2L5UA

Structure of the first phd finger (phd1) from chd4 (mi2b)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
61
structure length
61
Chain Sequence
GPLGSYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromodomain-helicase-DNA-binding protein 4
publication title Plant Homeodomain (PHD) Fingers of CHD4 Are Histone H3-binding Modules with Preference for Unmodified H3K4 and Methylated H3K9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 8
structure length 61
sequence length 61
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2l5uA00
2KU3A 3KNVA 4WA6A 4UP5A 1F62A 5FB0A 4LK9A 4WZ2A 1JOCA 2YQMA 5TDRA 4BBQA 2EA6A 4ZUXU 1T1HA 5LCWB 2MNZA 2K4DA 4UP0A 4R8PK 1CHCA 5FEYA 1WEUA 5DINA 3ZPVE 5LKTA 3HCSA 3HCTA 3PURA 4MSXA 4FJCA 1V87A 2YU4A 2LGVA 2LXPC 2L43A 2CSYA 3L11A 2VJEA 3O7AA 2MD8C 3O37A 4S3OB 1JM7A 2RSDA 3SOWA 2VPBA 4GB0A 4I7DA 4LLBA 2G45A 4BHWA 2YURA 4UI9B 1WEMA 1ZBDB 2D8SA 2PNXA 3M63A 3O36A 4IC2A 2KE1A 2MA5A 5B8DA 2YHOA 5KH3A 1Z60A 2M1RA 4F52B 3ZVZB 1VFYA 5LKZA 2XEUA 3N9QA 2OXQC 4AP4A 4GNDA 1WEPA 2JRJA 3M62A 2L80A 1VYXA 3MHHA 2VPGA 3LQHA 2KREA 2Y1NA 2KWOA 2KWNA 2MA6A 2LGGA 3EB6A 2KGGA 4YBTA 1X4UA 3N9OA 4B86C 1HYJA 2IDAA 4V3KC 4P5OB 5AIUA 1FBVA 5B76A 2UZGA 2VJFB 2VP7A 4AYCA 3KV5A 4YATA 2I50A 3C5KA 4CA1A 3U5MA 5B79A 2QICA 1WEEA 3LQIA 5C11A 1E4UA 4FIPA 2YUCA 2YYRA 4V3LC 5DKAA 1X4JA 3LQJA 3GV4A 5G04B 4S3OC 2F6JA 4R2YA 4MVTA 4A4CA 2ECIA 3ASLA 5G0FA 4PTBA 3O34A 2CKLA 5KH7A 3SOXA 2L75A 1K2FA 2PUYA 5H1VA 5D1KB 5C13A 1LDJB 2VNFA 2G6QA 1WE9A 3O70A 2M3HA 3GL6A 5G05B 3HTKC 2YT5A 2MUMA 2F6NA 1Z6UA 3N9NA 4CCGX 3KQIA 4AUQB 5D1MB 2H0DA 2YSMA 3N9PA 4LJNA 4I7CA 3LRQA 4ZQLA 1MM2A 1WESA 1WEWA 4YBSA 2ZETC 2G43A 3PHDA 2KGIA 2MD7B 2VJEB 1VD4A 2RI7A 3ZYQA 3SOUA 2ECVA 1JM7B 4N3WA 4PPEA 1N87A 5TABA 1WEOA 2LN0A 4QF3A 2AN6A 2QJ0A 3PUQA 2XB1A 3RPGB 4WZ3B 4AVXA 3SHBA 4LADB 2JMJA 2KWJA 2F42A 4N4FA 1HYIA 2LGKA 2LXHC 2VPDA 3C6WA 5KH9A 1RMDA 4FK5A 3HCUA 2YREA 5TRBA 2EODA 2LV9A 2E6RA 2DX8A 2JMDA 3O35A 3QZVA 3O33A 4NN2A 3ZNIA 1IYMA 4AYCB 2ECWA 4C9ZA 2K1JA 3I2DA 2MNYA 2K17A 1MM3A 2M85A 3IHPA 2JMIA 4IC3A 2FUUA 1BORA 4L7XA 3N9MA 5AITA 5J3XA 3MHSA 2YW8A 2YQLA 3NG2A 2FUIA 5B75A 4R7EA 3T7LA 4I7BA 