3T6RA

Structure of uhrf1 in complex with unmodified h3 n-terminal tail
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
b'APEFGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title UHRF1 double tudor domain and the adjacent PHD finger act together to recognize K9me3-containing histone H3 tail
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3t6rA00
2YU4A 2ECIA 4A0CD 2XB1A 4UP0A 2F6JA 3KV5A 1WEUA 3HCUA 3HTKC 3KNVA 4I7CA 5KH9A 2YSMA 4V3LC 3MHHA 1JM7A 4N3WA 2LN0A 2L43A 4R7EA 3LRQA 3IHPA 4IC2A 5G04B 4YAXA 1WEOA 3ASLA 2M3HA 2YQMA 2YW8A 3M63A 2YT5A 3M99A 1LDJB 4I7DA 4GNEA 4A4BA 3U5PA 2YURA 4PPEA 5H1TA 5LKUA 2F6NA 3T7LA 2LGGA 2LXHC 2JMIA 1F62A 5FERA 1V87A 2HYED 4WZ2A 4UP5A 1T1HA 3N9LA 2YREA 1Z60A 5J3XA 3PUQA 3KQIA 4GB0A 5EYAF 2ECTA 2VJFA 2VPBA 4YC9A 3U5MA 2LXPC 2CSZA 2QJ0A 5FB1A 5AIUA 4FJCA 2H0DA 5TDWA 3HCSA 4FIPA 2Y1NA 4C9ZA 2HDPA 4AVXA 3SOUA 2G45A 3T6RA 1WEQA 1WEWA 5LKZA 4S3OB 2Y43A 1VFYA 2VPDA 3QZVA 2VP7A 2CKLB 2RI7A 5AITA 2YHNA 4UI9B 3L1XA 1WESA 1JOCA 4AYCB 2E6RA 2KWJA 5FEYA 5B79A 2LV9A 2RSDA 2YHOA 5H1UA 5TRBA 4A49A 4ZUXU 2MA6A 2K17A 2K16A 4N4FA 1WIMA 2C2VS 3SHBA 2E6SA 1IYMA 4ZQLA 1HYJA 4MVTA 2MNZA 3ZYQA 2LRIC 2MD7B 2C2LA 4TKPB 2M85A 2MT5A 2M1RA 5FB0A 2VPEA 2D8SA 5G05B 1CHCA 2L5UA 3N9PA 2VJFB 2EODA 3O7AA 2AN6A 2JRJA 2EGPA 4GNFA 5KH3A 3EB6A 2K1JA 4FK5A 5KH7A 4WZ3B 2MIQA 4BHWA 2H0DB 3O37A 1E4UA 4GNDA 5D1KB 2BAYA 2KWNA 1VD4A 4B7YC 4FO9A 2JMDA 4R8PK 2ECVA 3PHDA 4WZ0A 3ZPVE 2QIZA 4LK9A 3N9MA 5B76A 4A4CA 3I2DA 4S3OC 1Z6UA 3GV4A 4LADB 1Z2QA 5H9MA 3N9QA 5LCWB 1MM3A 2KYUA 5TABA 1G25A 2MNYA 3O36A 3O33A 2VPGA 3KV6A 4L7XA 3O35A 4LLBA 5D1LB 5C13A 1WGMA 4P5OB 3PURA 3U5OA 3M62A 5G0FA 5TDRA 2KR4A 4R2YA 3C5KA 3RPGB 2QICA 3ZVYA 2MA5A 1JM7B 3DQVR 3VK6A 2YUCA 1RMDA 2K4DA 4ZDTA 5B77A 2KREA 5B75A 3ZVZB 5DINA 4YABA 4XI1A 4YBMA 4V3KC 1WE9A 4CCGX 4GNGA 4F52B 4I7BA 5B78A 2ECJA 3O70A 2VJEA 2I50A 2F42A 2YYRA 2LGVA 3LQIA 2KE1A 3SOXA 2KIZA 1X4JA 4BBQA 2L80A 2FUIA 4YADA 1X4UA 1WENA 3HCTA 2MD8C 1WEVA 2ZETC 4X3GA 2KFTA 2OXQC 4B86C 5LKXA 4AYCA 1WEPA 2KU3A 2VNFA 2PNXA 4O64A 2PUYA 5C11A 5B8DA 3U5NA 2LDRA 1WFKA 1HYIA 2LQ6A 3NG2A 4YBSA 1U6GB 4AP4A 3C6WA 3RPGC 5D1MB 2L0BA 2LGKA 5JG6A 2IDAA 2JMJA 4YATA 1WEMA 3DPLR 2KWOA 2KGIA 4W4UA 3ZNIA 2EA6A 1N87A 3O34A 4QF3A 3L1ZB 2CT2A 2Y1MA 1FP0A 2KWKA 4L58A 4Q6FA 2VJEB 4YBTA 2LGLA 2G6QA 3LQHA 2ECWA 1XWHA 3EB5A 1FBVA 1MM2A 3ZPV1 3N9NA 3V43A 3GL6A 4IC3A 1WEEA 2NAAA 5H1VA 3L11A 3N9OA 1WILA 1VYXA 5DKAA 2YQLA 2CSYA 1BORA 4MSXA 2FSAA 4CA1A 4PTBA 4QF2A 1ZBDB 2MUMA 3RTRB 2M6MA 1X4IA 4WA6A 4LJNA 2KGGA 5TBNA 2G43A 3ZTGA 3FL2A 2XEUA 4NN2A 1LDKC 2DX8A 2ECNA 2YSJA 2ECGA 5I3LA 5LKTA 3MHSA 4LKAA 2FUUA 3LQJA 4AUQB 2L75A 2UZGA 1DVPA 2CKLA 3SOWA 1K2FA
