3T6RA

Structure of uhrf1 in complex with unmodified h3 n-terminal tail
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
APEFGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title UHRF1 double tudor domain and the adjacent PHD finger act together to recognize K9me3-containing histone H3 tail
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase UHRF1
total genus 10
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3t6rA00
2HDPA 5DKAA 2OXQC 5FB1A 1JOCA 4QF2A 1MM2A 2QJ0A 2LXPC 2G6QA 4L58A 2F6JA 1T1HA 2Y43A 3KV6A 2VP7A 5FERA 3RTRB 2YT5A 2H0DB 1WEPA 5LCWB 4YBMA 4N4FA 1WEOA 4IC2A 3M63A 3KNVA 3LQHA 2C2VS 1WEMA 4CA1A 3V43A 5H1UA 3N9PA 2EODA 3U5PA 2MNZA 2KU3A 2EA6A 5EYAF 4A0CD 2IDAA 2XEUA 3LQIA 4I7CA 2JRJA 3N9MA 2JMIA 4S3OB 2ECJA 4LADB 4FO9A 3U5NA 4V3LC 2YHOA 3C5KA 3ZYQA 4BBQA 2KWOA 2LGVA 5TRBA 4UI9B 2L0BA 3RPGC 1WEWA 2YHNA 4GNGA 5D1KB 4F52B 3IHPA 5FEYA 2MIQA 2KE1A 2LRIC 2YREA 1WEQA 4FIPA 3EB5A 5KH3A 5LKXA 5B79A 2YUCA 2CSYA 4B7YC 4YAXA 4WA6A 4UP5A 3ZPVE 4S3OC 5B78A 3M99A 5G05B 2ECTA 3VK6A 2MNYA 2LDRA 2L43A 3GL6A 5AIUA 2CKLB 2LXHC 2VPBA 4ZDTA 2KREA 5B8DA 4GNFA 2D8SA 1WEEA 1VD4A 3KV5A 1X4UA 3ZTGA 3U5MA 2ECWA 1N87A 3MHHA 3SOUA 3L11A 3GV4A 4AYCB 3DQVR 4N3WA 2PUYA 3L1ZB 3FL2A 1U6GB 2CSZA 3L1XA 3PURA 2ECVA 1F62A 4LJNA 2Y1NA 2MA6A 5H1TA 2RI7A 2YQLA 4XI1A 3N9OA 4AP4A 4C9ZA 4WZ2A 1HYJA 4GNDA 2AN6A 2M6MA 5TBNA 3N9LA 2CKLA 1WE9A 5LKUA 5TDRA 2RSDA 4YADA 1CHCA 2LGKA 3RPGB 4LLBA 1JM7B 4AYCA 2QIZA 3SOWA 4R8PK 4R2YA 4FJCA 4I7BA 4MSXA 1WEVA 2VPGA 5TABA 5FB0A 4BHWA 5TDWA 5B77A 2M85A 5LKZA 4AUQB 4Q6FA 3O34A 3SOXA 2E6RA 4GNEA 3LQJA 2MA5A 4ZQLA 4NN2A 2VJEB 5DINA 2C2LA 2VJFA 3SHBA 2G43A 4A4CA 2KGGA 5H1VA 3T7LA 3EB6A 3ZVYA 1VYXA 4GB0A 3QZVA 2MD8C 3HCSA 5D1LB 3HCTA 4V3KC 3N9NA 1WILA 5G0FA 2KWKA 1Z60A 2LGGA 2G45A 2F6NA 2UZGA 3KQIA 2YURA 3ZNIA 3C6WA 3LRQA 2JMJA 2ECIA 2KR4A 2QICA 2KFTA 4WZ0A 2VNFA 3O7AA 5D1MB 2JMDA 2K4DA 1E4UA 3NG2A 3MHSA 2E6SA 4R7EA 4WZ3B 1X4IA 4TKPB 2M1RA 1LDJB 4O64A 4A4BA 3ASLA 1Z2QA 4YBTA 4MVTA 4L7XA 5C13A 2YSMA 2VPEA 1WFKA 2F42A 2YU4A 4YBSA 5I3LA 1XWHA 4PPEA 2K16A 3O37A 2M3HA 2FUUA 3N9QA 1WESA 2KYUA 2NAAA 4UP0A 3O36A 2MUMA 4W4UA 3ZPV1 2MD7B 2FSAA 1WIMA 2BAYA 1FP0A 2H0DA 5J3XA 2L80A 2YW8A 1Z6UA 2HYED 2VJEA 3HTKC 1IYMA 1V87A 2KWNA 5H9MA 2L5UA 4LK9A 4LKAA 4AVXA 4A49A 5AITA 1BORA 2Y1MA 4YABA 2K1JA 1WEUA 5KH7A 4ZUXU 2FUIA 2PNXA 2VPDA 1JM7A 4CCGX 3HCUA 2I50A 3PUQA 3O70A 