3V43A 1WENA 2YHNA 2MT5A 5EYAF 5B77A 5FERA 5H1TA 2ECGA 4A4BA 2C2LA 2CKLB 3N9LA 5B78A 4YC9A 2Y43A 4TKPB 2ECTA 4A49A 1LDKC 2K16A 4YBMA 5TBNA 4WZ0A 1G25A 3DPLR 3T6RA 4GNGA 4ZDTA 3RPGC 3ZVYA 2KWKA 4Q6FA 4QF2A 5H9MA 4L58A 2M6MA 2YSJA 5D1LB 2LDRA 1U6GB 2QIZA 4W4UA 3DQVR 2FSAA 2H0DB 2L0BA 4A0CD 3KV6A 2KR4A 2Y1MA 2EGPA 3ZPV1 5H1UA 3VK6A 2VPEA 1WEVA 1WGMA 5FB1A 2KFTA 4O64A 2HDPA 1WIMA 3U5PA 3L1ZB 5TDWA 4B7YC 5LKUA 4X3GA 4LKAA 2BAYA 2NAAA 4GNEA 4XI1A 2HYED 4YABA 3U5OA 3U5NA 1WILA 1WEQA 2LGLA 3L1XA 4GNFA 1DVPA 2C2VS 2KIZA 2MIQA 2ECNA 2ECJA 4YADA 3FL2A 1X4IA 2VJFA 3M99A 2L5UA 4FO9A 1FP0A 2LRIC 5LKXA 1XWHA 2CT2A 4YAXA 2KYUA 5JG6A 3ZTGA 1Z2QA 5I3LA 2CSZA 2E6SA 2LQ6A 3EB5A 3RTRB 1WFKA
chains in the Genus database with same CATH superfamily
2KU3A 3KNVA 4WA6A 4UP5A 1F62A 5FB0A 4LK9A 4WZ2A 1JOCA 2YQMA 5TDRA 4BBQA 2EA6A 4ZUXU 1T1HA 5LCWB 2MNZA 3FEHA 2OWAA 2K4DA 4UP0A 4R8PK 1CHCA 3FAOA 5FEYA 1WEUA 5DINA 3ZPVE 5LKTA 3HCSA 3HCTA 5K3QA 3PURA 4MSXA 4FJCA 1V87A 2YU4A 2LGVA 2LXPC 2L43A 2CSYA 3L11A 4H9DA 2VJEA 3O7AA 3M7KA 2MD8C 3O37A 4S3OB 1JM7A 2RSDA 3SOWA 2VPBA 3FJUB 4GB0A 4I7DA 2G45A 4LLBA 4BHWA 2YURA 4UI9B 1WEMA 1ZBDB 2D8SA 2PNXA 3M63A 3O36A 4IC2A 2KE1A 2MA5A 5B8DA 2YHOA 5KH3A 1Z60A 2KKYA 2M1RA 4F52B 3ZVZB 1VFYA 5LKZA 2XEUA 3N9QA 2CRWA 2OXQC 4AP4A 4GNDA 1WEPA 4OGCA 2JRJA 3M62A 2L80A 1VYXA 3E2DA 3MHHA 2VPGA 3LQHA 2LAUA 2KREA 2Y1NA 2XOYA 2KWOA 2KWNA 2MA6A 5SVIA 2LGGA 2DSMA 3EB6A 2KGGA 4YBTA 1X4UA 3N9OA 3PLWA 4B86C 1HYJA 2IDAA 4V3KC 4P5OB 5AIUA 1FBVA 5B76A 2UZGA 2VJFB 2VP7A 4AYCA 3KV5A 4YATA 2EGMA 2I50A 3FANA 3C5KA 3H7HA 4CA1A 3U5MA 5B79A 2QICA 1WEEA 3LQIA 5C11A 1E4UA 4FIPA 2YUCA 2YYRA 3LJUX 4V3LC 2XOCA 5DKAA 1X4JA 3LQJA 3GV4A 2CONA 5G04B 4O62A 4S3OC 2F6JA 4R2YA 4MVTA 4A4CA 2ECIA 3ASLA 5G0FA 4PTBA 3O34A 2CKLA 5KH7A 2JUNA 3SOXA 2L75A 1K2FA 2PUYA 5H1VA 5D1KB 5C13A 3LDYA 1LDJB 2VNFA 2G6QA 1WE9A 3O70A 2M3HA 3GL6A 5G05B 3HTKC 2YT5A 4Z0RA 2MUMA 2F6NA 1Z6UA 2MKEA 3N9NA 4CCGX 3KQIA 2P57A 4AUQB 5D1MB 2H0DA 2YSMA 3N9PA 4LJNA 4I7CA 3LRQA 4ZQLA 1MM2A 1WESA 1WEWA 4YBSA 2ZETC 2FD4A 2G43A 3PHDA 2KGIA 2MD7B 2VJEB 1VD4A 2RI7A 3ZYQA 3SOUA 2ECVA 1JM7B 4N3WA 4PPEA 2B0OE 1N87A 5TABA 1WEOA 2LN0A 4QF3A 2AN6A 2QJ0A 3PUQA 