chains in the Genus database with same CATH superfamily
2YU4A 2ECIA 2KKXA 4A0CD 2XB1A 4UP0A 2F6JA 3KV5A 1WEUA 3Q1DA 3HCUA 3HTKC 3KNVA 4I7CA 5KH9A 2YSMA 4V3LC 3MHHA 1JM7A 4N3WA 2LN0A 2L43A 4R7EA 3LRQA 3IHPA 4IC2A 5G04B 4YAXA 1WEOA 3ASLA 2M3HA 4Z0RA 2YQMA 2YW8A 3M63A 2YT5A 3M99A 1LDJB 4I7DA 4GNEA 4A4BA 3U5PA 2YURA 4PPEA 5H1TA 5LKUA 2F6NA 2JUNA 3T7LA 2LGGA 2LXHC 2JMIA 1F62A 5FERA 1V87A 2HYED 4WZ2A 4UP5A 1T1HA 3MDBC 3N9LA 2YREA 1Z60A 5J3XA 3PUQA 3KQIA 4GB0A 1DCQA 5EYAF 2ECTA 2VJFA 2VPBA 3LDYA 4QQ4A 4YC9A 3U5MA 2LXPC 2CSZA 2QJ0A 1MBMA 2EGMA 5FB1A 5AIUA 3O47A 4FJCA 3M7KA 2H0DA 5TDWA 3HCSA 4FIPA 2Y1NA 4C9ZA 2HDPA 4AVXA 3SOUA 2G45A 3T6RA 1WEQA 1WEWA 5LKZA 4S3OB 2Y43A 1VFYA 2VPDA 3QZVA 2VP7A 2CKLB 2RI7A 5AITA 2YHNA 4UI9B 3L1XA 1WESA 2XOYA 1JOCA 4AYCB 2E6RA 2KWJA 5FEYA 5B79A 2LV9A 2RSDA 2YHOA 4OGCA 5H1UA 5TRBA 4A49A 4ZUXU 2MA6A 2K17A 2K16A 4N4FA 1WIMA 2C2VS 5K3QA 2E6SA 3SHBA 1IYMA 2CONA 4ZQLA 2DJAA 1HYJA 2RR4A 4MVTA 2MNZA 3ZYQA 2LRIC 2MD7B 2C2LA 4TKPB 2M85A 2MT5A 2M1RA 5FB0A 2VPEA 5SVIB 2D8SA 2LAUA 5G05B 3FAOA 1CHCA 4F1PA 2L5UA 3N9PA 2VJFB 2EODA 3O7AA 2AN6A 2JRJA 2EGPA 4GNFA 5KH3A 2YVRA 3EB6A 2K1JA 4FK5A 2JM3A 3DDTA 5KH7A 4WZ3B 2MIQA 4BHWA 2H0DB 3O37A 2OWAA 1E4UA 4GNDA 3FJUB 5D1KB 2BAYA 2KWNA 4O62A 1VD4A 4B7YC 4FO9A 2JMDA 4R8PK 2ECVA 3PHDA 4WZ0A 3ZPVE 2QIZA 4LK9A 3N9MA 5B76A 4A4CA 2CRWA 3I2DA 4S3OC 1Z6UA 3GV4A 4LADB 1Z2QA 5H9MA 3DWDA 3N9QA 5LCWB 1MM3A 2KYUA 5TABA 1G25A 2MNYA 3O36A 3O33A 2VPGA 2CRRA 3FM8C 3KV6A 4L7XA 2KKYA 3O35A 4LLBA 5D1LB 5C13A 1WGMA 2FD4A 4P5OB 3PURA 3U5OA 3M62A 5G0FA 2DSMA 5TDRA 2KR4A 4R2YA 3C5KA 3RPGB 2QICA 2XOZA 2L7PA 3ZVYA 2MA5A 1JM7B 3DQVR 5SVXA 3VK6A 2YUCA 1RMDA 2K4DA 4ZDTA 2M13A 5B77A 2KREA 4Z0OA 5B75A 3ZVZB 3PLWA 5SVYA 5DINA 4YABA 4XI1A 4YBMA 4V3KC 1WE9A 4CCGX 4GNGA 3H7HA 4F52B 4I7BA 5B78A 2ECJA 3O70A 2VJEA 2I50A 2F42A 2YYRA 2LGVA 3LQIA 3FANA 2KE1A 2P57A 3SOXA 2KIZA 1X4JA 4BBQA 3JUEA 2L80A 2FUIA 4YADA 2CSVA 1X4UA 1WENA 3LVQE 3HCTA 2MD8C 1WEVA 2ZETC 4X3GA 2KFTA 3E2DA 2OXQC 4B86C 5LKXA 4AYCA 1WEPA 2KU3A 2VNFA 2PNXA 4O64A 2PUYA 5C11A 3LJUX 5B8DA 3U5NA 2LDRA 