3T6RA

Structure of uhrf1 in complex with unmodified h3 n-terminal tail
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
APEFGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title UHRF1 double tudor domain and the adjacent PHD finger act together to recognize K9me3-containing histone H3 tail
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3t6rA00
4R8PK 4FO9A 4FK5A 4GB0A 5TABA 1E4UA 3L11A 2FSAA 1WE9A 1N87A 5C11A 2L0BA 3M63A 4S3OC 2K1JA 2JMDA 5FB1A 3HCSA 3HTKC 4N3WA 2E6RA 4GNFA 3PURA 4YBSA 4QF2A 3ZPVE 3NG2A 3N9NA 4I7CA 1V87A 3M99A 1DVPA 2KGIA 1VD4A 2YW8A 1WEQA 1HYJA 4WZ2A 2HYED 3T6RA 4AVXA 1MM2A 5TRBA 3N9QA 2FUUA 4IC3A 3O70A 1WFKA 2Y43A 3ZVZB 4CA1A 1X4JA 4YABA 2VP7A 4S3OB 2LGVA 4UP5A 5AITA 2YREA 1X4IA 2KFTA 2KR4A 5H1VA 5G05B 3RPGC 5B76A 2CKLA 4BBQA 3LQIA 3O36A 2C2LA 1HYIA 2MNYA 5B77A 2LGLA 4LKAA 1LDKC 4L58A 4CCGX 2VPDA 2YURA 2QICA 2CKLB 2CT2A 5LKZA 5LCWB 4PTBA 5TDWA 2KREA 2LXPC 4ZQLA 3VK6A 3O35A 2LDRA 4GNEA 3N9MA 2F6JA 2KGGA 2MD8C 5J3XA 1WILA 4N4FA 3C6WA 3LQJA 4X3GA 4I7BA 5D1LB 2ECJA 4V3LC 3N9PA 5B8DA 2AN6A 2IDAA 3O7AA 4MVTA 2QIZA 3KV6A 4YBTA 2KIZA 2EODA 1FBVA 5JG6A 2ECIA 4YC9A 2YUCA 2YSJA 4FJCA 3KQIA 3O37A 2EGPA 2JMIA 5AIUA 1VYXA 3FL2A 2CSYA 1K2FA 4UP0A 2BAYA 3HCUA 5DINA 1WENA 2NAAA 2G45A 5TBNA 2Y1NA 2ECVA 4XI1A 2ECTA 2UZGA 2CSZA 1WEPA 5DKAA 4W4UA 1RMDA 3LQHA 4A4CA 3C5KA 1WEUA 2M3HA 2JRJA 4LK9A 1VFYA 1F62A 2G43A 1BORA 3L1ZB 2I50A 5EYAF 2L75A 3IHPA 4AYCA 2VPEA 3HCTA 2HDPA 2KYUA 4A0CD 4GNGA 3I2DA 3N9OA 3LRQA 2LN0A 4C9ZA 2ECNA 2G6QA 5H1TA 3ZPV1 2F6NA 2K17A 4AYCB 2YQMA 3GL6A 5KH7A 5KH3A 4TKPB 2LQ6A 1WEEA 4YAXA 5B79A 3MHSA 2M85A 2MUMA 2K4DA 3ZVYA 3GV4A 3RPGB 3ASLA 2LGGA 4B86C 2VPGA 5TDRA 1Z2QA 2MNZA 4FIPA 4YADA 4UI9B 5FB0A 2M6MA 4LADB 5I3LA 2K16A 4NN2A 1MM3A 4R7EA 5KH9A 2EA6A 2RSDA 5G04B 2RI7A 2M1RA 1ZBDB 2KWJA 2C2VS 1CHCA 2MA6A 1LDJB 4A49A 2XB1A 2DX8A 3KNVA 1U6GB 4ZDTA 2H0DA 5G0FA 3RTRB 4IC2A 2KWNA 4AUQB 2KU3A 2KWKA 3O34A 3N9LA 4BHWA 3U5PA 5LKUA 1FP0A 3U5NA 2PNXA 2YQLA 4V3KC 4L7XA 4YBMA 2YSMA 5B75A 2H0DB 2YHOA 2F42A 4WZ3B 2KE1A 1Z60A 2L5UA 3O33A 2YT5A 4ZUXU 3SOWA 2XEUA 4GNDA 2MD7B 2YYRA 1T1HA 4QF3A 5D1KB 4AP4A 2LRIC 3ZTGA 1WEMA 2KWOA 5B78A 3ZNIA 2E6SA 4LJNA 5C13A 2L80A 3SOUA 2YHNA 3DQVR 4Q6FA 3L1XA 2Y1MA 3MHHA 1IYMA 4R2YA 2PUYA 3DPLR 5FERA 4WZ0A 3SHBA 2JMJA 1WGMA 2LGKA 2VJFA 1Z6UA 2MA5A 5LKXA 3KV5A 1X4UA 3PHDA 2MIQA 2L43A 4WA6A 2QJ0A 2ZETC 1WIMA 3V43A 5D1MB 2VJFB 2VPBA 1JM7A 2ECGA 4LLBA 4O64A 2VJEA 4P5OB 3U5OA 1WEWA 1WEOA 4PPEA 2LV9A 1G25A 4YATA 1WESA 5H9MA 4I7DA 1WEVA 3EB5A 2YU4A 1XWHA 1JOCA 3M62A 4B7YC 5LKTA 4A4BA 1JM7B 3EB6A 2VJEB 3PUQA 3U5MA 3T7LA 2FUIA 2OXQC 2LXHC 3QZVA 2D8SA 2VNFA 4F52B 2MT5A 5FEYA 3SOXA 3ZYQA 5H1UA 2ECWA 4MSXA