2LN0A 1MM3A 3PHDA 1WGMA 5B75A 4X3GA 1WENA 2LQ6A 4QF3A 2MT5A 2KWJA 2CT2A 2YYRA 4B86C 1RMDA 2YQMA 1X4JA 5KH9A 5C11A 4PTBA 5G04B 4P5OB 4I7DA 3O33A 2YSJA 1LDKC 3T6RA 2LV9A 2KGIA 3DPLR 2XB1A 2ZETC 3ZVZB 2ECGA 4YC9A 2KIZA 5B76A 3M62A 1FBVA 3I2DA 4YATA 1HYIA 2DX8A 2K17A 4IC3A 1ZBDB 5JG6A 2EGPA 1DVPA 2ECNA 3O35A 5LKTA 2VJFB 4FK5A 2L75A 3U5OA 2LGLA 1VFYA 1G25A 1K2FA
chains in the Genus database with same CATH superfamily
2HDPA 5DKAA 2OXQC 5FB1A 1JOCA 4QF2A 1MM2A 2QJ0A 2LXPC 2G6QA 4OGEA 4L58A 3DDTA 3LDYA 2F6JA 1T1HA 2Y43A 3KV6A 2VP7A 5FERA 3RTRB 2YT5A 2H0DB 1WEPA 5LCWB 4YBMA 2OWAA 2E61A 4N4FA 1WEOA 4IC2A 3M63A 3KNVA 3LQHA 2C2VS 1WEMA 2DJAA 4CA1A 3V43A 5H1UA 3N9PA 2EODA 3U5PA 2MNZA 2KU3A 2EA6A 5EYAF 4A0CD 3FEHA 2IDAA 2XEUA 3LQIA 4I7CA 2JRJA 3N9MA 2JMIA 3JUEA 4S3OB 2ECJA 4LADB 3FM8C 2FFWA 4FO9A 2B0OE 4H9DA 3U5NA 4V3LC 2YHOA 3C5KA 3ZYQA 4BBQA 2KWOA 2LGVA 5TRBA 4UI9B 2L0BA 3RPGC 3MDBC 1WEWA 2YHNA 4GNGA 5D1KB 4Z0RA 4F52B 3IHPA 5FEYA 2CONA 2MIQA 2KE1A 2LRIC 2YREA 1WEQA 4FIPA 2RR4A 3EB5A 5KH3A 5LKXA 2YUCA 5B79A 2CSYA 4B7YC 4YAXA 2KKXA 4WA6A 4UP5A 3ZPVE 4S3OC 5B78A 3FJUB 3M99A 5G05B 2ECTA 1DCQA 3VK6A 2MNYA 2LDRA 2L43A 3GL6A 5AIUA 3T9KA 3LVQE 2CKLB 2D8UA 2LXHC 2VPBA 2KREA 4ZDTA 5B8DA 4GNFA 2D8SA 1WEEA 1VD4A 3KV5A 1X4UA 3ZTGA 3U5MA 2ECWA 4F1PA 1N87A 3MHHA 3SOUA 3L11A 3GV4A 4AYCB 3DQVR 4N3WA 2PUYA 3L1ZB 3DWDA 3FL2A 1U6GB 2CSZA 3L1XA 3PURA 2ECVA 2KKYA 1F62A 4LJNA 2Y1NA 2MA6A 5H1TA 2RI7A 2MKEA 2YQLA 4XI1A 3KDEC 2JUNA 3N9OA 4AP4A 2YVRA 4WZ2A 4C9ZA 1HYJA 4GNDA 2AN6A 2M6MA 5TBNA 3N9LA 2CKLA 1WE9A 5LKUA 3H7HA 5TDRA 2RSDA 4YADA 3SUBA 1CHCA 2LGKA 3RPGB 4LLBA 4Z0OA 1JM7B 4AYCA 2QIZA 3SOWA 5SVYA 4R8PK 2M13A 4R2YA 4FJCA 4I7BA 4MSXA 1WEVA 2VPGA 5TABA 5FB0A 4BHWA 5TDWA 5B77A 2M85A 5LKZA 4Q6FA 4AUQB 3O34A 3SOXA 2E6RA 4GNEA 3LQJA 2MA5A 4ZQLA 4NN2A 2VJEB 5DINA 2C2LA 2VJFA 3SHBA 2G43A 4A4CA 2KGGA 2CRRA 5H1VA 3T7LA 2IQJA 3EB6A 3ZVYA 1VYXA 4GB0A 3QZVA 2MD8C 3HCSA 3Q1DA 5D1LB 3HCTA 5K3QA 4V3KC 3N9NA 1WILA 5SVIB 5G0FA 2KWKA 5SVXA 1Z60A 2LGGA 2FD4A 3E2DA 2G45A 2F6NA 2UZGA 3KQIA 3O47A 2YURA 3ZNIA 3C6WA 3LRQA 2JMJA 3FANA 2ECIA 2KR4A 2QICA 2EXUA 2KFTA 4WZ0A 2VNFA 2XOYA 3O7AA 5D1MB 3PLWA 2JMDA 2K4DA 1E4UA 3NG2A 3MHSA 2E6SA 4R7EA 4WZ3B 1X4IA 4TKPB 2M1RA 1LDJB 4O64A 4A4BA 3ASLA 1Z2QA 4YBTA 4MVTA 4L7XA 5C13A 2YSMA 2VPEA 1WFKA 2F42A 2YU4A 4YBSA 5I3LA 1XWHA 4PPEA 2K16A 3O37A 2M3HA 2FUUA 3N9QA 1WESA 2KYUA 5SVIA 2NAAA 