2XB1A 4F1PA 3RPGB 2M13A 4WZ3B 4AVXA 2FFWA 3SHBA 4QQ4A 4LADB 2JMJA 2KWJA 2F42A 4N4FA 1HYIA 2LGKA 2LXHC 2VPDA 3C6WA 5SVIB 5KH9A 1RMDA 4FK5A 3HCUA 2YREA 5TRBA 2EODA 2EXUA 4Z0OA 2LV9A 2E6RA 2KKXA 3SUBA 2DX8A 2JMDA 3O35A 3QZVA 3O33A 4NN2A 3ZNIA 3O47A 1IYMA 4AYCB 2ECWA 4C9ZA 2K1JA 3I2DA 2MNYA 2CSVA 3DDTA 2K17A 1MM3A 2M85A 3IHPA 2JMIA 4IC3A 2FUUA 1BORA 4L7XA 3N9MA 5SVXA 5AITA 5J3XA 3MHSA 2YW8A 3T9KA 2YQLA 3NG2A 2FUIA 5B75A 4R7EA 3T7LA 4I7BA 3V43A 1WENA 2YHNA 2MT5A 5EYAF 5B77A 5FERA 5H1TA 2ECGA 4A4BA 2C2LA 2CKLB 3N9LA 5B78A 2RR4A 4YC9A 2Y43A 4TKPB 2ECTA 4A49A 1LDKC 2K16A 2YVRA 4YBMA 4WZ0A 5TBNA 1G25A 3DPLR 3T6RA 4GNGA 4ZDTA 3RPGC 2JM3A 2KWKA 4Q6FA 4QF2A 5H9MA 4L58A 3ZVYA 2M6MA 2YSJA 5D1LB 2LDRA 1U6GB 2CRRA 2QIZA 4W4UA 3DQVR 2FSAA 2H0DB 2L0BA 4A0CD 2L7PA 3KV6A 2KR4A 2Y1MA 4OGEA 5SVYA 2EGPA 2DJAA 3ZPV1 5H1UA 3VK6A 2VPEA 2XOZA 1WEVA 1WGMA 5FB1A 2KFTA 4O64A 2HDPA 2D8UA 1WIMA 3U5PA 2XP0A 3L1ZB 5TDWA 1DCQA 3MDBC 4B7YC 5LKUA 4X3GA 3FM8C 4LKAA 2BAYA 2E61A 2NAAA 3LVQE 4GNEA 4XI1A 2HYED 4YABA 3U5OA 3U5NA 1WILA 1WEQA 2LGLA 3L1XA 4GNFA 3JUEA 1DVPA 2C2VS 2KIZA 2MIQA 2ECNA 2ECJA 4YADA 3FL2A 1X4IA 2VJFA 3M99A 2L5UA 4FO9A 1FP0A 2LRIC 1MBMA 5LKXA 3DWDA 1XWHA 2CT2A 4YAXA 2KYUA 5JG6A 3LVRE 3ZTGA 1Z2QA 5I3LA 2CSZA 3Q1DA 2E6SA 2LQ6A 2IQJA 3EB5A 3KDEC 3RTRB 1WFKA
chains in the Genus database with same CATH topology
2KU3A 3KNVA 4WA6A 4UP5A 1F62A 5FB0A 4LK9A 4WZ2A 1JOCA 2YQMA 5TDRA 4BBQA 2EA6A 4ZUXU 1T1HA 5LCWB 2MNZA 2K4DA 4UP0A 4R8PK 1CHCA 5FEYA 1WEUA 5DINA 3ZPVE 5LKTA 3HCSA 3HCTA 3PURA 4MSXA 4FJCA 1V87A 2YU4A 2LGVA 2LXPC 2L43A 2CSYA 3L11A 2VJEA 3O7AA 2MD8C 3O37A 4S3OB 1JM7A 2RSDA 3SOWA 2VPBA 4GB0A 4I7DA 4LLBA 2G45A 4BHWA 2YURA 4UI9B 1WEMA 1ZBDB 2D8SA 2PNXA 3M63A 3O36A 4IC2A 2KE1A 2MA5A 5B8DA 2YHOA 5KH3A 1Z60A 2M1RA 4F52B 3ZVZB 1VFYA 5LKZA 2XEUA 3N9QA 2OXQC 4AP4A 4GNDA 1WEPA 2JRJA 3M62A 2L80A 1VYXA 3MHHA 2VPGA 3LQHA 2KREA 2Y1NA 2KWOA 2KWNA 2MA6A 2LGGA 3EB6A 2KGGA 4YBTA 1X4UA 3N9OA 4B86C 1HYJA 2IDAA 4V3KC 4P5OB 5AIUA 1FBVA 5B76A 2UZGA 2VJFB 2VP7A 4AYCA 3KV5A 4YATA 2I50A 3C5KA 4CA1A 3U5MA 5B79A 2QICA 1WEEA 3LQIA 5C11A 1E4UA 4FIPA 2YUCA 2YYRA 4V3LC 5DKAA 1X4JA 3LQJA 3GV4A 5G04B 4S3OC 2F6JA 4R2YA 4MVTA 