chains in the Genus database with same CATH superfamily
4R8PK 2JM3A 2D8UA 4FO9A 4FK5A 4GB0A 5TABA 1E4UA 3L11A 2FSAA 1WE9A 4H9DA 1N87A 5C11A 2CRWA 2L0BA 3M63A 4S3OC 2K1JA 2JMDA 3DDTA 2FD4A 5FB1A 3HCSA 3HTKC 4N3WA 2E6RA 4GNFA 3PURA 1DCQA 4YBSA 4QF2A 3ZPVE 3NG2A 3N9NA 4I7CA 1V87A 3M99A 1DVPA 2KGIA 1VD4A 2MKEA 2YW8A 1WEQA 1HYJA 4WZ2A 2HYED 3T6RA 4AVXA 1MM2A 5TRBA 3N9QA 2FUUA 4IC3A 3O70A 1WFKA 2Y43A 3ZVZB 4CA1A 1X4JA 4YABA 2VP7A 4S3OB 3E2DA 2LGVA 4QQ4A 4UP5A 5AITA 2YREA 1X4IA 2KFTA 2KR4A 5H1VA 5G05B 3RPGC 5B76A 2CKLA 3T9KA 4BBQA 3LQIA 3O36A 5K3QA 2C2LA 3LJUX 1HYIA 2MNYA 5B77A 2LGLA 3JUEA 4LKAA 1LDKC 4L58A 2E61A 4CCGX 2VPDA 2YURA 2QICA 2CKLB 2CT2A 5LKZA 4F1PA 5LCWB 4PTBA 5TDWA 2KREA 2LXPC 2RR4A 4ZQLA 4O62A 3VK6A 3O35A 2LDRA 4GNEA 2M13A 3N9MA 3FAOA 2CRRA 2F6JA 2KGGA 2MD8C 5J3XA 1WILA 2XOCA 3PLWA 4N4FA 3C6WA 3LQJA 4X3GA 4I7BA 5SVIA 3FEHA 5D1LB 2ECJA 4V3LC 3N9PA 2EXUA 5B8DA 2AN6A 2IDAA 3O7AA 4MVTA 2QIZA 3KV6A 4YBTA 2KIZA 2EODA 1FBVA 5JG6A 4OGCA 2ECIA 4YC9A 2YUCA 5SVIB 2YSJA 4FJCA 3H7HA 3KQIA 3O37A 2CSVA 2EGPA 2JMIA 5AIUA 1VYXA 3FL2A 2CSYA 2IQJA 1K2FA 4UP0A 2BAYA 3HCUA 5DINA 1WENA 2NAAA 2G45A 5TBNA 4Z0RA 2Y1NA 2ECVA 4XI1A 2ECTA 2UZGA 2CSZA 1WEPA 5DKAA 4W4UA 1RMDA 3LQHA 3DWDA 4A4CA 3C5KA 1WEUA 2M3HA 2JRJA 4LK9A 1VFYA 1F62A 2G43A 3LDYA 1BORA 3L1ZB 2I50A 5EYAF 2L75A 2XOYA 3IHPA 4AYCA 2VPEA 3HCTA 2HDPA 2KYUA 4A0CD 4GNGA 3I2DA 2KKYA 3N9OA 3LRQA 2LN0A 2OWAA 4C9ZA 2ECNA 2G6QA 5H1TA 3ZPV1 2F6NA 3LVQE 2K17A 4AYCB 2YQMA 3GL6A 5KH7A 5KH3A 4TKPB 2LQ6A 1WEEA 4YAXA 3FJUB 3KDEC 5B79A 2DSMA 3MHSA 2M85A 5SVXA 2MUMA 2K4DA 3ZVYA 3GV4A 3RPGB 3ASLA 2LGGA 2L7PA 2VPGA 5TDRA 4B86C 1Z2QA 2MNZA 4FIPA 4YADA 4UI9B 2XOZA 3SUBA 2CONA 5FB0A 2M6MA 4LADB 5I3LA 2K16A 4NN2A 1MM3A 3FANA 4R7EA 4OGEA 5KH9A 2EA6A 2YVRA 2RSDA 5G04B 2RI7A 3FM8C 2M1RA 1ZBDB 2KWJA 2C2VS 1CHCA 2MA6A 1LDJB 4A49A 2XB1A 2DX8A 3KNVA 1U6GB 4ZDTA 2H0DA 5G0FA 3RTRB 4IC2A 2KWNA 4AUQB 2KU3A 2KWKA 3O34A 3N9LA 4BHWA 3U5PA 5LKUA 1FP0A 3U5NA 2PNXA 2YQLA 4V3KC 4L7XA 4YBMA 2YSMA 3M7KA 5B75A 2H0DB 2YHOA 2F42A 3Q1DA 4WZ3B 5SVYA 2KE1A 1Z60A 2JUNA 2L5UA 4Z0OA 