4UP0A 3O36A 2MUMA 4W4UA 3M7KA 3ZPV1 2MD7B 2FSAA 1WIMA 2DSMA 2BAYA 1FP0A 2H0DA 5J3XA 2L80A 2YW8A 1Z6UA 2HYED 2VJEA 4QQ4A 2LAUA 3HTKC 1IYMA 1V87A 2KWNA 5H9MA 2L5UA 4LK9A 2P57A 4O62A 4LKAA 4AVXA 4A49A 5AITA 1BORA 2Y1MA 4YABA 2L7PA 2K1JA 2CSVA 1WEUA 5KH7A 4ZUXU 2FUIA 2PNXA 2VPDA 1JM7A 2XOZA 4CCGX 3HCUA 2I50A 3PUQA 3O70A 2LN0A 1MM3A 3PHDA 1WGMA 2JM3A 5B75A 4X3GA 1WENA 2LQ6A 3LVRE 4QF3A 2MT5A 2KWJA 2CT2A 2YYRA 4B86C 2XP0A 1RMDA 2YQMA 1X4JA 1MBMA 2CRWA 5KH9A 4PTBA 5C11A 5G04B 4P5OB 4I7DA 3O33A 2YSJA 1LDKC 3T6RA 2LV9A 2EGMA 2KGIA 3DPLR 2XB1A 2ZETC 3ZVZB 2ECGA 4YC9A 2KIZA 5B76A 3M62A 3FAOA 1FBVA 3I2DA 4YATA 1HYIA 2DX8A 2K17A 4IC3A 1ZBDB 2XOCA 5JG6A 2EGPA 1DVPA 2ECNA 3LJUX 4OGCA 3O35A 5LKTA 2VJFB 4FK5A 2L75A 3U5OA 2LGLA 1VFYA 1G25A 1K2FA
chains in the Genus database with same CATH topology
2HDPA 5DKAA 2OXQC 5FB1A 1JOCA 4QF2A 1MM2A 2QJ0A 2LXPC 2G6QA 4L58A 2F6JA 1T1HA 2Y43A 3KV6A 2VP7A 5FERA 3RTRB 2YT5A 2H0DB 1WEPA 5LCWB 4YBMA 4N4FA 1WEOA 4IC2A 3M63A 3KNVA 3LQHA 2C2VS 1WEMA 4CA1A 3V43A 5H1UA 3N9PA 2EODA 3U5PA 2MNZA 2KU3A 2EA6A 5EYAF 4A0CD 2IDAA 2XEUA 3LQIA 4I7CA 2JRJA 3N9MA 2JMIA 4S3OB 2ECJA 4LADB 4FO9A 3U5NA 4V3LC 2YHOA 3C5KA 3ZYQA 4BBQA 2KWOA 2LGVA 5TRBA 4UI9B 2L0BA 3RPGC 1WEWA 2YHNA 4GNGA 5D1KB 4F52B 3IHPA 5FEYA 2MIQA 2KE1A 2LRIC 2YREA 1WEQA 4FIPA 3EB5A 5KH3A 5LKXA 5B79A 2YUCA 2CSYA 4B7YC 4YAXA 4WA6A 4UP5A 3ZPVE 4S3OC 5B78A 3M99A 5G05B 2ECTA 3VK6A 2MNYA 2LDRA 2L43A 3GL6A 5AIUA 2CKLB 2LXHC 2VPBA 4ZDTA 2KREA 5B8DA 4GNFA 2D8SA 1WEEA 1VD4A 3KV5A 1X4UA 3ZTGA 3U5MA 2ECWA 1N87A 3MHHA 3SOUA 3L11A 3GV4A 4AYCB 3DQVR 4N3WA 2PUYA 3L1ZB 3FL2A 1U6GB 2CSZA 3L1XA 3PURA 2ECVA 1F62A 4LJNA 2Y1NA 2MA6A 5H1TA 2RI7A 2YQLA 4XI1A 3N9OA 4AP4A 4C9ZA 4WZ2A 1HYJA 4GNDA 2AN6A 2M6MA 5TBNA 3N9LA 2CKLA 1WE9A 5LKUA 5TDRA 2RSDA 4YADA 1CHCA 2LGKA 3RPGB 4LLBA 1JM7B 4AYCA 2QIZA 3SOWA 4R8PK 4R2YA 4FJCA 4I7BA 4MSXA 1WEVA 2VPGA 5TABA 5FB0A 4BHWA 5TDWA 5B77A 2M85A 5LKZA 4AUQB 4Q6FA 3O34A 3SOXA 2E6RA 4GNEA 3LQJA 2MA5A 4ZQLA 4NN2A 2VJEB 5DINA 2C2LA 2VJFA 3SHBA 2G43A 4A4CA 2KGGA 5H1VA 3T7LA 3EB6A 3ZVYA 1VYXA 4GB0A 3QZVA 2MD8C 3HCSA 5D1LB 3HCTA 4V3KC 3N9NA 1WILA 5G0FA 2KWKA 1Z60A 2LGGA 2G45A 2F6NA 2UZGA 3KQIA 2YURA 3ZNIA 3C6WA 3LRQA 2JMJA 2ECIA 2KR4A 2QICA 2KFTA 4WZ0A 2VNFA 3O7AA 5D1MB 2JMDA 2K4DA 1E4UA 3NG2A 3MHSA 2E6SA 4R7EA 4WZ3B 1X4IA 4TKPB 2M1RA 1LDJB 4O64A 4A4BA 3ASLA 1Z2QA 4YBTA 4MVTA 4L7XA 5C13A 2YSMA 2VPEA 1WFKA 