3FEHA 1WFKA 1HYIA 2LQ6A 3NG2A 4YBSA 1U6GB 4AP4A 3C6WA 3RPGC 5D1MB 2L0BA 3LVRE 2LGKA 5JG6A 2FFWA 2D8UA 2IDAA 2JMJA 4YATA 5SVIA 2XOCA 1WEMA 3DPLR 2KWOA 2KGIA 4W4UA 3ZNIA 2EA6A 1N87A 3O34A 4QF3A 3L1ZB 2CT2A 2Y1MA 1FP0A 2KWKA 4L58A 4Q6FA 2VJEB 4YBTA 2LGLA 2G6QA 3LQHA 2ECWA 1XWHA 4OGEA 3EB5A 1FBVA 1MM2A 3ZPV1 3N9NA 3V43A 3GL6A 4IC3A 1WEEA 2NAAA 3KDEC 2EXUA 5H1VA 2IQJA 3L11A 3N9OA 1WILA 1VYXA 5DKAA 2YQLA 2CSYA 1BORA 2B0OE 4MSXA 2FSAA 4CA1A 4PTBA 4QF2A 1ZBDB 2MUMA 3RTRB 2M6MA 1X4IA 4WA6A 2E61A 4LJNA 2KGGA 3SUBA 5TBNA 2G43A 3ZTGA 3FL2A 2XEUA 4H9DA 2XP0A 4NN2A 3T9KA 1LDKC 2DX8A 2ECNA 2YSJA 2ECGA 5I3LA 5LKTA 3MHSA 4LKAA 2FUUA 2MKEA 3LQJA 4AUQB 2L75A 2UZGA 1DVPA 2CKLA 3SOWA 1K2FA
chains in the Genus database with same CATH topology
2YU4A 2ECIA 4A0CD 2XB1A 4UP0A 2F6JA 3KV5A 1WEUA 3HCUA 3HTKC 3KNVA 4I7CA 5KH9A 2YSMA 4V3LC 3MHHA 1JM7A 4N3WA 2LN0A 2L43A 4R7EA 3LRQA 3IHPA 4IC2A 5G04B 4YAXA 1WEOA 3ASLA 2M3HA 2YQMA 2YW8A 3M63A 2YT5A 3M99A 1LDJB 4I7DA 4GNEA 4A4BA 3U5PA 2YURA 4PPEA 5H1TA 5LKUA 2F6NA 3T7LA 2LGGA 2LXHC 2JMIA 1F62A 5FERA 1V87A 2HYED 4WZ2A 4UP5A 1T1HA 3N9LA 2YREA 1Z60A 5J3XA 3PUQA 3KQIA 4GB0A 5EYAF 2ECTA 2VJFA 2VPBA 4YC9A 3U5MA 2LXPC 2CSZA 2QJ0A 5FB1A 5AIUA 4FJCA 2H0DA 5TDWA 3HCSA 4FIPA 2Y1NA 4C9ZA 2HDPA 4AVXA 3SOUA 2G45A 3T6RA 1WEQA 1WEWA 5LKZA 4S3OB 2Y43A 1VFYA 2VPDA 3QZVA 2VP7A 2CKLB 2RI7A 5AITA 2YHNA 4UI9B 3L1XA 1WESA 1JOCA 4AYCB 2E6RA 2KWJA 5FEYA 5B79A 2LV9A 2RSDA 2YHOA 5H1UA 5TRBA 4A49A 4ZUXU 2MA6A 2K17A 2K16A 4N4FA 1WIMA 2C2VS 3SHBA 2E6SA 1IYMA 4ZQLA 1HYJA 4MVTA 2MNZA 3ZYQA 2LRIC 2MD7B 2C2LA 4TKPB 2M85A 2MT5A 2M1RA 5FB0A 2VPEA 2D8SA 5G05B 1CHCA 2L5UA 3N9PA 2VJFB 2EODA 3O7AA 2AN6A 2JRJA 2EGPA 4GNFA 5KH3A 3EB6A 2K1JA 4FK5A 5KH7A 4WZ3B 2MIQA 4BHWA 2H0DB 3O37A 1E4UA 4GNDA 5D1KB 2BAYA 2KWNA 1VD4A 4B7YC 4FO9A 2JMDA 4R8PK 2ECVA 3PHDA 4WZ0A 3ZPVE 2QIZA 4LK9A 3N9MA 5B76A 4A4CA 3I2DA 4S3OC 1Z6UA 3GV4A 4LADB 1Z2QA 5H9MA 3N9QA 5LCWB 1MM3A 2KYUA 5TABA 1G25A 2MNYA 3O36A 3O33A 2VPGA 3KV6A 4L7XA 3O35A 4LLBA 5D1LB 5C13A 1WGMA 4P5OB 3PURA 3U5OA 3M62A 5G0FA 5TDRA 2KR4A 4R2YA 3C5KA 3RPGB 2QICA 3ZVYA 2MA5A 1JM7B 3DQVR 3VK6A 2YUCA 1RMDA 2K4DA 4ZDTA 5B77A 2KREA 5B75A 3ZVZB 5DINA 4YABA 4XI1A 4YBMA 4V3KC 1WE9A 4CCGX 4GNGA 4F52B 4I7BA 5B78A 2ECJA 3O70A 2VJEA 2I50A 2F42A 2YYRA 2LGVA 3LQIA 2KE1A 3SOXA 2KIZA 1X4JA 4BBQA 2L80A 2FUIA 4YADA 1X4UA 1WENA 3HCTA 2MD8C 1WEVA 2ZETC 4X3GA 2KFTA 