 1X4IA 4R2YA 3O36A 2M85A 3N9NA 2ZETC 1WE9A 4X3GA 3KQIA 3O70A 2CKLB 1WEUA 4I7CA 2KE1A 3IHPA 4PTBA 4BBQA 4ZUXU 4OGCA 1VFYA 5H1VA 2YREA 2MD7B 2EXUA 2FSAA 3RPGC 4XI1A 4YBTA 3O34A 5B77A 2C2LA 2AN6A 4A4CA 3PURA 3ZVZB 2F42A 2E61A 3L1XA 4YC9A 2L43A 4WZ0A 2YSJA 3KNVA 5TDWA 2KR4A 5KH7A 2YSMA 4YATA 2QJ0A 2JMDA 4PPEA 4FIPA 2DSMA 3M62A 5FB1A 2KREA 4LADB 3MHHA 2L7PA 4V3LC 1Z2QA 2CSYA 3FANA 3M7KA 2PNXA 3N9MA 5SVIA 1G25A 2RR4A 1WEMA 3MDBC 3M63A 4TKPB 3ASLA 3U5NA 4Z0OA 3MHSA 3U5OA 2LN0A 4WZ2A 4I7BA 1T1HA 4B7YC 4N3WA 2CRWA 4QF3A 2HDPA 4UP5A 3HCTA 3L11A 1RMDA 2KYUA 4QQ4A 1LDJB 2EODA 3O37A 5G04B 3FL2A 1IYMA 2CONA 4YAXA 2KGIA 4I7DA 3LVQE 2IDAA 3DDTA 2KU3A 2CRRA 4WZ3B 5B75A 2MT5A 4O62A 5I3LA 5H1TA 5D1KB 2MA6A 4N4FA 5C13A 2H0DB 4AYCB 3KV5A 3H7HA 3HCSA 2EGMA 1U6GB 1WEOA 2LGVA 2ECNA 3DPLR 3SOUA 2ECVA 3LVRE 2C2VS 4V3KC 2LGGA 5SVIB 2YUCA 1MM3A 2DX8A 3QZVA 4A4BA 2K1JA 2HYED 3O47A 1E4UA 4A0CD 1F62A 2LV9A 2RI7A 5DKAA 3ZNIA 3ZPVE 4GB0A 4UI9B 2XB1A 2FFWA 2YQMA 2MIQA 4LKAA 2F6JA 3GV4A 2D8SA 3PUQA 1ZBDB 2EGPA 2IQJA 3DQVR 3O35A 3T6RA 3EB5A 2VPBA 5AITA 2VNFA 4CA1A 5G05B 2G45A 2MKEA 2M6MA 3U5PA 3HTKC 5TBNA 1VYXA 1FBVA
chains in the Genus database with same CATH topology
3C6WA 3SHBA 2MNYA 2ECWA 2L5UA 3LQIA 5KH3A 3O7AA 4A49A 5LKUA 2VJEB 2L0BA 3C5KA 5B8DA 3U5MA 3L1ZB 4L7XA 3LQHA 4YBSA 2Y1MA 3VK6A 4CCGX 2NAAA 3ZVYA 4IC2A 3LRQA 1CHCA 2MA5A 1HYJA 2LGKA 5J3XA 4P5OB 1LDKC 1WEEA 2KIZA 2VPEA 1WEVA 2K17A 5B79A 4AP4A 4GNGA 3ZYQA 3O33A 5FEYA 2G6QA 3T7LA 4FK5A 4O64A 1JM7A 4F52B 2JMIA 2QICA 2ECJA 1Z60A 3M99A 1MM2A 4S3OB 3N9OA 5TABA 2F6NA 2L80A 2ECTA 1HYIA 1X4UA 2MUMA 1K2FA 1V87A 4B86C 2YURA 4GNDA 2YU4A 1BORA 5B78A 2YYRA 4R7EA 5H1UA 2M1RA 4YABA 1FP0A 1X4JA 2VPDA 5LCWB 3N9LA 1VD4A 4LLBA 3ZPV1 1JOCA 1WEWA 2JRJA 4ZDTA 3SOWA 2RSDA 4ZQLA 2VPGA 5C11A 2KGGA 5D1MB 2YW8A 5KH9A 2YQLA 1JM7B 2YT5A 2LXPC 4LJNA 5DINA 2EA6A 2KWKA 3KV6A 2E6RA 2VP7A 5FERA 4WA6A 4NN2A 2I50A 4R8PK 2Y43A 1WGMA 5G0FA 4BHWA 2YHOA 5JG6A 5LKZA 2LDRA 2Y1NA 4GNEA 4S3OC 2MNZA 2KFTA 3I2DA 3RTRB 3PHDA 5TDRA 2E6SA 4QF2A 3SOXA 2H0DA 3ZTGA 3EB6A 4AYCA 4UP0A 2OXQC 2PUYA 5AIUA 1WESA 1WILA 2VJFA 