3O33A 2YT5A 2KKXA 4ZUXU 3MDBC 3SOWA 2XEUA 4GNDA 3O47A 2MD7B 2YYRA 1T1HA 4QF3A 5D1KB 4AP4A 2LRIC 3ZTGA 1WEMA 2KWOA 5B78A 3ZNIA 2E6SA 4LJNA 5C13A 2L80A 3SOUA 2YHNA 3DQVR 4Q6FA 3L1XA 2Y1MA 3MHHA 1IYMA 4R2YA 2PUYA 3DPLR 5FERA 4WZ0A 3SHBA 2JMJA 1WGMA 2LGKA 2FFWA 2VJFA 1Z6UA 2MA5A 5LKXA 2DJAA 3KV5A 2XP0A 1X4UA 3PHDA 2MIQA 2L43A 4WA6A 2QJ0A 2ZETC 1WIMA 3V43A 5D1MB 2VJFB 2VPBA 1JM7A 2ECGA 4LLBA 4O64A 2VJEA 4P5OB 3U5OA 1WEWA 1WEOA 4PPEA 2LV9A 1G25A 4YATA 1WESA 5H9MA 4I7DA 1WEVA 3EB5A 2YU4A 1XWHA 1JOCA 3M62A 4B7YC 5LKTA 4A4BA 1JM7B 3EB6A 2VJEB 3PUQA 3U5MA 3T7LA 2LAUA 2FUIA 2B0OE 2OXQC 3LVRE 2LXHC 2P57A 3QZVA 2D8SA 2EGMA 2VNFA 1MBMA 4F52B 2MT5A 5FEYA 3SOXA 3ZYQA 5H1UA 2ECWA 4MSXA
chains in the Genus database with same CATH topology
4R8PK 4FO9A 4FK5A 4GB0A 5TABA 1E4UA 3L11A 2FSAA 1WE9A 1N87A 5C11A 2L0BA 3M63A 4S3OC 2K1JA 2JMDA 5FB1A 3HCSA 3HTKC 4N3WA 2E6RA 4GNFA 3PURA 4YBSA 4QF2A 3ZPVE 3NG2A 3N9NA 4I7CA 1V87A 3M99A 1DVPA 2KGIA 1VD4A 2YW8A 1WEQA 1HYJA 4WZ2A 2HYED 3T6RA 4AVXA 1MM2A 5TRBA 3N9QA 2FUUA 4IC3A 3O70A 1WFKA 2Y43A 3ZVZB 4CA1A 1X4JA 4YABA 2VP7A 4S3OB 2LGVA 4UP5A 5AITA 2YREA 1X4IA 2KFTA 2KR4A 5H1VA 5G05B 3RPGC 5B76A 2CKLA 4BBQA 3LQIA 3O36A 2C2LA 1HYIA 2MNYA 5B77A 2LGLA 4LKAA 1LDKC 4L58A 4CCGX 2VPDA 2YURA 2QICA 2CKLB 2CT2A 5LKZA 5LCWB 4PTBA 5TDWA 2KREA 2LXPC 4ZQLA 3VK6A 3O35A 2LDRA 4GNEA 3N9MA 2F6JA 2KGGA 2MD8C 5J3XA 1WILA 4N4FA 3C6WA 3LQJA 4X3GA 4I7BA 5D1LB 2ECJA 4V3LC 3N9PA 5B8DA 2AN6A 2IDAA 3O7AA 4MVTA 2QIZA 3KV6A 4YBTA 2KIZA 2EODA 1FBVA 5JG6A 2ECIA 4YC9A 2YUCA 2YSJA 4FJCA 3KQIA 3O37A 2EGPA 2JMIA 5AIUA 1VYXA 3FL2A 2CSYA 1K2FA 4UP0A 2BAYA 3HCUA 5DINA 1WENA 2NAAA 2G45A 5TBNA 2Y1NA 2ECVA 4XI1A 2ECTA 2UZGA 2CSZA 1WEPA 5DKAA 4W4UA 1RMDA 3LQHA 4A4CA 3C5KA 1WEUA 2M3HA 2JRJA 4LK9A 1VFYA 1F62A 2G43A 1BORA 3L1ZB 2I50A 5EYAF 2L75A 3IHPA 4AYCA 2VPEA 3HCTA 2HDPA 2KYUA 4A0CD 4GNGA 3I2DA 3N9OA 3LRQA 2LN0A 4C9ZA 2ECNA 2G6QA 5H1TA 3ZPV1 2F6NA 2K17A 4AYCB 2YQMA 3GL6A 5KH7A 5KH3A 4TKPB 2LQ6A 1WEEA 4YAXA 5B79A 3MHSA 2M85A 2MUMA 2K4DA 3ZVYA 3GV4A 3RPGB 3ASLA 2LGGA 4B86C 2VPGA 5TDRA 1Z2QA 2MNZA 4FIPA 4YADA 4UI9B 5FB0A 2M6MA 4LADB 5I3LA 2K16A 4NN2A 1MM3A 4R7EA 5KH9A 2EA6A 2RSDA 5G04B 2RI7A 2M1RA 1ZBDB 2KWJA 2C2VS 1CHCA 2MA6A 1LDJB 4A49A 2XB1A 2DX8A 3KNVA 1U6GB 4ZDTA 2H0DA 5G0FA 3RTRB 4IC2A 2KWNA 4AUQB 2KU3A 2KWKA 3O34A 3N9LA 4BHWA 3U5PA 5LKUA 1FP0A 3U5NA 2PNXA 2YQLA 4V3KC 4L7XA 4YBMA 