2F42A 2YU4A 4YBSA 5I3LA 1XWHA 4PPEA 2K16A 3O37A 2M3HA 2FUUA 3N9QA 1WESA 2KYUA 2NAAA 4UP0A 3O36A 2MUMA 4W4UA 3ZPV1 2MD7B 2FSAA 1WIMA 2BAYA 1FP0A 2H0DA 5J3XA 2L80A 2YW8A 1Z6UA 2HYED 2VJEA 3HTKC 1IYMA 1V87A 2KWNA 5H9MA 2L5UA 4LK9A 4LKAA 4AVXA 4A49A 5AITA 1BORA 2Y1MA 4YABA 2K1JA 1WEUA 5KH7A 4ZUXU 2FUIA 2PNXA 2VPDA 1JM7A 4CCGX 3HCUA 2I50A 3PUQA 3O70A 2LN0A 1MM3A 3PHDA 1WGMA 5B75A 4X3GA 1WENA 2LQ6A 4QF3A 2MT5A 2KWJA 2CT2A 2YYRA 4B86C 1RMDA 2YQMA 1X4JA 5KH9A 5C11A 4PTBA 5G04B 4P5OB 4I7DA 3O33A 2YSJA 1LDKC 3T6RA 2LV9A 2KGIA 3DPLR 2XB1A 2ZETC 3ZVZB 2ECGA 4YC9A 2KIZA 5B76A 3M62A 1FBVA 3I2DA 4YATA 1HYIA 2DX8A 2K17A 4IC3A 1ZBDB 5JG6A 2EGPA 1DVPA 2ECNA 3O35A 5LKTA 2VJFB 4FK5A 2L75A 3U5OA 2LGLA 1VFYA 1G25A 1K2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDP A;  5DKA A;  2OXQ C;  5FB1 A;  1JOC A;  4QF2 A;  1MM2 A;  2QJ0 A;  2LXP C;  2G6Q A;  4L58 A;  2F6J A;  1T1H A;  2Y43 A;  3KV6 A;  2VP7 A;  5FER A;  3RTR B;  2YT5 A;  2H0D B;  1WEP A;  5LCW B;  4YBM A;  4N4F A;  1WEO A;  4IC2 A;  3M63 A;  3KNV A;  3LQH A;  2C2V S;  1WEM A;  4CA1 A;  3V43 A;  5H1U A;  3N9P A;  2EOD A;  3U5P A;  2MNZ A;  2KU3 A;  2EA6 A;  5EYA F;  4A0C D;  2IDA A;  2XEU A;  3LQI A;  4I7C A;  2JRJ A;  3N9M A;  2JMI A;  4S3O B;  2ECJ A;  4LAD B;  4FO9 A;  3U5N A;  4V3L C;  2YHO A;  3C5K A;  3ZYQ A;  4BBQ A;  2KWO A;  2LGV A;  5TRB A;  4UI9 B;  2L0B A;  3RPG C;  1WEW A;  2YHN A;  4GNG A;  5D1K B;  4F52 B;  3IHP A;  5FEY A;  2MIQ A;  2KE1 A;  2LRI C;  2YRE A;  1WEQ A;  4FIP A;  3EB5 A;  5KH3 A;  5LKX A;  5B79 A;  2YUC A;  2CSY A;  4B7Y C;  4YAX A;  4WA6 A;  4UP5 A;  3ZPV E;  4S3O C;  5B78 A;  3M99 A;  5G05 B;  2ECT A;  3VK6 A;  2MNY A;  2LDR A;  2L43 A;  3GL6 A;  5AIU A;  2CKL B;  2LXH C;  2VPB A;  4ZDT A;  2KRE A;  5B8D A;  4GNF A;  2D8S A;  1WEE A;  1VD4 A;  3KV5 A;  1X4U A;  3ZTG A;  3U5M A;  2ECW A;  1N87 A;  3MHH A;  3SOU A;  3L11 A;  3GV4 A;  4AYC B;  3DQV R;  4N3W A;  2PUY A;  3L1Z B;  3FL2 A;  1U6G B;  2CSZ A;  3L1X A;  3PUR A;  2ECV A;  1F62 A;  4LJN A;  2Y1N A;  2MA6 A;  5H1T A;  2RI7 A;  2YQL A;  4XI1 A;  3N9O A;  4AP4 A;  4C9Z A;  4WZ2 A;  1HYJ A;  4GND A;  2AN6 A;  2M6M A;  5TBN A;  3N9L A;  2CKL A;  1WE9 A;  5LKU A;  5TDR A;  2RSD A;  4YAD A;  1CHC A;  2LGK A;  3RPG B;  4LLB A;  1JM7 B;  4AYC A;  2QIZ A;  3SOW A;  4R8P K;  4R2Y A;  4FJC A;  4I7B A;  4MSX A;  1WEV A;  2VPG A;  5TAB A;  5FB0 A;  