2OXQC 4B86C 5LKXA 4AYCA 1WEPA 2KU3A 2VNFA 2PNXA 4O64A 2PUYA 5C11A 5B8DA 3U5NA 2LDRA 1WFKA 1HYIA 2LQ6A 3NG2A 4YBSA 1U6GB 4AP4A 3C6WA 3RPGC 5D1MB 2L0BA 2LGKA 5JG6A 2IDAA 2JMJA 4YATA 1WEMA 3DPLR 2KWOA 2KGIA 4W4UA 3ZNIA 2EA6A 1N87A 3O34A 4QF3A 3L1ZB 2CT2A 2Y1MA 1FP0A 2KWKA 4L58A 4Q6FA 2VJEB 4YBTA 2LGLA 2G6QA 3LQHA 2ECWA 1XWHA 3EB5A 1FBVA 1MM2A 3ZPV1 3N9NA 3V43A 3GL6A 4IC3A 1WEEA 2NAAA 5H1VA 3L11A 3N9OA 1WILA 1VYXA 5DKAA 2YQLA 2CSYA 1BORA 4MSXA 2FSAA 4CA1A 4PTBA 4QF2A 1ZBDB 2MUMA 3RTRB 2M6MA 1X4IA 4WA6A 4LJNA 2KGGA 5TBNA 2G43A 3ZTGA 3FL2A 2XEUA 4NN2A 1LDKC 2DX8A 2ECNA 2YSJA 2ECGA 5I3LA 5LKTA 3MHSA 4LKAA 2FUUA 3LQJA 4AUQB 2L75A 2UZGA 1DVPA 2CKLA 3SOWA 1K2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU4 A;  2ECI A;  4A0C D;  2XB1 A;  4UP0 A;  2F6J A;  3KV5 A;  1WEU A;  3HCU A;  3HTK C;  3KNV A;  4I7C A;  5KH9 A;  2YSM A;  4V3L C;  3MHH A;  1JM7 A;  4N3W A;  2LN0 A;  2L43 A;  4R7E A;  3LRQ A;  3IHP A;  4IC2 A;  5G04 B;  4YAX A;  1WEO A;  3ASL A;  2M3H A;  2YQM A;  2YW8 A;  3M63 A;  2YT5 A;  3M99 A;  1LDJ B;  4I7D A;  4GNE A;  4A4B A;  3U5P A;  2YUR A;  4PPE A;  5H1T A;  5LKU A;  2F6N A;  3T7L A;  2LGG A;  2LXH C;  2JMI A;  1F62 A;  5FER A;  1V87 A;  2HYE D;  4WZ2 A;  4UP5 A;  1T1H A;  3N9L A;  2YRE A;  1Z60 A;  5J3X A;  3PUQ A;  3KQI A;  4GB0 A;  5EYA F;  2ECT A;  2VJF A;  2VPB A;  4YC9 A;  3U5M A;  2LXP C;  2CSZ A;  2QJ0 A;  5FB1 A;  5AIU A;  4FJC A;  2H0D A;  5TDW A;  3HCS A;  4FIP A;  2Y1N A;  4C9Z A;  2HDP A;  4AVX A;  3SOU A;  2G45 A;  3T6R A;  1WEQ A;  1WEW A;  5LKZ A;  4S3O B;  2Y43 A;  1VFY A;  2VPD A;  3QZV A;  2VP7 A;  2CKL B;  2RI7 A;  5AIT A;  2YHN A;  4UI9 B;  3L1X A;  1WES A;  1JOC A;  4AYC B;  2E6R A;  2KWJ A;  5FEY A;  5B79 A;  2LV9 A;  2RSD A;  2YHO A;  5H1U A;  5TRB A;  4A49 A;  4ZUX U;  2MA6 A;  2K17 A;  2K16 A;  4N4F A;  1WIM A;  2C2V S;  3SHB A;  2E6S A;  1IYM A;  4ZQL A;  1HYJ A;  4MVT A;  2MNZ A;  3ZYQ A;  2LRI C;  2MD7 B;  2C2L A;  4TKP B;  2M85 A;  2MT5 A;  2M1R A;  5FB0 A;  2VPE A;  2D8S A;  5G05 B;  1CHC A;  2L5U A;  3N9P A;  2VJF B;  2EOD A;  3O7A A;  2AN6 A;  2JRJ A;  2EGP A;  4GNF A;  5KH3 A;  3EB6 A;  2K1J A;  4FK5 A;  5KH7 A;  4WZ3 B;  2MIQ A;  4BHW A;  2H0D B;  3O37 A;  1E4U A;  4GND A;  5D1K B;  2BAY A;  2KWN A;  1VD4 A;  4B7Y C;  4FO9 A;  2JMD A;  4R8P K;  2ECV A;  3PHD A;  4WZ0 A;  3ZPV E;  2QIZ A;  4LK9 A;  3N9M A;  5B76 