2CSZA 1WIMA 2QIZA 4Q6FA 2XEUA 3N9QA 2UZGA 3RPGB 4MSXA 3V43A 2ECIA 2G43A 3GL6A 4L58A 1XWHA 4FJCA 4FO9A 1DVPA 2K16A 4YADA 2CKLA 3N9PA 5B76A 2CT2A 2ECGA 2YHNA 2KWOA 2BAYA 5D1LB 2K4DA 2L75A 1N87A 1Z6UA 2M3HA 5H9MA 2KWNA 4MVTA 2JMJA 5FB0A 5EYAF 4YBMA 4C9ZA 4AVXA 3LQJA 4IC3A 5TRBA 2LGLA 2FUIA 2KWJA 1WENA 1WFKA 4LK9A 4GNFA 2VJFB 1WEPA 3NG2A 2LRIC 2MD8C 5LKTA 2VJEA 4AUQB 2LXHC 5LKXA 2LQ6A 2FUUA 1WEQA 4W4UA 3HCUA 1X4IA 4R2YA 3O36A 2M85A 3N9NA 2ZETC 1WE9A 4X3GA 3KQIA 3O70A 2CKLB 1WEUA 4I7CA 2KE1A 3IHPA 4PTBA 4BBQA 4ZUXU 1VFYA 5H1VA 2YREA 2MD7B 2FSAA 3RPGC 4XI1A 4YBTA 3O34A 5B77A 2C2LA 2AN6A 4A4CA 3PURA 3ZVZB 2F42A 3L1XA 4YC9A 2L43A 4WZ0A 2YSJA 3KNVA 5TDWA 2KR4A 5KH7A 2YSMA 4YATA 2QJ0A 2JMDA 4PPEA 4FIPA 3M62A 5FB1A 2KREA 4LADB 3MHHA 4V3LC 1Z2QA 2CSYA 2PNXA 3N9MA 1G25A 1WEMA 3M63A 4TKPB 3ASLA 3U5NA 3MHSA 3U5OA 2LN0A 4WZ2A 4I7BA 1T1HA 4B7YC 4N3WA 4QF3A 2HDPA 4UP5A 3HCTA 3L11A 1RMDA 2KYUA 1LDJB 2EODA 3O37A 5G04B 3FL2A 1IYMA 4YAXA 2KGIA 4I7DA 2IDAA 2KU3A 4WZ3B 5B75A 2MT5A 5I3LA 5H1TA 5D1KB 2MA6A 4N4FA 5C13A 2H0DB 4AYCB 3KV5A 3HCSA 1U6GB 1WEOA 2LGVA 2ECNA 3DPLR 3SOUA 2ECVA 2C2VS 4V3KC 2LGGA 2YUCA 1MM3A 2DX8A 3QZVA 4A4BA 2K1JA 2HYED 1E4UA 4A0CD 1F62A 2LV9A 2RI7A 5DKAA 3ZNIA 3ZPVE 4GB0A 4UI9B 2XB1A 2YQMA 2MIQA 4LKAA 2F6JA 3GV4A 2D8SA 3PUQA 1ZBDB 2EGPA 3DQVR 3O35A 3T6RA 3EB5A 2VPBA 5AITA 2VNFA 4CA1A 5G05B 2G45A 2M6MA 3U5PA 3HTKC 5TBNA 1VYXA 1FBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C6W A;  3SHB A;  2MNY A;  2ECW A;  2L5U A;  3LQI A;  5KH3 A;  3O7A A;  4A49 A;  5LKU A;  2VJE B;  2L0B A;  3C5K A;  5B8D A;  3U5M A;  3L1Z B;  4L7X A;  3LQH A;  4YBS A;  2Y1M A;  3VK6 A;  4CCG X;  2NAA A;  3ZVY A;  4IC2 A;  3LRQ A;  1CHC A;  2MA5 A;  1HYJ A;  2LGK A;  5J3X A;  4P5O B;  1LDK C;  1WEE A;  2KIZ A;  2VPE A;  1WEV A;  2K17 A;  5B79 A;  4AP4 A;  4GNG A;  3ZYQ A;  3O33 A;  5FEY A;  2G6Q A;  3T7L A;  4FK5 A;  4O64 A;  1JM7 A;  4F52 B;  2JMI A;  2QIC A;  2ECJ A;  1Z60 A;  3M99 A;  1MM2 A;  4S3O B;  3N9O A;  5TAB A;  2F6N A;  2L80 A;  2ECT A;  1HYI A;  1X4U A;  2MUM A;  1K2F A;  1V87 A;  4B86 C;  2YUR A;  4GND A;  