4BHW A;  5TDW A;  5B77 A;  2M85 A;  5LKZ A;  4AUQ B;  4Q6F A;  3O34 A;  3SOX A;  2E6R A;  4GNE A;  3LQJ A;  2MA5 A;  4ZQL A;  4NN2 A;  2VJE B;  5DIN A;  2C2L A;  2VJF A;  3SHB A;  2G43 A;  4A4C A;  2KGG A;  5H1V A;  3T7L A;  3EB6 A;  3ZVY A;  1VYX A;  4GB0 A;  3QZV A;  2MD8 C;  3HCS A;  5D1L B;  3HCT A;  4V3K C;  3N9N A;  1WIL A;  5G0F A;  2KWK A;  1Z60 A;  2LGG A;  2G45 A;  2F6N A;  2UZG A;  3KQI A;  2YUR A;  3ZNI A;  3C6W A;  3LRQ A;  2JMJ A;  2ECI A;  2KR4 A;  2QIC A;  2KFT A;  4WZ0 A;  2VNF A;  3O7A A;  5D1M B;  2JMD A;  2K4D A;  1E4U A;  3NG2 A;  3MHS A;  2E6S A;  4R7E A;  4WZ3 B;  1X4I A;  4TKP B;  2M1R A;  1LDJ B;  4O64 A;  4A4B A;  3ASL A;  1Z2Q A;  4YBT A;  4MVT A;  4L7X A;  5C13 A;  2YSM A;  2VPE A;  1WFK A;  2F42 A;  2YU4 A;  4YBS A;  5I3L A;  1XWH A;  4PPE A;  2K16 A;  3O37 A;  2M3H A;  2FUU A;  3N9Q A;  1WES A;  2KYU A;  2NAA A;  4UP0 A;  3O36 A;  2MUM A;  4W4U A;  3ZPV 1;  2MD7 B;  2FSA A;  1WIM A;  2BAY A;  1FP0 A;  2H0D A;  5J3X A;  2L80 A;  2YW8 A;  1Z6U A;  2HYE D;  2VJE A;  3HTK C;  1IYM A;  1V87 A;  2KWN A;  5H9M A;  2L5U A;  4LK9 A;  4LKA A;  4AVX A;  4A49 A;  5AIT A;  1BOR A;  2Y1M A;  4YAB A;  2K1J A;  1WEU A;  5KH7 A;  4ZUX U;  2FUI A;  2PNX A;  2VPD A;  1JM7 A;  4CCG X;  3HCU A;  2I50 A;  3PUQ A;  3O70 A;  2LN0 A;  1MM3 A;  3PHD A;  1WGM A;  5B75 A;  4X3G A;  1WEN A;  2LQ6 A;  4QF3 A;  2MT5 A;  2KWJ A;  2CT2 A;  2YYR A;  4B86 C;  1RMD A;  2YQM A;  1X4J A;  5KH9 A;  5C11 A;  4PTB A;  5G04 B;  4P5O B;  4I7D A;  3O33 A;  2YSJ A;  1LDK C;  3T6R A;  2LV9 A;  2KGI A;  3DPL R;  2XB1 A;  2ZET C;  3ZVZ B;  2ECG A;  4YC9 A;  2KIZ A;  5B76 A;  3M62 A;  1FBV A;  3I2D A;  4YAT A;  1HYI A;  2DX8 A;  2K17 A;  4IC3 A;  1ZBD B;  5JG6 A;  2EGP A;  1DVP A;  2ECN A;  3O35 A;  5LKT A;  2VJF B;  4FK5 A;  2L75 A;  3U5O A;  2LGL A;  1VFY A;  1G25 A;  1K2F A; 
#chains in the Genus database with same CATH topology
 2HDP A;  5DKA A;  2OXQ C;  5FB1 A;  1JOC A;  4QF2 A;  1MM2 A;  2QJ0 A;  2LXP C;  2G6Q A;  4OGE A;  4L58 A;  3DDT A;  3LDY A;  2F6J A;  1T1H A;  2Y43 A;  3KV6 A;  2VP7 A;  5FER A;  3RTR B;  2YT5 A;  2H0D B;  1WEP A;  5LCW B;  4YBM A;  2OWA A;  2E61 A;  4N4F A;  1WEO A;  4IC2 A;  3M63 A;  3KNV A;  3LQH A;  2C2V S;  1WEM A;  2DJA A;  4CA1 A;  3V43 A;  5H1U A;  3N9P A;  2EOD A;  3U5P A;  2MNZ A;  2KU3 A;  2EA6 A;  5EYA F;  4A0C D;  3FEH A;  2IDA A;  2XEU A;  3LQI