A;  4A4C A;  3I2D A;  4S3O C;  1Z6U A;  3GV4 A;  4LAD B;  1Z2Q A;  5H9M A;  3N9Q A;  5LCW B;  1MM3 A;  2KYU A;  5TAB A;  1G25 A;  2MNY A;  3O36 A;  3O33 A;  2VPG A;  3KV6 A;  4L7X A;  3O35 A;  4LLB A;  5D1L B;  5C13 A;  1WGM A;  4P5O B;  3PUR A;  3U5O A;  3M62 A;  5G0F A;  5TDR A;  2KR4 A;  4R2Y A;  3C5K A;  3RPG B;  2QIC A;  3ZVY A;  2MA5 A;  1JM7 B;  3DQV R;  3VK6 A;  2YUC A;  1RMD A;  2K4D A;  4ZDT A;  5B77 A;  2KRE A;  5B75 A;  3ZVZ B;  5DIN A;  4YAB A;  4XI1 A;  4YBM A;  4V3K C;  1WE9 A;  4CCG X;  4GNG A;  4F52 B;  4I7B A;  5B78 A;  2ECJ A;  3O70 A;  2VJE A;  2I50 A;  2F42 A;  2YYR A;  2LGV A;  3LQI A;  2KE1 A;  3SOX A;  2KIZ A;  1X4J A;  4BBQ A;  2L80 A;  2FUI A;  4YAD A;  1X4U A;  1WEN A;  3HCT A;  2MD8 C;  1WEV A;  2ZET C;  4X3G A;  2KFT A;  2OXQ C;  4B86 C;  5LKX A;  4AYC A;  1WEP A;  2KU3 A;  2VNF A;  2PNX A;  4O64 A;  2PUY A;  5C11 A;  5B8D A;  3U5N A;  2LDR A;  1WFK A;  1HYI A;  2LQ6 A;  3NG2 A;  4YBS A;  1U6G B;  4AP4 A;  3C6W A;  3RPG C;  5D1M B;  2L0B A;  2LGK A;  5JG6 A;  2IDA A;  2JMJ A;  4YAT A;  1WEM A;  3DPL R;  2KWO A;  2KGI A;  4W4U A;  3ZNI A;  2EA6 A;  1N87 A;  3O34 A;  4QF3 A;  3L1Z B;  2CT2 A;  2Y1M A;  1FP0 A;  2KWK A;  4L58 A;  4Q6F A;  2VJE B;  4YBT A;  2LGL A;  2G6Q A;  3LQH A;  2ECW A;  1XWH A;  3EB5 A;  1FBV A;  1MM2 A;  3ZPV 1;  3N9N A;  3V43 A;  3GL6 A;  4IC3 A;  1WEE A;  2NAA A;  5H1V A;  3L11 A;  3N9O A;  1WIL A;  1VYX A;  5DKA A;  2YQL A;  2CSY A;  1BOR A;  4MSX A;  2FSA A;  4CA1 A;  4PTB A;  4QF2 A;  1ZBD B;  2MUM A;  3RTR B;  2M6M A;  1X4I A;  4WA6 A;  4LJN A;  2KGG A;  5TBN A;  2G43 A;  3ZTG A;  3FL2 A;  2XEU A;  4NN2 A;  1LDK C;  2DX8 A;  2ECN A;  2YSJ A;  2ECG A;  5I3L A;  5LKT A;  3MHS A;  4LKA A;  2FUU A;  3LQJ A;  4AUQ B;  2L75 A;  2UZG A;  1DVP A;  2CKL A;  3SOW A;  1K2F A; 
#chains in the Genus database with same CATH topology
 2YU4 A;  2ECI A;  2KKX A;  4A0C D;  2XB1 A;  4UP0 A;  2F6J A;  3KV5 A;  1WEU A;  3Q1D A;  3HCU A;  3HTK C;  3KNV A;  4I7C A;  5KH9 A;  2YSM A;  4V3L C;  3MHH A;  1JM7 A;  4N3W A;  2LN0 A;  2L43 A;  4R7E A;  3LRQ A;  3IHP A;  4IC2 A;  5G04 B;  4YAX A;  1WEO A;  3ASL A;  2M3H A;  4Z0R A;  2YQM A;  2YW8 A;  3M63 A;  2YT5 A;  3M99 A;  1LDJ B;  4I7D A;  4GNE A;  4A4B A;  3U5P A;  2YUR A;  4PPE A;  5H1T A;  5LKU A;  2F6N A;  2JUN A;  3T7L A;  2LGG A;  2LXH C;  2JMI A;  1F62 A;  5FER A;  1V87 