4A4CA 2ECIA 3ASLA 5G0FA 4PTBA 3O34A 2CKLA 5KH7A 3SOXA 2L75A 1K2FA 2PUYA 5H1VA 5D1KB 5C13A 1LDJB 2VNFA 2G6QA 1WE9A 3O70A 2M3HA 3GL6A 5G05B 3HTKC 2YT5A 2MUMA 2F6NA 1Z6UA 3N9NA 4CCGX 3KQIA 4AUQB 5D1MB 2H0DA 2YSMA 3N9PA 4LJNA 4I7CA 3LRQA 4ZQLA 1MM2A 1WESA 1WEWA 4YBSA 2ZETC 2G43A 3PHDA 2KGIA 2MD7B 2VJEB 1VD4A 2RI7A 3ZYQA 3SOUA 2ECVA 1JM7B 4N3WA 4PPEA 1N87A 5TABA 1WEOA 2LN0A 4QF3A 2AN6A 2QJ0A 3PUQA 2XB1A 3RPGB 4WZ3B 4AVXA 3SHBA 4LADB 2JMJA 2KWJA 2F42A 4N4FA 1HYIA 2LGKA 2LXHC 2VPDA 3C6WA 5KH9A 1RMDA 4FK5A 3HCUA 2YREA 5TRBA 2EODA 2LV9A 2E6RA 2DX8A 2JMDA 3O35A 3QZVA 3O33A 4NN2A 3ZNIA 1IYMA 4AYCB 2ECWA 4C9ZA 2K1JA 3I2DA 2MNYA 2K17A 1MM3A 2M85A 3IHPA 2JMIA 4IC3A 2FUUA 1BORA 4L7XA 3N9MA 5AITA 5J3XA 3MHSA 2YW8A 2YQLA 3NG2A 2FUIA 5B75A 4R7EA 3T7LA 4I7BA 3V43A 1WENA 2YHNA 2MT5A 5EYAF 5B77A 5FERA 5H1TA 2ECGA 4A4BA 2C2LA 2CKLB 3N9LA 5B78A 4YC9A 2Y43A 4TKPB 2ECTA 4A49A 1LDKC 2K16A 4YBMA 5TBNA 4WZ0A 1G25A 3DPLR 3T6RA 4GNGA 4ZDTA 3RPGC 3ZVYA 2KWKA 4Q6FA 4QF2A 5H9MA 4L58A 2M6MA 2YSJA 5D1LB 2LDRA 1U6GB 2QIZA 4W4UA 3DQVR 2FSAA 2H0DB 2L0BA 4A0CD 3KV6A 2KR4A 2Y1MA 2EGPA 3ZPV1 5H1UA 3VK6A 2VPEA 1WEVA 1WGMA 5FB1A 2KFTA 4O64A 2HDPA 1WIMA 3U5PA 3L1ZB 5TDWA 4B7YC 5LKUA 4X3GA 4LKAA 2BAYA 2NAAA 4GNEA 4XI1A 2HYED 4YABA 3U5OA 3U5NA 1WILA 1WEQA 2LGLA 3L1XA 4GNFA 1DVPA 2C2VS 2KIZA 2MIQA 2ECNA 2ECJA 4YADA 3FL2A 1X4IA 2VJFA 3M99A 2L5UA 4FO9A 1FP0A 2LRIC 5LKXA 1XWHA 2CT2A 4YAXA 2KYUA 5JG6A 3ZTGA 1Z2QA 5I3LA 2CSZA 2E6SA 2LQ6A 3EB5A 3RTRB 1WFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KU3 A;  3KNV A;  4WA6 A;  4UP5 A;  1F62 A;  5FB0 A;  4LK9 A;  4WZ2 A;  1JOC A;  2YQM A;  5TDR A;  4BBQ A;  2EA6 A;  4ZUX U;  1T1H A;  5LCW B;  2MNZ A;  2K4D A;  4UP0 A;  4R8P K;  1CHC A;  5FEY A;  1WEU A;  5DIN A;  3ZPV E;  5LKT A;  3HCS A;  3HCT A;  3PUR A;  4MSX A;  4FJC A;  1V87 A;  2YU4 A;  2LGV A;  2LXP C;  2L43 A;  2CSY A;  3L11 A;  2VJE A;  3O7A A;  2MD8 C;  3O37 A;  4S3O B;  1JM7 A;  2RSD A;  3SOW A;  2VPB A;  4GB0 A;  4I7D A;  4LLB A;  2G45 A;  4BHW A;  2YUR A;  4UI9 B;  1WEM A;  1ZBD B;  2D8S A;  2PNX A;  3M63 A;  3O36 A;  4IC2 A;  2KE1 A;  2MA5 A;  5B8D A;  2YHO A;  5KH3 A;  1Z60 A;  2M1R A;  4F52 B;  3ZVZ B;  