2YU4 A;  1BOR A;  5B78 A;  2YYR A;  4R7E A;  5H1U A;  2M1R A;  4YAB A;  1FP0 A;  1X4J A;  2VPD A;  5LCW B;  3N9L A;  1VD4 A;  4LLB A;  3ZPV 1;  1JOC A;  1WEW A;  2JRJ A;  4ZDT A;  3SOW A;  2RSD A;  4ZQL A;  2VPG A;  5C11 A;  2KGG A;  5D1M B;  2YW8 A;  5KH9 A;  2YQL A;  1JM7 B;  2YT5 A;  2LXP C;  4LJN A;  5DIN A;  2EA6 A;  2KWK A;  3KV6 A;  2E6R A;  2VP7 A;  5FER A;  4WA6 A;  4NN2 A;  2I50 A;  4R8P K;  2Y43 A;  1WGM A;  5G0F A;  4BHW A;  2YHO A;  5JG6 A;  5LKZ A;  2LDR A;  2Y1N A;  4GNE A;  4S3O C;  2MNZ A;  2KFT A;  3I2D A;  3RTR B;  3PHD A;  5TDR A;  2E6S A;  4QF2 A;  3SOX A;  2H0D A;  3ZTG A;  3EB6 A;  4AYC A;  4UP0 A;  2OXQ C;  2PUY A;  5AIU A;  1WES A;  1WIL A;  2VJF A;  2CSZ A;  1WIM A;  2QIZ A;  4Q6F A;  2XEU A;  3N9Q A;  2UZG A;  3RPG B;  4MSX A;  3V43 A;  2ECI A;  2G43 A;  3GL6 A;  4L58 A;  1XWH A;  4FJC A;  4FO9 A;  1DVP A;  2K16 A;  4YAD A;  2CKL A;  3N9P A;  5B76 A;  2CT2 A;  2ECG A;  2YHN A;  2KWO A;  2BAY A;  5D1L B;  2K4D A;  2L75 A;  1N87 A;  1Z6U A;  2M3H A;  5H9M A;  2KWN A;  4MVT A;  2JMJ A;  5FB0 A;  5EYA F;  4YBM A;  4C9Z A;  4AVX A;  3LQJ A;  4IC3 A;  5TRB A;  2LGL A;  2FUI A;  2KWJ A;  1WEN A;  1WFK A;  4LK9 A;  4GNF A;  2VJF B;  1WEP A;  3NG2 A;  2LRI C;  2MD8 C;  5LKT A;  2VJE A;  4AUQ B;  2LXH C;  5LKX A;  2LQ6 A;  2FUU A;  1WEQ A;  4W4U A;  3HCU A;  1X4I A;  4R2Y A;  3O36 A;  2M85 A;  3N9N A;  2ZET C;  1WE9 A;  4X3G A;  3KQI A;  3O70 A;  2CKL B;  1WEU A;  4I7C A;  2KE1 A;  3IHP A;  4PTB A;  4BBQ A;  4ZUX U;  1VFY A;  5H1V A;  2YRE A;  2MD7 B;  2FSA A;  3RPG C;  4XI1 A;  4YBT A;  3O34 A;  5B77 A;  2C2L A;  2AN6 A;  4A4C A;  3PUR A;  3ZVZ B;  2F42 A;  3L1X A;  4YC9 A;  2L43 A;  4WZ0 A;  2YSJ A;  3KNV A;  5TDW A;  2KR4 A;  5KH7 A;  2YSM A;  4YAT A;  2QJ0 A;  2JMD A;  4PPE A;  4FIP A;  3M62 A;  5FB1 A;  2KRE A;  4LAD B;  3MHH A;  4V3L C;  1Z2Q A;  2CSY A;  2PNX A;  3N9M A;  1G25 A;  1WEM A;  3M63 A;  4TKP B;  3ASL A;  3U5N A;  3MHS A;  3U5O A;  2LN0 A;  4WZ2 A;  4I7B A;  1T1H A;  4B7Y C;  4N3W A;  4QF3 A;  2HDP A;  4UP5 A;  3HCT A;  3L11 A;  1RMD A;  2KYU A;  1LDJ B;  2EOD