2YSMA 5B75A 2H0DB 2YHOA 2F42A 4WZ3B 2KE1A 1Z60A 2L5UA 3O33A 2YT5A 4ZUXU 3SOWA 2XEUA 4GNDA 2MD7B 2YYRA 1T1HA 4QF3A 5D1KB 4AP4A 2LRIC 3ZTGA 1WEMA 2KWOA 5B78A 3ZNIA 2E6SA 4LJNA 5C13A 2L80A 3SOUA 2YHNA 3DQVR 4Q6FA 3L1XA 2Y1MA 3MHHA 1IYMA 4R2YA 2PUYA 3DPLR 5FERA 4WZ0A 3SHBA 2JMJA 1WGMA 2LGKA 2VJFA 1Z6UA 2MA5A 5LKXA 3KV5A 1X4UA 3PHDA 2MIQA 2L43A 4WA6A 2QJ0A 2ZETC 1WIMA 3V43A 5D1MB 2VJFB 2VPBA 1JM7A 2ECGA 4LLBA 4O64A 2VJEA 4P5OB 3U5OA 1WEWA 1WEOA 4PPEA 2LV9A 1G25A 4YATA 1WESA 5H9MA 4I7DA 1WEVA 3EB5A 2YU4A 1XWHA 1JOCA 3M62A 4B7YC 5LKTA 4A4BA 1JM7B 3EB6A 2VJEB 3PUQA 3U5MA 3T7LA 2FUIA 2OXQC 2LXHC 3QZVA 2D8SA 2VNFA 4F52B 2MT5A 5FEYA 3SOXA 3ZYQA 5H1UA 2ECWA 4MSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8P K;  4FO9 A;  4FK5 A;  4GB0 A;  5TAB A;  1E4U A;  3L11 A;  2FSA A;  1WE9 A;  1N87 A;  5C11 A;  2L0B A;  3M63 A;  4S3O C;  2K1J A;  2JMD A;  5FB1 A;  3HCS A;  3HTK C;  4N3W A;  2E6R A;  4GNF A;  3PUR A;  4YBS A;  4QF2 A;  3ZPV E;  3NG2 A;  3N9N A;  4I7C A;  1V87 A;  3M99 A;  1DVP A;  2KGI A;  1VD4 A;  2YW8 A;  1WEQ A;  1HYJ A;  4WZ2 A;  2HYE D;  3T6R A;  4AVX A;  1MM2 A;  5TRB A;  3N9Q A;  2FUU A;  4IC3 A;  3O70 A;  1WFK A;  2Y43 A;  3ZVZ B;  4CA1 A;  1X4J A;  4YAB A;  2VP7 A;  4S3O B;  2LGV A;  4UP5 A;  5AIT A;  2YRE A;  1X4I A;  2KFT A;  2KR4 A;  5H1V A;  5G05 B;  3RPG C;  5B76 A;  2CKL A;  4BBQ A;  3LQI A;  3O36 A;  2C2L A;  1HYI A;  2MNY A;  5B77 A;  2LGL A;  4LKA A;  1LDK C;  4L58 A;  4CCG X;  2VPD A;  2YUR A;  2QIC A;  2CKL B;  2CT2 A;  5LKZ A;  5LCW B;  4PTB A;  5TDW A;  2KRE A;  2LXP C;  4ZQL A;  3VK6 A;  3O35 A;  2LDR A;  4GNE A;  3N9M A;  2F6J A;  2KGG A;  2MD8 C;  5J3X A;  1WIL A;  4N4F A;  3C6W A;  3LQJ A;  4X3G A;  4I7B A;  5D1L B;  2ECJ A;  4V3L C;  3N9P A;  5B8D A;  2AN6 A;  2IDA A;  3O7A A;  4MVT A;  2QIZ A;  3KV6 A;  4YBT A;  2KIZ A;  2EOD A;  1FBV A;  5JG6 A;  2ECI A;  4YC9 A;  2YUC A;  2YSJ A;  4FJC A;  3KQI A;  3O37 A;  2EGP A;  2JMI A;  5AIU A;  1VYX A;  3FL2 A;  2CSY A;  1K2F A;  4UP0 A;  2BAY A;  3HCU A;  5DIN A;  1WEN A;  2NAA A;  2G45 A;  5TBN A;  2Y1N A;  2ECV A;  4XI1 A;  2ECT A;  2UZG A;  2CSZ A;  1WEP A;  5DKA A;  4W4U A;  1RMD A;  3LQH A;  4A4C A;  3C5K A;  1WEU A;  2M3H A;  2JRJ A;  4LK9 A;  1VFY A;  1F62 A;  2G43 A;  1BOR A;  3L1Z B;  2I50 A;  5EYA F;  2L75 A;  3IHP A;  4AYC A;  2VPE A;  3HCT A;  2HDP A;  2KYU A;  4A0C D;  4GNG