A;  4I7C A;  2JRJ A;  3N9M A;  2JMI A;  3JUE A;  4S3O B;  2ECJ A;  4LAD B;  3FM8 C;  2FFW A;  4FO9 A;  2B0O E;  4H9D A;  3U5N A;  4V3L C;  2YHO A;  3C5K A;  3ZYQ A;  4BBQ A;  2KWO A;  2LGV A;  5TRB A;  4UI9 B;  2L0B A;  3RPG C;  3MDB C;  1WEW A;  2YHN A;  4GNG A;  5D1K B;  4Z0R A;  4F52 B;  3IHP A;  5FEY A;  2CON A;  2MIQ A;  2KE1 A;  2LRI C;  2YRE A;  1WEQ A;  4FIP A;  2RR4 A;  3EB5 A;  5KH3 A;  5LKX A;  2YUC A;  5B79 A;  2CSY A;  4B7Y C;  4YAX A;  2KKX A;  4WA6 A;  4UP5 A;  3ZPV E;  4S3O C;  5B78 A;  3FJU B;  3M99 A;  5G05 B;  2ECT A;  1DCQ A;  3VK6 A;  2MNY A;  2LDR A;  2L43 A;  3GL6 A;  5AIU A;  3T9K A;  3LVQ E;  2CKL B;  2D8U A;  2LXH C;  2VPB A;  2KRE A;  4ZDT A;  5B8D A;  4GNF A;  2D8S A;  1WEE A;  1VD4 A;  3KV5 A;  1X4U A;  3ZTG A;  3U5M A;  2ECW A;  4F1P A;  1N87 A;  3MHH A;  3SOU A;  3L11 A;  3GV4 A;  4AYC B;  3DQV R;  4N3W A;  2PUY A;  3L1Z B;  3DWD A;  3FL2 A;  1U6G B;  2CSZ A;  3L1X A;  3PUR A;  2ECV A;  2KKY A;  1F62 A;  4LJN A;  2Y1N A;  2MA6 A;  5H1T A;  2RI7 A;  2MKE A;  2YQL A;  4XI1 A;  3KDE C;  2JUN A;  3N9O A;  4AP4 A;  2YVR A;  4WZ2 A;  4C9Z A;  1HYJ A;  4GND A;  2AN6 A;  2M6M A;  5TBN A;  3N9L A;  2CKL A;  1WE9 A;  5LKU A;  3H7H A;  5TDR A;  2RSD A;  4YAD A;  3SUB A;  1CHC A;  2LGK A;  3RPG B;  4LLB A;  4Z0O A;  1JM7 B;  4AYC A;  2QIZ A;  3SOW A;  5SVY A;  4R8P K;  2M13 A;  4R2Y A;  4FJC A;  4I7B A;  4MSX A;  1WEV A;  2VPG A;  5TAB A;  5FB0 A;  4BHW A;  5TDW A;  5B77 A;  2M85 A;  5LKZ A;  4Q6F A;  4AUQ B;  3O34 A;  3SOX A;  2E6R A;  4GNE A;  3LQJ A;  2MA5 A;  4ZQL A;  4NN2 A;  2VJE B;  5DIN A;  2C2L A;  2VJF A;  3SHB A;  2G43 A;  4A4C A;  2KGG A;  2CRR A;  5H1V A;  3T7L A;  2IQJ A;  3EB6 A;  3ZVY A;  1VYX A;  4GB0 A;  3QZV A;  2MD8 C;  3HCS A;  3Q1D A;  5D1L B;  3HCT A;  5K3Q A;  4V3K C;  3N9N A;  1WIL A;  5SVI B;  5G0F A;  2KWK A;  5SVX A;  1Z60 A;  2LGG A;  2FD4 A;  3E2D A;  2G45 A;  2F6N A;  2UZG A;  3KQI A;  3O47 A;  2YUR A;  3ZNI A;  3C6W A;  3LRQ A;  2JMJ A;  3FAN A;  2ECI A;  2KR4 A;  2QIC A;  2EXU A;  2KFT A;  4WZ0 A;  2VNF A;  2XOY A;  3O7A A;  5D1M B;  3PLW A;  2JMD A;  2K4D A;  1E4U A;  3NG2 A;  3MHS A;  2E6S A;  4R7E A;  4WZ3 B;  1X4I A;  4TKP B;  2M1R A;  1LDJ B;  4O64 A;  4A4B A;  3ASL A;  1Z2Q A;  4YBT A;  4MVT A;  4L7X A;  5C13 A;  2YSM A;  2VPE A;  1WFK A;  2F42 A;  2YU4 A;  4YBS A;  5I3L A;  1XWH A;  4PPE A;  2K16 A;  3O37 A;  