A;  2HYE D;  4WZ2 A;  4UP5 A;  1T1H A;  3MDB C;  3N9L A;  2YRE A;  1Z60 A;  5J3X A;  3PUQ A;  3KQI A;  4GB0 A;  1DCQ A;  5EYA F;  2ECT A;  2VJF A;  2VPB A;  3LDY A;  4QQ4 A;  4YC9 A;  3U5M A;  2LXP C;  2CSZ A;  2QJ0 A;  1MBM A;  2EGM A;  5FB1 A;  5AIU A;  3O47 A;  4FJC A;  3M7K A;  2H0D A;  5TDW A;  3HCS A;  4FIP A;  2Y1N A;  4C9Z A;  2HDP A;  4AVX A;  3SOU A;  2G45 A;  3T6R A;  1WEQ A;  1WEW A;  5LKZ A;  4S3O B;  2Y43 A;  1VFY A;  2VPD A;  3QZV A;  2VP7 A;  2CKL B;  2RI7 A;  5AIT A;  2YHN A;  4UI9 B;  3L1X A;  1WES A;  2XOY A;  1JOC A;  4AYC B;  2E6R A;  2KWJ A;  5FEY A;  5B79 A;  2LV9 A;  2RSD A;  2YHO A;  4OGC A;  5H1U A;  5TRB A;  4A49 A;  4ZUX U;  2MA6 A;  2K17 A;  2K16 A;  4N4F A;  1WIM A;  2C2V S;  5K3Q A;  2E6S A;  3SHB A;  1IYM A;  2CON A;  4ZQL A;  2DJA A;  1HYJ A;  2RR4 A;  4MVT A;  2MNZ A;  3ZYQ A;  2LRI C;  2MD7 B;  2C2L A;  4TKP B;  2M85 A;  2MT5 A;  2M1R A;  5FB0 A;  2VPE A;  5SVI B;  2D8S A;  2LAU A;  5G05 B;  3FAO A;  1CHC A;  4F1P A;  2L5U A;  3N9P A;  2VJF B;  2EOD A;  3O7A A;  2AN6 A;  2JRJ A;  2EGP A;  4GNF A;  5KH3 A;  2YVR A;  3EB6 A;  2K1J A;  4FK5 A;  2JM3 A;  3DDT A;  5KH7 A;  4WZ3 B;  2MIQ A;  4BHW A;  2H0D B;  3O37 A;  2OWA A;  1E4U A;  4GND A;  3FJU B;  5D1K B;  2BAY A;  2KWN A;  4O62 A;  1VD4 A;  4B7Y C;  4FO9 A;  2JMD A;  4R8P K;  2ECV A;  3PHD A;  4WZ0 A;  3ZPV E;  2QIZ A;  4LK9 A;  3N9M A;  5B76 A;  4A4C A;  2CRW A;  3I2D A;  4S3O C;  1Z6U A;  3GV4 A;  4LAD B;  1Z2Q A;  5H9M A;  3DWD A;  3N9Q A;  5LCW B;  1MM3 A;  2KYU A;  5TAB A;  1G25 A;  2MNY A;  3O36 A;  3O33 A;  2VPG A;  2CRR A;  3FM8 C;  3KV6 A;  4L7X A;  2KKY A;  3O35 A;  4LLB A;  5D1L B;  5C13 A;  1WGM A;  2FD4 A;  4P5O B;  3PUR A;  3U5O A;  3M62 A;  5G0F A;  2DSM A;  5TDR A;  2KR4 A;  4R2Y A;  3C5K A;  3RPG B;  2QIC A;  2XOZ A;  2L7P A;  3ZVY A;  2MA5 A;  1JM7 B;  3DQV R;  5SVX A;  3VK6 A;  2YUC A;  1RMD A;  2K4D A;  4ZDT A;  2M13 A;  5B77 A;  2KRE A;  4Z0O A;  5B75 A;  3ZVZ B;  3PLW A;  5SVY A;  5DIN A;  4YAB A;  4XI1 A;  4YBM A;  4V3K C;  1WE9 A;  4CCG X;  4GNG A;  3H7H A;  4F52 B;  4I7B A;  5B78 A;  2ECJ A;  3O70 A;  2VJE A;  2I50 A;  2F42 A;  2YYR A;  2LGV A;  3LQI A;  3FAN A;  2KE1 A;  2P57 A;  3SOX A;  2KIZ A;  1X4J A;  4BBQ A;  3JUE A;  2L80 A;  2FUI A;  4YAD A;  2CSV A;  1X4U A;  1WEN A;  3LVQ E;  3HCT A;  2MD8 C;  1WEV A;  2ZET C;  4X3G A;  2KFT A;  3E2D A;  