A;  3I2D A;  3N9O A;  3LRQ A;  2LN0 A;  4C9Z A;  2ECN A;  2G6Q A;  5H1T A;  3ZPV 1;  2F6N A;  2K17 A;  4AYC B;  2YQM A;  3GL6 A;  5KH7 A;  5KH3 A;  4TKP B;  2LQ6 A;  1WEE A;  4YAX A;  5B79 A;  3MHS A;  2M85 A;  2MUM A;  2K4D A;  3ZVY A;  3GV4 A;  3RPG B;  3ASL A;  2LGG A;  4B86 C;  2VPG A;  5TDR A;  1Z2Q A;  2MNZ A;  4FIP A;  4YAD A;  4UI9 B;  5FB0 A;  2M6M A;  4LAD B;  5I3L A;  2K16 A;  4NN2 A;  1MM3 A;  4R7E A;  5KH9 A;  2EA6 A;  2RSD A;  5G04 B;  2RI7 A;  2M1R A;  1ZBD B;  2KWJ A;  2C2V S;  1CHC A;  2MA6 A;  1LDJ B;  4A49 A;  2XB1 A;  2DX8 A;  3KNV A;  1U6G B;  4ZDT A;  2H0D A;  5G0F A;  3RTR B;  4IC2 A;  2KWN A;  4AUQ B;  2KU3 A;  2KWK A;  3O34 A;  3N9L A;  4BHW A;  3U5P A;  5LKU A;  1FP0 A;  3U5N A;  2PNX A;  2YQL A;  4V3K C;  4L7X A;  4YBM A;  2YSM A;  5B75 A;  2H0D B;  2YHO A;  2F42 A;  4WZ3 B;  2KE1 A;  1Z60 A;  2L5U A;  3O33 A;  2YT5 A;  4ZUX U;  3SOW A;  2XEU A;  4GND A;  2MD7 B;  2YYR A;  1T1H A;  4QF3 A;  5D1K B;  4AP4 A;  2LRI C;  3ZTG A;  1WEM A;  2KWO A;  5B78 A;  3ZNI A;  2E6S A;  4LJN A;  5C13 A;  2L80 A;  3SOU A;  2YHN A;  3DQV R;  4Q6F A;  3L1X A;  2Y1M A;  3MHH A;  1IYM A;  4R2Y A;  2PUY A;  3DPL R;  5FER A;  4WZ0 A;  3SHB A;  2JMJ A;  1WGM A;  2LGK A;  2VJF A;  1Z6U A;  2MA5 A;  5LKX A;  3KV5 A;  1X4U A;  3PHD A;  2MIQ A;  2L43 A;  4WA6 A;  2QJ0 A;  2ZET C;  1WIM A;  3V43 A;  5D1M B;  2VJF B;  2VPB A;  1JM7 A;  2ECG A;  4LLB A;  4O64 A;  2VJE A;  4P5O B;  3U5O A;  1WEW A;  1WEO A;  4PPE A;  2LV9 A;  1G25 A;  4YAT A;  1WES A;  5H9M A;  4I7D A;  1WEV A;  3EB5 A;  2YU4 A;  1XWH A;  1JOC A;  3M62 A;  4B7Y C;  5LKT A;  4A4B A;  1JM7 B;  3EB6 A;  2VJE B;  3PUQ A;  3U5M A;  3T7L A;  2FUI A;  2OXQ C;  2LXH C;  3QZV A;  2D8S A;  2VNF A;  4F52 B;  2MT5 A;  5FEY A;  3SOX A;  3ZYQ A;  5H1U A;  2ECW A;  4MSX A; 
#chains in the Genus database with same CATH topology
 4R8P K;  2JM3 A;  2D8U A;  4FO9 A;  4FK5 A;  4GB0 A;  5TAB A;  1E4U A;  3L11 A;  2FSA A;  1WE9 A;  4H9D A;  1N87 A;  5C11 A;  2CRW A;  2L0B A;  3M63 A;  4S3O C;  2K1J A;  2JMD A;  3DDT A;  2FD4 A;  5FB1 A;  3HCS A;  3HTK C;  4N3W A;  2E6R A;  4GNF A;  3PUR A;  1DCQ A;  4YBS A;  4QF2 A;  3ZPV E;  3NG2 A;  3N9N A;  4I7C A;  1V87 A;  3M99 A;  1DVP A;  2KGI A;  1VD4 A;  2MKE A;  2YW8 A;  1WEQ A;  1HYJ A;  4WZ2 A;  2HYE D;  3T6R A;  4AVX A;  1MM2 A;  5TRB A;  3N9Q A;  2FUU A;  4IC3 A;  3O70 A;  