A;  3O37 A;  5G04 B;  3FL2 A;  1IYM A;  4YAX A;  2KGI A;  4I7D A;  2IDA A;  2KU3 A;  4WZ3 B;  5B75 A;  2MT5 A;  5I3L A;  5H1T A;  5D1K B;  2MA6 A;  4N4F A;  5C13 A;  2H0D B;  4AYC B;  3KV5 A;  3HCS A;  1U6G B;  1WEO A;  2LGV A;  2ECN A;  3DPL R;  3SOU A;  2ECV A;  2C2V S;  4V3K C;  2LGG A;  2YUC A;  1MM3 A;  2DX8 A;  3QZV A;  4A4B A;  2K1J A;  2HYE D;  1E4U A;  4A0C D;  1F62 A;  2LV9 A;  2RI7 A;  5DKA A;  3ZNI A;  3ZPV E;  4GB0 A;  4UI9 B;  2XB1 A;  2YQM A;  2MIQ A;  4LKA A;  2F6J A;  3GV4 A;  2D8S A;  3PUQ A;  1ZBD B;  2EGP A;  3DQV R;  3O35 A;  3T6R A;  3EB5 A;  2VPB A;  5AIT A;  2VNF A;  4CA1 A;  5G05 B;  2G45 A;  2M6M A;  3U5P A;  3HTK C;  5TBN A;  1VYX A;  1FBV A; 
#chains in the Genus database with same CATH topology
 3C6W A;  3SHB A;  2MNY A;  2ECW A;  2L5U A;  3LQI A;  5KH3 A;  3O7A A;  3Q1D A;  4A49 A;  5LKU A;  2VJE B;  3E2D A;  2L0B A;  3C5K A;  2OWA A;  5B8D A;  3FEH A;  3FAO A;  3U5M A;  3L1Z B;  2KKX A;  4L7X A;  3LQH A;  4YBS A;  2Y1M A;  3VK6 A;  2P57 A;  4CCG X;  2NAA A;  3ZVY A;  4IC2 A;  3LRQ A;  1CHC A;  3SUB A;  2MA5 A;  1HYJ A;  2LGK A;  5J3X A;  4P5O B;  1LDK C;  5SVY A;  1WEE A;  2KIZ A;  2VPE A;  1WEV A;  2K17 A;  5B79 A;  2KKY A;  2CSV A;  4GNG A;  4AP4 A;  3ZYQ A;  3O33 A;  5FEY A;  2G6Q A;  3T7L A;  4FK5 A;  4F1P A;  4O64 A;  1JM7 A;  4F52 B;  2JMI A;  2QIC A;  2ECJ A;  1Z60 A;  3M99 A;  4H9D A;  1MM2 A;  4S3O B;  2LAU A;  3N9O A;  5TAB A;  2F6N A;  2L80 A;  2ECT A;  1HYI A;  1X4U A;  2MUM A;  1K2F A;  1V87 A;  4B86 C;  2YUR A;  4GND A;  2YU4 A;  1BOR A;  5B78 A;  4Z0R A;  2YYR A;  4R7E A;  5H1U A;  2M1R A;  4YAB A;  1FP0 A;  1X4J A;  2VPD A;  5LCW B;  3JUE A;  3N9L A;  1VD4 A;  3LJU X;  4LLB A;  3ZPV 1;  1JOC A;  1WEW A;  2JRJ A;  4ZDT A;  3SOW A;  2RSD A;  4ZQL A;  2YVR A;  2B0O E;  2VPG A;  5C11 A;  2KGG A;  5D1M B;  2FD4 A;  2YW8 A;  5KH9 A;  2DJA A;  2YQL A;  1JM7 B;  2YT5 A;  2LXP C;  4LJN A;  5DIN A;  5K3Q A;  2EA6 A;  2KWK A;  3KV6 A;  2E6R A;  2JUN A;  2VP7 A;  5FER A;  4WA6 A;  2M13 A;  3DWD A;  4NN2 A;  2I50 A;  4R8P K;  2Y43 A;  1WGM A;  5G0F A;  4BHW A;  