2M3H A;  2FUU A;  3N9Q A;  1WES A;  2KYU A;  5SVI A;  2NAA A;  4UP0 A;  3O36 A;  2MUM A;  4W4U A;  3M7K A;  3ZPV 1;  2MD7 B;  2FSA A;  1WIM A;  2DSM A;  2BAY A;  1FP0 A;  2H0D A;  5J3X A;  2L80 A;  2YW8 A;  1Z6U A;  2HYE D;  2VJE A;  4QQ4 A;  2LAU A;  3HTK C;  1IYM A;  1V87 A;  2KWN A;  5H9M A;  2L5U A;  4LK9 A;  2P57 A;  4O62 A;  4LKA A;  4AVX A;  4A49 A;  5AIT A;  1BOR A;  2Y1M A;  4YAB A;  2L7P A;  2K1J A;  2CSV A;  1WEU A;  5KH7 A;  4ZUX U;  2FUI A;  2PNX A;  2VPD A;  1JM7 A;  2XOZ A;  4CCG X;  3HCU A;  2I50 A;  3PUQ A;  3O70 A;  2LN0 A;  1MM3 A;  3PHD A;  1WGM A;  2JM3 A;  5B75 A;  4X3G A;  1WEN A;  2LQ6 A;  3LVR E;  4QF3 A;  2MT5 A;  2KWJ A;  2CT2 A;  2YYR A;  4B86 C;  2XP0 A;  1RMD A;  2YQM A;  1X4J A;  1MBM A;  2CRW A;  5KH9 A;  4PTB A;  5C11 A;  5G04 B;  4P5O B;  4I7D A;  3O33 A;  2YSJ A;  1LDK C;  3T6R A;  2LV9 A;  2EGM A;  2KGI A;  3DPL R;  2XB1 A;  2ZET C;  3ZVZ B;  2ECG A;  4YC9 A;  2KIZ A;  5B76 A;  3M62 A;  3FAO A;  1FBV A;  3I2D A;  4YAT A;  1HYI A;  2DX8 A;  2K17 A;  4IC3 A;  1ZBD B;  2XOC A;  5JG6 A;  2EGP A;  1DVP A;  2ECN A;  3LJU X;  4OGC A;  3O35 A;  5LKT A;  2VJF B;  4FK5 A;  2L75 A;  3U5O A;  2LGL A;  1VFY A;  1G25 A;  1K2F A; 
#chains in the Genus database with same CATH homology
 2HDP A;  5DKA A;  2OXQ C;  5FB1 A;  1JOC A;  4QF2 A;  1MM2 A;  2QJ0 A;  2LXP C;  2G6Q A;  4L58 A;  2F6J A;  1T1H A;  2Y43 A;  3KV6 A;  2VP7 A;  5FER A;  3RTR B;  2YT5 A;  2H0D B;  1WEP A;  5LCW B;  4YBM A;  4N4F A;  1WEO A;  4IC2 A;  3M63 A;  3KNV A;  3LQH A;  2C2V S;  1WEM A;  4CA1 A;  3V43 A;  5H1U A;  3N9P A;  2EOD A;  3U5P A;  2MNZ A;  2KU3 A;  2EA6 A;  5EYA F;  4A0C D;  2IDA A;  2XEU A;  3LQI A;  4I7C A;  2JRJ A;  3N9M A;  2JMI A;  4S3O B;  2ECJ A;  4LAD B;  4FO9 A;  3U5N A;  4V3L C;  2YHO A;  3C5K A;  3ZYQ A;  4BBQ A;  2KWO A;  2LGV A;  5TRB A;  4UI9 B;  2L0B A;  3RPG C;  1WEW A;  2YHN A;  4GNG A;  5D1K B;  4F52 B;  3IHP A;  5FEY A;  2MIQ A;  2KE1 A;  2LRI C;  2YRE A;  1WEQ A;  4FIP A;  3EB5 A;  5KH3 A;  5LKX A;  5B79 A;  2YUC A;  2CSY A;  4B7Y C;  4YAX A;  4WA6 A;  4UP5 A;  3ZPV E;  4S3O C;  5B78 A;  3M99 A;  5G05 B;  2ECT A;  3VK6 A;  2MNY A;  2LDR A;  2L43 A;  3GL6 A;  5AIU A;  2CKL B;  2LXH C;  2VPB A;  4ZDT A;  2KRE A;  5B8D A;  4GNF A;  2D8S A;  1WEE A;  1VD4 A;  3KV5 A;  1X4U A;  3ZTG A;  3U5M A;  2ECW A;  1N87 A;  3MHH A;  3SOU A;  3L11 A;  3GV4 A;  