2OXQ C;  4B86 C;  5LKX A;  4AYC A;  1WEP A;  2KU3 A;  2VNF A;  2PNX A;  4O64 A;  2PUY A;  5C11 A;  3LJU X;  5B8D A;  3U5N A;  2LDR A;  3FEH A;  1WFK A;  1HYI A;  2LQ6 A;  3NG2 A;  4YBS A;  1U6G B;  4AP4 A;  3C6W A;  3RPG C;  5D1M B;  2L0B A;  3LVR E;  2LGK A;  5JG6 A;  2FFW A;  2D8U A;  2IDA A;  2JMJ A;  4YAT A;  5SVI A;  2XOC A;  1WEM A;  3DPL R;  2KWO A;  2KGI A;  4W4U A;  3ZNI A;  2EA6 A;  1N87 A;  3O34 A;  4QF3 A;  3L1Z B;  2CT2 A;  2Y1M A;  1FP0 A;  2KWK A;  4L58 A;  4Q6F A;  2VJE B;  4YBT A;  2LGL A;  2G6Q A;  3LQH A;  2ECW A;  1XWH A;  4OGE A;  3EB5 A;  1FBV A;  1MM2 A;  3ZPV 1;  3N9N A;  3V43 A;  3GL6 A;  4IC3 A;  1WEE A;  2NAA A;  3KDE C;  2EXU A;  5H1V A;  2IQJ A;  3L11 A;  3N9O A;  1WIL A;  1VYX A;  5DKA A;  2YQL A;  2CSY A;  1BOR A;  2B0O E;  4MSX A;  2FSA A;  4CA1 A;  4PTB A;  4QF2 A;  1ZBD B;  2MUM A;  3RTR B;  2M6M A;  1X4I A;  4WA6 A;  2E61 A;  4LJN A;  2KGG A;  3SUB A;  5TBN A;  2G43 A;  3ZTG A;  3FL2 A;  2XEU A;  4H9D A;  2XP0 A;  4NN2 A;  3T9K A;  1LDK C;  2DX8 A;  2ECN A;  2YSJ A;  2ECG A;  5I3L A;  5LKT A;  3MHS A;  4LKA A;  2FUU A;  2MKE A;  3LQJ A;  4AUQ B;  2L75 A;  2UZG A;  1DVP A;  2CKL A;  3SOW A;  1K2F A; 
#chains in the Genus database with same CATH homology
 2YU4 A;  2ECI A;  4A0C D;  2XB1 A;  4UP0 A;  2F6J A;  3KV5 A;  1WEU A;  3HCU A;  3HTK C;  3KNV A;  4I7C A;  5KH9 A;  2YSM A;  4V3L C;  3MHH A;  1JM7 A;  4N3W A;  2LN0 A;  2L43 A;  4R7E A;  3LRQ A;  3IHP A;  4IC2 A;  5G04 B;  4YAX A;  1WEO A;  3ASL A;  2M3H A;  2YQM A;  2YW8 A;  3M63 A;  2YT5 A;  3M99 A;  1LDJ B;  4I7D A;  4GNE A;  4A4B A;  3U5P A;  2YUR A;  4PPE A;  5H1T A;  5LKU A;  2F6N A;  3T7L A;  2LGG A;  2LXH C;  2JMI A;  1F62 A;  5FER A;  1V87 A;  2HYE D;  4WZ2 A;  4UP5 A;  1T1H A;  3N9L A;  2YRE A;  1Z60 A;  5J3X A;  3PUQ A;  3KQI A;  4GB0 A;  5EYA F;  2ECT A;  2VJF A;  2VPB A;  4YC9 A;  3U5M A;  2LXP C;  2CSZ A;  2QJ0 A;  5FB1 A;  5AIU A;  4FJC A;  2H0D A;  5TDW A;  3HCS A;  4FIP A;  2Y1N A;  4C9Z A;  2HDP A;  4AVX A;  3SOU A;  2G45 A;  3T6R A;  1WEQ A;  1WEW A;  5LKZ A;  4S3O B;  2Y43 A;  1VFY A;  2VPD A;  3QZV A;  2VP7 A;  2CKL B;  2RI7 A;  5AIT A;  2YHN A;  4UI9 B;  3L1X A;  1WES A;  1JOC A;  4AYC B;  2E6R A;  2KWJ A;  5FEY A;  5B79 A;  2LV9 A;  2RSD A;  2YHO A;  5H1U A;  5TRB A;  4A49 A;  4ZUX U;  2MA6 A;  2K17 A;  2K16 A;  4N4F A;  1WIM A;  2C2V S;  3SHB A;  