2YHO A;  5JG6 A;  2XP0 A;  5LKZ A;  1DCQ A;  2LDR A;  2Y1N A;  4GNE A;  4S3O C;  2MNZ A;  2KFT A;  3I2D A;  3RTR B;  3PHD A;  5TDR A;  2E6S A;  4QF2 A;  3SOX A;  2H0D A;  3ZTG A;  3EB6 A;  4AYC A;  4UP0 A;  2OXQ C;  3KDE C;  2PUY A;  5AIU A;  1WES A;  1WIL A;  2VJF A;  2CSZ A;  1WIM A;  2QIZ A;  4Q6F A;  2XOY A;  2XEU A;  3N9Q A;  2XOC A;  2UZG A;  3RPG B;  4MSX A;  3V43 A;  1MBM A;  2ECI A;  2G43 A;  3GL6 A;  4L58 A;  1XWH A;  4FJC A;  4FO9 A;  1DVP A;  2K16 A;  4YAD A;  2CKL A;  3N9P A;  3PLW A;  5B76 A;  2CT2 A;  2ECG A;  2YHN A;  2KWO A;  2BAY A;  5D1L B;  2K4D A;  2L75 A;  1N87 A;  1Z6U A;  2XOZ A;  2M3H A;  5SVX A;  5H9M A;  2KWN A;  2JM3 A;  4MVT A;  2JMJ A;  5FB0 A;  4OGE A;  5EYA F;  4YBM A;  4C9Z A;  4AVX A;  3LQJ A;  4IC3 A;  5TRB A;  3FJU B;  2LGL A;  3LDY A;  2FUI A;  2KWJ A;  1WEN A;  1WFK A;  4LK9 A;  3FM8 C;  4GNF A;  2VJF B;  1WEP A;  3NG2 A;  2LRI C;  2MD8 C;  2D8U A;  5LKT A;  2VJE A;  4AUQ B;  2LXH C;  5LKX A;  2LQ6 A;  2FUU A;  1WEQ A;  4W4U A;  3T9K A;  3HCU A;  1X4I A;  4R2Y A;  3O36 A;  2M85 A;  3N9N A;  2ZET C;  1WE9 A;  4X3G A;  3KQI A;  3O70 A;  2CKL B;  1WEU A;  4I7C A;  2KE1 A;  3IHP A;  4PTB A;  4BBQ A;  4ZUX U;  4OGC A;  1VFY A;  5H1V A;  2YRE A;  2MD7 B;  2EXU A;  2FSA A;  3RPG C;  4XI1 A;  4YBT A;  3O34 A;  5B77 A;  2C2L A;  2AN6 A;  4A4C A;  3PUR A;  3ZVZ B;  2F42 A;  2E61 A;  3L1X A;  4YC9 A;  2L43 A;  4WZ0 A;  2YSJ A;  3KNV A;  5TDW A;  2KR4 A;  5KH7 A;  2YSM A;  4YAT A;  2QJ0 A;  2JMD A;  4PPE A;  4FIP A;  2DSM A;  3M62 A;  5FB1 A;  2KRE A;  4LAD B;  3MHH A;  2L7P A;  4V3L C;  1Z2Q A;  2CSY A;  3FAN A;  3M7K A;  2PNX A;  3N9M A;  5SVI A;  1G25 A;  2RR4 A;  1WEM A;  3MDB C;  3M63 A;  4TKP B;  3ASL A;  3U5N A;  4Z0O A;  3MHS A;  3U5O A;  2LN0 A;  4WZ2 A;  4I7B A;  1T1H A;  4B7Y C;  4N3W A;  2CRW A;  4QF3 A;  2HDP A;  4UP5 A;  3HCT A;  3L11 A;  1RMD A;  2KYU A;  4QQ4 A;  1LDJ B;  2EOD A;  3O37 A;  5G04 B;  3FL2 A;  1IYM A;  2CON A;  4YAX A;  2KGI A;  4I7D A;  3LVQ E;  2IDA A;  3DDT A;  2KU3 A;  2CRR A;  4WZ3 B;  5B75 A;  2MT5 A;  4O62 A;  5I3L A;  5H1T A;  5D1K