4AYC B;  3DQV R;  4N3W A;  2PUY A;  3L1Z B;  3FL2 A;  1U6G B;  2CSZ A;  3L1X A;  3PUR A;  2ECV A;  1F62 A;  4LJN A;  2Y1N A;  2MA6 A;  5H1T A;  2RI7 A;  2YQL A;  4XI1 A;  3N9O A;  4AP4 A;  4C9Z A;  4WZ2 A;  1HYJ A;  4GND A;  2AN6 A;  2M6M A;  5TBN A;  3N9L A;  2CKL A;  1WE9 A;  5LKU A;  5TDR A;  2RSD A;  4YAD A;  1CHC A;  2LGK A;  3RPG B;  4LLB A;  1JM7 B;  4AYC A;  2QIZ A;  3SOW A;  4R8P K;  4R2Y A;  4FJC A;  4I7B A;  4MSX A;  1WEV A;  2VPG A;  5TAB A;  5FB0 A;  4BHW A;  5TDW A;  5B77 A;  2M85 A;  5LKZ A;  4AUQ B;  4Q6F A;  3O34 A;  3SOX A;  2E6R A;  4GNE A;  3LQJ A;  2MA5 A;  4ZQL A;  4NN2 A;  2VJE B;  5DIN A;  2C2L A;  2VJF A;  3SHB A;  2G43 A;  4A4C A;  2KGG A;  5H1V A;  3T7L A;  3EB6 A;  3ZVY A;  1VYX A;  4GB0 A;  3QZV A;  2MD8 C;  3HCS A;  5D1L B;  3HCT A;  4V3K C;  3N9N A;  1WIL A;  5G0F A;  2KWK A;  1Z60 A;  2LGG A;  2G45 A;  2F6N A;  2UZG A;  3KQI A;  2YUR A;  3ZNI A;  3C6W A;  3LRQ A;  2JMJ A;  2ECI A;  2KR4 A;  2QIC A;  2KFT A;  4WZ0 A;  2VNF A;  3O7A A;  5D1M B;  2JMD A;  2K4D A;  1E4U A;  3NG2 A;  3MHS A;  2E6S A;  4R7E A;  4WZ3 B;  1X4I A;  4TKP B;  2M1R A;  1LDJ B;  4O64 A;  4A4B A;  3ASL A;  1Z2Q A;  4YBT A;  4MVT A;  4L7X A;  5C13 A;  2YSM A;  2VPE A;  1WFK A;  2F42 A;  2YU4 A;  4YBS A;  5I3L A;  1XWH A;  4PPE A;  2K16 A;  3O37 A;  2M3H A;  2FUU A;  3N9Q A;  1WES A;  2KYU A;  2NAA A;  4UP0 A;  3O36 A;  2MUM A;  4W4U A;  3ZPV 1;  2MD7 B;  2FSA A;  1WIM A;  2BAY A;  1FP0 A;  2H0D A;  5J3X A;  2L80 A;  2YW8 A;  1Z6U A;  2HYE D;  2VJE A;  3HTK C;  1IYM A;  1V87 A;  2KWN A;  5H9M A;  2L5U A;  4LK9 A;  4LKA A;  4AVX A;  4A49 A;  5AIT A;  1BOR A;  2Y1M A;  4YAB A;  2K1J A;  1WEU A;  5KH7 A;  4ZUX U;  2FUI A;  2PNX A;  2VPD A;  1JM7 A;  4CCG X;  3HCU A;  2I50 A;  3PUQ A;  3O70 A;  2LN0 A;  1MM3 A;  3PHD A;  1WGM A;  5B75 A;  4X3G A;  1WEN A;  2LQ6 A;  4QF3 A;  2MT5 A;  2KWJ A;  2CT2 A;  2YYR A;  4B86 C;  1RMD A;  2YQM A;  1X4J A;  5KH9 A;  5C11 A;  4PTB A;  5G04 B;  4P5O B;  4I7D A;  3O33 A;  2YSJ A;  1LDK C;  3T6R A;  2LV9 A;  2KGI A;  3DPL R;  2XB1 A;  2ZET C;  3ZVZ B;  2ECG A;  4YC9 A;  2KIZ A;  5B76 A;  3M62 A;  1FBV A;  3I2D A;  4YAT A;  1HYI A;  2DX8 A;  2K17 A;  4IC3 A;  1ZBD B;  5JG6 A;  2EGP A;  1DVP A;  2ECN A;  3O35 A;  5LKT A;  2VJF B;  4FK5 A;  2L75 A;  3U5O A;  2LGL A;  1VFY A;  1G25 A;  1K2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...