1VFY A;  5LKZ A;  2XEU A;  3N9Q A;  2OXQ C;  4AP4 A;  4GND A;  1WEP A;  2JRJ A;  3M62 A;  2L80 A;  1VYX A;  3MHH A;  2VPG A;  3LQH A;  2KRE A;  2Y1N A;  2KWO A;  2KWN A;  2MA6 A;  2LGG A;  3EB6 A;  2KGG A;  4YBT A;  1X4U A;  3N9O A;  4B86 C;  1HYJ A;  2IDA A;  4V3K C;  4P5O B;  5AIU A;  1FBV A;  5B76 A;  2UZG A;  2VJF B;  2VP7 A;  4AYC A;  3KV5 A;  4YAT A;  2I50 A;  3C5K A;  4CA1 A;  3U5M A;  5B79 A;  2QIC A;  1WEE A;  3LQI A;  5C11 A;  1E4U A;  4FIP A;  2YUC A;  2YYR A;  4V3L C;  5DKA A;  1X4J A;  3LQJ A;  3GV4 A;  5G04 B;  4S3O C;  2F6J A;  4R2Y A;  4MVT A;  4A4C A;  2ECI A;  3ASL A;  5G0F A;  4PTB A;  3O34 A;  2CKL A;  5KH7 A;  3SOX A;  2L75 A;  1K2F A;  2PUY A;  5H1V A;  5D1K B;  5C13 A;  1LDJ B;  2VNF A;  2G6Q A;  1WE9 A;  3O70 A;  2M3H A;  3GL6 A;  5G05 B;  3HTK C;  2YT5 A;  2MUM A;  2F6N A;  1Z6U A;  3N9N A;  4CCG X;  3KQI A;  4AUQ B;  5D1M B;  2H0D A;  2YSM A;  3N9P A;  4LJN A;  4I7C A;  3LRQ A;  4ZQL A;  1MM2 A;  1WES A;  1WEW A;  4YBS A;  2ZET C;  2G43 A;  3PHD A;  2KGI A;  2MD7 B;  2VJE B;  1VD4 A;  2RI7 A;  3ZYQ A;  3SOU A;  2ECV A;  1JM7 B;  4N3W A;  4PPE A;  1N87 A;  5TAB A;  1WEO A;  2LN0 A;  4QF3 A;  2AN6 A;  2QJ0 A;  3PUQ A;  2XB1 A;  3RPG B;  4WZ3 B;  4AVX A;  3SHB A;  4LAD B;  2JMJ A;  2KWJ A;  2F42 A;  4N4F A;  1HYI A;  2LGK A;  2LXH C;  2VPD A;  3C6W A;  5KH9 A;  1RMD A;  4FK5 A;  3HCU A;  2YRE A;  5TRB A;  2EOD A;  2LV9 A;  2E6R A;  2DX8 A;  2JMD A;  3O35 A;  3QZV A;  3O33 A;  4NN2 A;  3ZNI A;  1IYM A;  4AYC B;  2ECW A;  4C9Z A;  2K1J A;  3I2D A;  2MNY A;  2K17 A;  1MM3 A;  2M85 A;  3IHP A;  2JMI A;  4IC3 A;  2FUU A;  1BOR A;  4L7X A;  3N9M A;  5AIT A;  5J3X A;  3MHS A;  2YW8 A;  2YQL A;  3NG2 A;  2FUI A;  5B75 A;  4R7E A;  3T7L A;  4I7B A;  3V43 A;  1WEN A;  2YHN A;  2MT5 A;  5EYA F;  5B77 A;  5FER A;  5H1T A;  2ECG A;  4A4B A;  2C2L A;  2CKL B;  3N9L A;  5B78 A;  4YC9 A;  2Y43 A;  4TKP B;  2ECT A;  4A49 A;  1LDK C;  2K16 A;  4YBM A;  5TBN A;  4WZ0 A;  1G25 A;  3DPL R;  3T6R A;  4GNG A;  4ZDT A;  3RPG C;  3ZVY A;  2KWK A;  4Q6F A;  4QF2 A;  5H9M A;  4L58 A;  2M6M A;  2YSJ A;  5D1L B;  2LDR A;  1U6G B;  2QIZ A;  4W4U A;  3DQV R;  2FSA A;  2H0D B;  