1WFK A;  2Y43 A;  3ZVZ B;  4CA1 A;  1X4J A;  4YAB A;  2VP7 A;  4S3O B;  3E2D A;  2LGV A;  4QQ4 A;  4UP5 A;  5AIT A;  2YRE A;  1X4I A;  2KFT A;  2KR4 A;  5H1V A;  5G05 B;  3RPG C;  5B76 A;  2CKL A;  3T9K A;  4BBQ A;  3LQI A;  3O36 A;  5K3Q A;  2C2L A;  3LJU X;  1HYI A;  2MNY A;  5B77 A;  2LGL A;  3JUE A;  4LKA A;  1LDK C;  4L58 A;  2E61 A;  4CCG X;  2VPD A;  2YUR A;  2QIC A;  2CKL B;  2CT2 A;  5LKZ A;  4F1P A;  5LCW B;  4PTB A;  5TDW A;  2KRE A;  2LXP C;  2RR4 A;  4ZQL A;  4O62 A;  3VK6 A;  3O35 A;  2LDR A;  4GNE A;  2M13 A;  3N9M A;  3FAO A;  2CRR A;  2F6J A;  2KGG A;  2MD8 C;  5J3X A;  1WIL A;  2XOC A;  3PLW A;  4N4F A;  3C6W A;  3LQJ A;  4X3G A;  4I7B A;  5SVI A;  3FEH A;  5D1L B;  2ECJ A;  4V3L C;  3N9P A;  2EXU A;  5B8D A;  2AN6 A;  2IDA A;  3O7A A;  4MVT A;  2QIZ A;  3KV6 A;  4YBT A;  2KIZ A;  2EOD A;  1FBV A;  5JG6 A;  4OGC A;  2ECI A;  4YC9 A;  2YUC A;  5SVI B;  2YSJ A;  4FJC A;  3H7H A;  3KQI A;  3O37 A;  2CSV A;  2EGP A;  2JMI A;  5AIU A;  1VYX A;  3FL2 A;  2CSY A;  2IQJ A;  1K2F A;  4UP0 A;  2BAY A;  3HCU A;  5DIN A;  1WEN A;  2NAA A;  2G45 A;  5TBN A;  4Z0R A;  2Y1N A;  2ECV A;  4XI1 A;  2ECT A;  2UZG A;  2CSZ A;  1WEP A;  5DKA A;  4W4U A;  1RMD A;  3LQH A;  3DWD A;  4A4C A;  3C5K A;  1WEU A;  2M3H A;  2JRJ A;  4LK9 A;  1VFY A;  1F62 A;  2G43 A;  3LDY A;  1BOR A;  3L1Z B;  2I50 A;  5EYA F;  2L75 A;  2XOY A;  3IHP A;  4AYC A;  2VPE A;  3HCT A;  2HDP A;  2KYU A;  4A0C D;  4GNG A;  3I2D A;  2KKY A;  3N9O A;  3LRQ A;  2LN0 A;  2OWA A;  4C9Z A;  2ECN A;  2G6Q A;  5H1T A;  3ZPV 1;  2F6N A;  3LVQ E;  2K17 A;  4AYC B;  2YQM A;  3GL6 A;  5KH7 A;  5KH3 A;  4TKP B;  2LQ6 A;  1WEE A;  4YAX A;  3FJU B;  3KDE C;  5B79 A;  2DSM A;  3MHS A;  2M85 A;  5SVX A;  2MUM A;  2K4D A;  3ZVY A;  3GV4 A;  3RPG B;  3ASL A;  2LGG A;  2L7P A;  2VPG A;  5TDR A;  4B86 C;  1Z2Q A;  2MNZ A;  4FIP A;  4YAD A;  4UI9 B;  2XOZ A;  3SUB A;  2CON A;  5FB0 A;  2M6M A;  4LAD B;  5I3L A;  2K16 A;  4NN2 A;  1MM3 A;  3FAN A;  4R7E A;  4OGE A;  5KH9 A;  2EA6 A;  2YVR A;  2RSD A;  5G04 B;  2RI7 A;  3FM8 C;  2M1R A;  1ZBD B;  2KWJ A;  2C2V S;  1CHC A;  2MA6 A;  1LDJ B;  4A49 A;  2XB1 A;  2DX8 A;  3KNV A;  1U6G B;  4ZDT A;  2H0D A;  5G0F A;  3RTR B;  4IC2 A;  2KWN A;  4AUQ B;  2KU3 A;  2KWK A;  3O34 A;  3N9L A;  4BHW A;  3U5P A;  5LKU A;  1FP0 A;  3U5N A;  2PNX A;  2YQL A;  4V3K C;  4L7X A;  