B;  2MA6 A;  4N4F A;  5C13 A;  2H0D B;  4AYC B;  3KV5 A;  3H7H A;  3HCS A;  2EGM A;  1U6G B;  1WEO A;  2LGV A;  2ECN A;  3DPL R;  3SOU A;  2ECV A;  3LVR E;  2C2V S;  4V3K C;  2LGG A;  5SVI B;  2YUC A;  1MM3 A;  2DX8 A;  3QZV A;  4A4B A;  2K1J A;  2HYE D;  3O47 A;  1E4U A;  4A0C D;  1F62 A;  2LV9 A;  2RI7 A;  5DKA A;  3ZNI A;  3ZPV E;  4GB0 A;  4UI9 B;  2XB1 A;  2FFW A;  2YQM A;  2MIQ A;  4LKA A;  2F6J A;  3GV4 A;  2D8S A;  3PUQ A;  1ZBD B;  2EGP A;  2IQJ A;  3DQV R;  3O35 A;  3T6R A;  3EB5 A;  2VPB A;  5AIT A;  2VNF A;  4CA1 A;  5G05 B;  2G45 A;  2MKE A;  2M6M A;  3U5P A;  3HTK C;  5TBN A;  1VYX A;  1FBV A; 
#chains in the Genus database with same CATH homology
 3C6W A;  3SHB A;  2MNY A;  2ECW A;  2L5U A;  3LQI A;  5KH3 A;  3O7A A;  4A49 A;  5LKU A;  2VJE B;  2L0B A;  3C5K A;  5B8D A;  3U5M A;  3L1Z B;  4L7X A;  3LQH A;  4YBS A;  2Y1M A;  3VK6 A;  4CCG X;  2NAA A;  3ZVY A;  4IC2 A;  3LRQ A;  1CHC A;  2MA5 A;  1HYJ A;  2LGK A;  5J3X A;  4P5O B;  1LDK C;  1WEE A;  2KIZ A;  2VPE A;  1WEV A;  2K17 A;  5B79 A;  4AP4 A;  4GNG A;  3ZYQ A;  3O33 A;  5FEY A;  2G6Q A;  3T7L A;  4FK5 A;  4O64 A;  1JM7 A;  4F52 B;  2JMI A;  2QIC A;  2ECJ A;  1Z60 A;  3M99 A;  1MM2 A;  4S3O B;  3N9O A;  5TAB A;  2F6N A;  2L80 A;  2ECT A;  1HYI A;  1X4U A;  2MUM A;  1K2F A;  1V87 A;  4B86 C;  2YUR A;  4GND A;  2YU4 A;  1BOR A;  5B78 A;  2YYR A;  4R7E A;  5H1U A;  2M1R A;  4YAB A;  1FP0 A;  1X4J A;  2VPD A;  5LCW B;  3N9L A;  1VD4 A;  4LLB A;  3ZPV 1;  1JOC A;  1WEW A;  2JRJ A;  4ZDT A;  3SOW A;  2RSD A;  4ZQL A;  2VPG A;  5C11 A;  2KGG A;  5D1M B;  2YW8 A;  5KH9 A;  2YQL A;  1JM7 B;  2YT5 A;  2LXP C;  4LJN A;  5DIN A;  2EA6 A;  2KWK A;  3KV6 A;  2E6R A;  2VP7 A;  5FER A;  4WA6 A;  4NN2 A;  2I50 A;  4R8P K;  2Y43 A;  1WGM A;  5G0F A;  4BHW A;  2YHO A;  5JG6 A;  5LKZ A;  2LDR A;  2Y1N A;  4GNE A;  4S3O C;  2MNZ A;  2KFT A;  3I2D A;  3RTR B;  3PHD A;  5TDR A;  2E6S A;  4QF2 A;  3SOX A;  2H0D A;  3ZTG A;  3EB6 A;  4AYC A;  4UP0 A;  2OXQ C;  2PUY A;  5AIU A;  1WES A;  1WIL A;  2VJF A;  2CSZ A;  1WIM A;  2QIZ A;  4Q6F A;  2XEU A;  