2L0B A;  4A0C D;  3KV6 A;  2KR4 A;  2Y1M A;  2EGP A;  3ZPV 1;  5H1U A;  3VK6 A;  2VPE A;  1WEV A;  1WGM A;  5FB1 A;  2KFT A;  4O64 A;  2HDP A;  1WIM A;  3U5P A;  3L1Z B;  5TDW A;  4B7Y C;  5LKU A;  4X3G A;  4LKA A;  2BAY A;  2NAA A;  4GNE A;  4XI1 A;  2HYE D;  4YAB A;  3U5O A;  3U5N A;  1WIL A;  1WEQ A;  2LGL A;  3L1X A;  4GNF A;  1DVP A;  2C2V S;  2KIZ A;  2MIQ A;  2ECN A;  2ECJ A;  4YAD A;  3FL2 A;  1X4I A;  2VJF A;  3M99 A;  2L5U A;  4FO9 A;  1FP0 A;  2LRI C;  5LKX A;  1XWH A;  2CT2 A;  4YAX A;  2KYU A;  5JG6 A;  3ZTG A;  1Z2Q A;  5I3L A;  2CSZ A;  2E6S A;  2LQ6 A;  3EB5 A;  3RTR B;  1WFK A; 
#chains in the Genus database with same CATH topology
 2KU3 A;  3KNV A;  4WA6 A;  4UP5 A;  1F62 A;  5FB0 A;  4LK9 A;  4WZ2 A;  1JOC A;  2YQM A;  5TDR A;  4BBQ A;  2EA6 A;  4ZUX U;  1T1H A;  5LCW B;  2MNZ A;  3FEH A;  2OWA A;  2K4D A;  4UP0 A;  4R8P K;  1CHC A;  3FAO A;  5FEY A;  1WEU A;  5DIN A;  3ZPV E;  5LKT A;  3HCS A;  3HCT A;  5K3Q A;  3PUR A;  4MSX A;  4FJC A;  1V87 A;  2YU4 A;  2LGV A;  2LXP C;  2L43 A;  2CSY A;  3L11 A;  4H9D A;  2VJE A;  3O7A A;  3M7K A;  2MD8 C;  3O37 A;  4S3O B;  1JM7 A;  2RSD A;  3SOW A;  2VPB A;  3FJU B;  4GB0 A;  4I7D A;  2G45 A;  4LLB A;  4BHW A;  2YUR A;  4UI9 B;  1WEM A;  1ZBD B;  2D8S A;  2PNX A;  3M63 A;  3O36 A;  4IC2 A;  2KE1 A;  2MA5 A;  5B8D A;  2YHO A;  5KH3 A;  1Z60 A;  2KKY A;  2M1R A;  4F52 B;  3ZVZ B;  1VFY A;  5LKZ A;  2XEU A;  3N9Q A;  2CRW A;  2OXQ C;  4AP4 A;  4GND A;  1WEP A;  4OGC A;  2JRJ A;  3M62 A;  2L80 A;  1VYX A;  3E2D A;  3MHH A;  2VPG A;  3LQH A;  2LAU A;  2KRE A;  2Y1N A;  2XOY A;  2KWO A;  2KWN A;  2MA6 A;  5SVI A;  2LGG A;  2DSM A;  3EB6 A;  2KGG A;  4YBT A;  1X4U A;  3N9O A;  3PLW A;  4B86 C;  1HYJ A;  2IDA A;  4V3K C;  4P5O B;  5AIU A;  1FBV A;  5B76 A;  2UZG A;  2VJF B;  2VP7 A;  4AYC A;  3KV5 A;  4YAT A;  2EGM A;  2I50 A;  3FAN A;  3C5K A;  3H7H A;  4CA1 A;  3U5M A;  5B79 A;  2QIC A;  1WEE A;  3LQI A;  5C11 A;  1E4U A;  4FIP A;  2YUC A;  2YYR A;  3LJU X;  4V3L C;  2XOC A;  5DKA A;  1X4J A;  3LQJ A;  3GV4 A;  2CON A;  5G04 B;  4O62 A;  4S3O C;  2F6J A;  4R2Y A;  4MVT A;  4A4C A;  2ECI A;  3ASL A;  5G0F A;  4PTB A;  