4YBM A;  2YSM A;  3M7K A;  5B75 A;  2H0D B;  2YHO A;  2F42 A;  3Q1D A;  4WZ3 B;  5SVY A;  2KE1 A;  1Z60 A;  2JUN A;  2L5U A;  4Z0O A;  3O33 A;  2YT5 A;  2KKX A;  4ZUX U;  3MDB C;  3SOW A;  2XEU A;  4GND A;  3O47 A;  2MD7 B;  2YYR A;  1T1H A;  4QF3 A;  5D1K B;  4AP4 A;  2LRI C;  3ZTG A;  1WEM A;  2KWO A;  5B78 A;  3ZNI A;  2E6S A;  4LJN A;  5C13 A;  2L80 A;  3SOU A;  2YHN A;  3DQV R;  4Q6F A;  3L1X A;  2Y1M A;  3MHH A;  1IYM A;  4R2Y A;  2PUY A;  3DPL R;  5FER A;  4WZ0 A;  3SHB A;  2JMJ A;  1WGM A;  2LGK A;  2FFW A;  2VJF A;  1Z6U A;  2MA5 A;  5LKX A;  2DJA A;  3KV5 A;  2XP0 A;  1X4U A;  3PHD A;  2MIQ A;  2L43 A;  4WA6 A;  2QJ0 A;  2ZET C;  1WIM A;  3V43 A;  5D1M B;  2VJF B;  2VPB A;  1JM7 A;  2ECG A;  4LLB A;  4O64 A;  2VJE A;  4P5O B;  3U5O A;  1WEW A;  1WEO A;  4PPE A;  2LV9 A;  1G25 A;  4YAT A;  1WES A;  5H9M A;  4I7D A;  1WEV A;  3EB5 A;  2YU4 A;  1XWH A;  1JOC A;  3M62 A;  4B7Y C;  5LKT A;  4A4B A;  1JM7 B;  3EB6 A;  2VJE B;  3PUQ A;  3U5M A;  3T7L A;  2LAU A;  2FUI A;  2B0O E;  2OXQ C;  3LVR E;  2LXH C;  2P57 A;  3QZV A;  2D8S A;  2EGM A;  2VNF A;  1MBM A;  4F52 B;  2MT5 A;  5FEY A;  3SOX A;  3ZYQ A;  5H1U A;  2ECW A;  4MSX A; 
#chains in the Genus database with same CATH homology
 4R8P K;  4FO9 A;  4FK5 A;  4GB0 A;  5TAB A;  1E4U A;  3L11 A;  2FSA A;  1WE9 A;  1N87 A;  5C11 A;  2L0B A;  3M63 A;  4S3O C;  2K1J A;  2JMD A;  5FB1 A;  3HCS A;  3HTK C;  4N3W A;  2E6R A;  4GNF A;  3PUR A;  4YBS A;  4QF2 A;  3ZPV E;  3NG2 A;  3N9N A;  4I7C A;  1V87 A;  3M99 A;  1DVP A;  2KGI A;  1VD4 A;  2YW8 A;  1WEQ A;  1HYJ A;  4WZ2 A;  2HYE D;  3T6R A;  4AVX A;  1MM2 A;  5TRB A;  3N9Q A;  2FUU A;  4IC3 A;  3O70 A;  1WFK A;  2Y43 A;  3ZVZ B;  4CA1 A;  1X4J A;  4YAB A;  2VP7 A;  4S3O B;  2LGV A;  4UP5 A;  5AIT A;  2YRE A;  1X4I A;  2KFT A;  2KR4 A;  5H1V A;  5G05 B;  3RPG C;  5B76 A;  2CKL A;  4BBQ A;  3LQI A;  3O36 A;  2C2L A;  1HYI A;  2MNY A;  5B77 A;  2LGL A;  4LKA A;  1LDK C;  4L58 A;  4CCG X;  2VPD A;  2YUR A;  2QIC A;  2CKL B;  2CT2 A;  5LKZ A;  5LCW B;  4PTB A;  5TDW A;  2KRE A;  2LXP C;  4ZQL A;  3VK6 A;  3O35 A;  2LDR A;  4GNE A;  3N9M A;  2F6J A;  2KGG A;  2MD8 C;  5J3X A;  1WIL A;  4N4F A;  3C6W A;  3LQJ A;  4X3G A;  4I7B A;  5D1L B;  2ECJ A;  4V3L C;  3N9P A;  5B8D A;  2AN6 A;  2IDA A;  3O7A A;  4MVT A;  2QIZ A;  3KV6 A;  4YBT A;  2KIZ A;  2EOD A;  1FBV A;  