2E6S A;  1IYM A;  4ZQL A;  1HYJ A;  4MVT A;  2MNZ A;  3ZYQ A;  2LRI C;  2MD7 B;  2C2L A;  4TKP B;  2M85 A;  2MT5 A;  2M1R A;  5FB0 A;  2VPE A;  2D8S A;  5G05 B;  1CHC A;  2L5U A;  3N9P A;  2VJF B;  2EOD A;  3O7A A;  2AN6 A;  2JRJ A;  2EGP A;  4GNF A;  5KH3 A;  3EB6 A;  2K1J A;  4FK5 A;  5KH7 A;  4WZ3 B;  2MIQ A;  4BHW A;  2H0D B;  3O37 A;  1E4U A;  4GND A;  5D1K B;  2BAY A;  2KWN A;  1VD4 A;  4B7Y C;  4FO9 A;  2JMD A;  4R8P K;  2ECV A;  3PHD A;  4WZ0 A;  3ZPV E;  2QIZ A;  4LK9 A;  3N9M A;  5B76 A;  4A4C A;  3I2D A;  4S3O C;  1Z6U A;  3GV4 A;  4LAD B;  1Z2Q A;  5H9M A;  3N9Q A;  5LCW B;  1MM3 A;  2KYU A;  5TAB A;  1G25 A;  2MNY A;  3O36 A;  3O33 A;  2VPG A;  3KV6 A;  4L7X A;  3O35 A;  4LLB A;  5D1L B;  5C13 A;  1WGM A;  4P5O B;  3PUR A;  3U5O A;  3M62 A;  5G0F A;  5TDR A;  2KR4 A;  4R2Y A;  3C5K A;  3RPG B;  2QIC A;  3ZVY A;  2MA5 A;  1JM7 B;  3DQV R;  3VK6 A;  2YUC A;  1RMD A;  2K4D A;  4ZDT A;  5B77 A;  2KRE A;  5B75 A;  3ZVZ B;  5DIN A;  4YAB A;  4XI1 A;  4YBM A;  4V3K C;  1WE9 A;  4CCG X;  4GNG A;  4F52 B;  4I7B A;  5B78 A;  2ECJ A;  3O70 A;  2VJE A;  2I50 A;  2F42 A;  2YYR A;  2LGV A;  3LQI A;  2KE1 A;  3SOX A;  2KIZ A;  1X4J A;  4BBQ A;  2L80 A;  2FUI A;  4YAD A;  1X4U A;  1WEN A;  3HCT A;  2MD8 C;  1WEV A;  2ZET C;  4X3G A;  2KFT A;  2OXQ C;  4B86 C;  5LKX A;  4AYC A;  1WEP A;  2KU3 A;  2VNF A;  2PNX A;  4O64 A;  2PUY A;  5C11 A;  5B8D A;  3U5N A;  2LDR A;  1WFK A;  1HYI A;  2LQ6 A;  3NG2 A;  4YBS A;  1U6G B;  4AP4 A;  3C6W A;  3RPG C;  5D1M B;  2L0B A;  2LGK A;  5JG6 A;  2IDA A;  2JMJ A;  4YAT A;  1WEM A;  3DPL R;  2KWO A;  2KGI A;  4W4U A;  3ZNI A;  2EA6 A;  1N87 A;  3O34 A;  4QF3 A;  3L1Z B;  2CT2 A;  2Y1M A;  1FP0 A;  2KWK A;  4L58 A;  4Q6F A;  2VJE B;  4YBT A;  2LGL A;  2G6Q A;  3LQH A;  2ECW A;  1XWH A;  3EB5 A;  1FBV A;  1MM2 A;  3ZPV 1;  3N9N A;  3V43 A;  3GL6 A;  4IC3 A;  1WEE A;  2NAA A;  5H1V A;  3L11 A;  3N9O A;  1WIL A;  1VYX A;  5DKA A;  2YQL A;  2CSY A;  1BOR A;  4MSX A;  2FSA A;  4CA1 A;  4PTB A;  4QF2 A;  1ZBD B;  2MUM A;  3RTR B;  2M6M A;  1X4I A;  4WA6 A;  4LJN A;  2KGG A;  5TBN A;  2G43 A;  3ZTG A;  3FL2 A;  2XEU A;  4NN2 A;  1LDK C;  2DX8 A;  2ECN A;  2YSJ A;  2ECG A;  5I3L A;  5LKT A;  3MHS A;  4LKA A;  2FUU A;  3LQJ A;  4AUQ B;  2L75 A;  2UZG A;  1DVP A;  2CKL A;  3SOW A;  1K2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...