3O34 A;  2CKL A;  5KH7 A;  2JUN A;  3SOX A;  2L75 A;  1K2F A;  2PUY A;  5H1V A;  5D1K B;  5C13 A;  3LDY A;  1LDJ B;  2VNF A;  2G6Q A;  1WE9 A;  3O70 A;  2M3H A;  3GL6 A;  5G05 B;  3HTK C;  2YT5 A;  4Z0R A;  2MUM A;  2F6N A;  1Z6U A;  2MKE A;  3N9N A;  4CCG X;  3KQI A;  2P57 A;  4AUQ B;  5D1M B;  2H0D A;  2YSM A;  3N9P A;  4LJN A;  4I7C A;  3LRQ A;  4ZQL A;  1MM2 A;  1WES A;  1WEW A;  4YBS A;  2ZET C;  2FD4 A;  2G43 A;  3PHD A;  2KGI A;  2MD7 B;  2VJE B;  1VD4 A;  2RI7 A;  3ZYQ A;  3SOU A;  2ECV A;  1JM7 B;  4N3W A;  4PPE A;  2B0O E;  1N87 A;  5TAB A;  1WEO A;  2LN0 A;  4QF3 A;  2AN6 A;  2QJ0 A;  3PUQ A;  2XB1 A;  4F1P A;  3RPG B;  2M13 A;  4WZ3 B;  4AVX A;  2FFW A;  3SHB A;  4QQ4 A;  4LAD B;  2JMJ A;  2KWJ A;  2F42 A;  4N4F A;  1HYI A;  2LGK A;  2LXH C;  2VPD A;  3C6W A;  5SVI B;  5KH9 A;  1RMD A;  4FK5 A;  3HCU A;  2YRE A;  5TRB A;  2EOD A;  2EXU A;  4Z0O A;  2LV9 A;  2E6R A;  2KKX A;  3SUB A;  2DX8 A;  2JMD A;  3O35 A;  3QZV A;  3O33 A;  4NN2 A;  3ZNI A;  3O47 A;  1IYM A;  4AYC B;  2ECW A;  4C9Z A;  2K1J A;  3I2D A;  2MNY A;  2CSV A;  3DDT A;  2K17 A;  1MM3 A;  2M85 A;  3IHP A;  2JMI A;  4IC3 A;  2FUU A;  1BOR A;  4L7X A;  3N9M A;  5SVX A;  5AIT A;  5J3X A;  3MHS A;  2YW8 A;  3T9K A;  2YQL A;  3NG2 A;  2FUI A;  5B75 A;  4R7E A;  3T7L A;  4I7B A;  3V43 A;  1WEN A;  2YHN A;  2MT5 A;  5EYA F;  5B77 A;  5FER A;  5H1T A;  2ECG A;  4A4B A;  2C2L A;  2CKL B;  3N9L A;  5B78 A;  2RR4 A;  4YC9 A;  2Y43 A;  4TKP B;  2ECT A;  4A49 A;  1LDK C;  2K16 A;  2YVR A;  4YBM A;  4WZ0 A;  5TBN A;  1G25 A;  3DPL R;  3T6R A;  4GNG A;  4ZDT A;  3RPG C;  2JM3 A;  2KWK A;  4Q6F A;  4QF2 A;  5H9M A;  4L58 A;  3ZVY A;  2M6M A;  2YSJ A;  5D1L B;  2LDR A;  1U6G B;  2CRR A;  2QIZ A;  4W4U A;  3DQV R;  2FSA A;  2H0D B;  2L0B A;  4A0C D;  2L7P A;  3KV6 A;  2KR4 A;  2Y1M A;  4OGE A;  5SVY A;  2EGP A;  2DJA A;  3ZPV 1;  5H1U A;  3VK6 A;  2VPE A;  2XOZ A;  1WEV A;  1WGM A;  5FB1 A;  2KFT A;  4O64 A;  2HDP A;  2D8U A;  1WIM A;  3U5P A;  2XP0 A;  3L1Z B;  5TDW A;  1DCQ A;  3MDB C;  4B7Y C;  5LKU A;  4X3G A;  3FM8 C;  4LKA A;  2BAY A;  2E61 A;  2NAA A;  3LVQ E;  4GNE A;  4XI1 A;  2HYE D;  4YAB A;  3U5O A;  