5JG6 A;  2ECI A;  4YC9 A;  2YUC A;  2YSJ A;  4FJC A;  3KQI A;  3O37 A;  2EGP A;  2JMI A;  5AIU A;  1VYX A;  3FL2 A;  2CSY A;  1K2F A;  4UP0 A;  2BAY A;  3HCU A;  5DIN A;  1WEN A;  2NAA A;  2G45 A;  5TBN A;  2Y1N A;  2ECV A;  4XI1 A;  2ECT A;  2UZG A;  2CSZ A;  1WEP A;  5DKA A;  4W4U A;  1RMD A;  3LQH A;  4A4C A;  3C5K A;  1WEU A;  2M3H A;  2JRJ A;  4LK9 A;  1VFY A;  1F62 A;  2G43 A;  1BOR A;  3L1Z B;  2I50 A;  5EYA F;  2L75 A;  3IHP A;  4AYC A;  2VPE A;  3HCT A;  2HDP A;  2KYU A;  4A0C D;  4GNG A;  3I2D A;  3N9O A;  3LRQ A;  2LN0 A;  4C9Z A;  2ECN A;  2G6Q A;  5H1T A;  3ZPV 1;  2F6N A;  2K17 A;  4AYC B;  2YQM A;  3GL6 A;  5KH7 A;  5KH3 A;  4TKP B;  2LQ6 A;  1WEE A;  4YAX A;  5B79 A;  3MHS A;  2M85 A;  2MUM A;  2K4D A;  3ZVY A;  3GV4 A;  3RPG B;  3ASL A;  2LGG A;  4B86 C;  2VPG A;  5TDR A;  1Z2Q A;  2MNZ A;  4FIP A;  4YAD A;  4UI9 B;  5FB0 A;  2M6M A;  4LAD B;  5I3L A;  2K16 A;  4NN2 A;  1MM3 A;  4R7E A;  5KH9 A;  2EA6 A;  2RSD A;  5G04 B;  2RI7 A;  2M1R A;  1ZBD B;  2KWJ A;  2C2V S;  1CHC A;  2MA6 A;  1LDJ B;  4A49 A;  2XB1 A;  2DX8 A;  3KNV A;  1U6G B;  4ZDT A;  2H0D A;  5G0F A;  3RTR B;  4IC2 A;  2KWN A;  4AUQ B;  2KU3 A;  2KWK A;  3O34 A;  3N9L A;  4BHW A;  3U5P A;  5LKU A;  1FP0 A;  3U5N A;  2PNX A;  2YQL A;  4V3K C;  4L7X A;  4YBM A;  2YSM A;  5B75 A;  2H0D B;  2YHO A;  2F42 A;  4WZ3 B;  2KE1 A;  1Z60 A;  2L5U A;  3O33 A;  2YT5 A;  4ZUX U;  3SOW A;  2XEU A;  4GND A;  2MD7 B;  2YYR A;  1T1H A;  4QF3 A;  5D1K B;  4AP4 A;  2LRI C;  3ZTG A;  1WEM A;  2KWO A;  5B78 A;  3ZNI A;  2E6S A;  4LJN A;  5C13 A;  2L80 A;  3SOU A;  2YHN A;  3DQV R;  4Q6F A;  3L1X A;  2Y1M A;  3MHH A;  1IYM A;  4R2Y A;  2PUY A;  3DPL R;  5FER A;  4WZ0 A;  3SHB A;  2JMJ A;  1WGM A;  2LGK A;  2VJF A;  1Z6U A;  2MA5 A;  5LKX A;  3KV5 A;  1X4U A;  3PHD A;  2MIQ A;  2L43 A;  4WA6 A;  2QJ0 A;  2ZET C;  1WIM A;  3V43 A;  5D1M B;  2VJF B;  2VPB A;  1JM7 A;  2ECG A;  4LLB A;  4O64 A;  2VJE A;  4P5O B;  3U5O A;  1WEW A;  1WEO A;  4PPE A;  2LV9 A;  1G25 A;  4YAT A;  1WES A;  5H9M A;  4I7D A;  1WEV A;  3EB5 A;  2YU4 A;  1XWH A;  1JOC A;  3M62 A;  4B7Y C;  5LKT A;  4A4B A;  1JM7 B;  3EB6 A;  2VJE B;  3PUQ A;  3U5M A;  3T7L A;  2FUI A;  2OXQ C;  2LXH C;  3QZV A;  2D8S A;  2VNF A;  4F52 B;  2MT5 A;  5FEY A;  3SOX A;  3ZYQ A;  5H1U A;  2ECW A;  4MSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...