3N9Q A;  2UZG A;  3RPG B;  4MSX A;  3V43 A;  2ECI A;  2G43 A;  3GL6 A;  4L58 A;  1XWH A;  4FJC A;  4FO9 A;  1DVP A;  2K16 A;  4YAD A;  2CKL A;  3N9P A;  5B76 A;  2CT2 A;  2ECG A;  2YHN A;  2KWO A;  2BAY A;  5D1L B;  2K4D A;  2L75 A;  1N87 A;  1Z6U A;  2M3H A;  5H9M A;  2KWN A;  4MVT A;  2JMJ A;  5FB0 A;  5EYA F;  4YBM A;  4C9Z A;  4AVX A;  3LQJ A;  4IC3 A;  5TRB A;  2LGL A;  2FUI A;  2KWJ A;  1WEN A;  1WFK A;  4LK9 A;  4GNF A;  2VJF B;  1WEP A;  3NG2 A;  2LRI C;  2MD8 C;  5LKT A;  2VJE A;  4AUQ B;  2LXH C;  5LKX A;  2LQ6 A;  2FUU A;  1WEQ A;  4W4U A;  3HCU A;  1X4I A;  4R2Y A;  3O36 A;  2M85 A;  3N9N A;  2ZET C;  1WE9 A;  4X3G A;  3KQI A;  3O70 A;  2CKL B;  1WEU A;  4I7C A;  2KE1 A;  3IHP A;  4PTB A;  4BBQ A;  4ZUX U;  1VFY A;  5H1V A;  2YRE A;  2MD7 B;  2FSA A;  3RPG C;  4XI1 A;  4YBT A;  3O34 A;  5B77 A;  2C2L A;  2AN6 A;  4A4C A;  3PUR A;  3ZVZ B;  2F42 A;  3L1X A;  4YC9 A;  2L43 A;  4WZ0 A;  2YSJ A;  3KNV A;  5TDW A;  2KR4 A;  5KH7 A;  2YSM A;  4YAT A;  2QJ0 A;  2JMD A;  4PPE A;  4FIP A;  3M62 A;  5FB1 A;  2KRE A;  4LAD B;  3MHH A;  4V3L C;  1Z2Q A;  2CSY A;  2PNX A;  3N9M A;  1G25 A;  1WEM A;  3M63 A;  4TKP B;  3ASL A;  3U5N A;  3MHS A;  3U5O A;  2LN0 A;  4WZ2 A;  4I7B A;  1T1H A;  4B7Y C;  4N3W A;  4QF3 A;  2HDP A;  4UP5 A;  3HCT A;  3L11 A;  1RMD A;  2KYU A;  1LDJ B;  2EOD A;  3O37 A;  5G04 B;  3FL2 A;  1IYM A;  4YAX A;  2KGI A;  4I7D A;  2IDA A;  2KU3 A;  4WZ3 B;  5B75 A;  2MT5 A;  5I3L A;  5H1T A;  5D1K B;  2MA6 A;  4N4F A;  5C13 A;  2H0D B;  4AYC B;  3KV5 A;  3HCS A;  1U6G B;  1WEO A;  2LGV A;  2ECN A;  3DPL R;  3SOU A;  2ECV A;  2C2V S;  4V3K C;  2LGG A;  2YUC A;  1MM3 A;  2DX8 A;  3QZV A;  4A4B A;  2K1J A;  2HYE D;  1E4U A;  4A0C D;  1F62 A;  2LV9 A;  2RI7 A;  5DKA A;  3ZNI A;  3ZPV E;  4GB0 A;  4UI9 B;  2XB1 A;  2YQM A;  2MIQ A;  4LKA A;  2F6J A;  3GV4 A;  2D8S A;  3PUQ A;  1ZBD B;  2EGP A;  3DQV R;  3O35 A;  3T6R A;  3EB5 A;  2VPB A;  5AIT A;  2VNF A;  4CA1 A;  5G05 B;  2G45 A;  2M6M A;  3U5P A;  3HTK C;  5TBN A;  1VYX A;  1FBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...