3U5N A;  1WIL A;  1WEQ A;  2LGL A;  3L1X A;  4GNF A;  3JUE A;  1DVP A;  2C2V S;  2KIZ A;  2MIQ A;  2ECN A;  2ECJ A;  4YAD A;  3FL2 A;  1X4I A;  2VJF A;  3M99 A;  2L5U A;  4FO9 A;  1FP0 A;  2LRI C;  1MBM A;  5LKX A;  3DWD A;  1XWH A;  2CT2 A;  4YAX A;  2KYU A;  5JG6 A;  3LVR E;  3ZTG A;  1Z2Q A;  5I3L A;  2CSZ A;  3Q1D A;  2E6S A;  2LQ6 A;  2IQJ A;  3EB5 A;  3KDE C;  3RTR B;  1WFK A; 
#chains in the Genus database with same CATH homology
 2KU3 A;  3KNV A;  4WA6 A;  4UP5 A;  1F62 A;  5FB0 A;  4LK9 A;  4WZ2 A;  1JOC A;  2YQM A;  5TDR A;  4BBQ A;  2EA6 A;  4ZUX U;  1T1H A;  5LCW B;  2MNZ A;  2K4D A;  4UP0 A;  4R8P K;  1CHC A;  5FEY A;  1WEU A;  5DIN A;  3ZPV E;  5LKT A;  3HCS A;  3HCT A;  3PUR A;  4MSX A;  4FJC A;  1V87 A;  2YU4 A;  2LGV A;  2LXP C;  2L43 A;  2CSY A;  3L11 A;  2VJE A;  3O7A A;  2MD8 C;  3O37 A;  4S3O B;  1JM7 A;  2RSD A;  3SOW A;  2VPB A;  4GB0 A;  4I7D A;  4LLB A;  2G45 A;  4BHW A;  2YUR A;  4UI9 B;  1WEM A;  1ZBD B;  2D8S A;  2PNX A;  3M63 A;  3O36 A;  4IC2 A;  2KE1 A;  2MA5 A;  5B8D A;  2YHO A;  5KH3 A;  1Z60 A;  2M1R A;  4F52 B;  3ZVZ B;  1VFY A;  5LKZ A;  2XEU A;  3N9Q A;  2OXQ C;  4AP4 A;  4GND A;  1WEP A;  2JRJ A;  3M62 A;  2L80 A;  1VYX A;  3MHH A;  2VPG A;  3LQH A;  2KRE A;  2Y1N A;  2KWO A;  2KWN A;  2MA6 A;  2LGG A;  3EB6 A;  2KGG A;  4YBT A;  1X4U A;  3N9O A;  4B86 C;  1HYJ A;  2IDA A;  4V3K C;  4P5O B;  5AIU A;  1FBV A;  5B76 A;  2UZG A;  2VJF B;  2VP7 A;  4AYC A;  3KV5 A;  4YAT A;  2I50 A;  3C5K A;  4CA1 A;  3U5M A;  5B79 A;  2QIC A;  1WEE A;  3LQI A;  5C11 A;  1E4U A;  4FIP A;  2YUC A;  2YYR A;  4V3L C;  5DKA A;  1X4J A;  3LQJ A;  3GV4 A;  5G04 B;  4S3O C;  2F6J A;  4R2Y A;  4MVT A;  4A4C A;  2ECI A;  3ASL A;  5G0F A;  4PTB A;  3O34 A;  2CKL A;  5KH7 A;  3SOX A;  2L75 A;  1K2F A;  2PUY A;  5H1V A;  5D1K B;  5C13 A;  1LDJ B;  2VNF A;  2G6Q A;  1WE9 A;  3O70 A;  2M3H A;  3GL6 A;  5G05 B;  3HTK C;  2YT5 A;  2MUM A;  2F6N A;  1Z6U A;  3N9N A;  4CCG X;  3KQI A;  4AUQ B;  5D1M B;  2H0D A;  2YSM A;  3N9P A;  4LJN A;  4I7C A;  3LRQ A;  4ZQL A;  1MM2 A;  1WES A;  1WEW A;  4YBS A;  2ZET C;  2G43 A;  3PHD A;  2KGI A;  2MD7 B;  2VJE B;  1VD4 A;  2RI7 A;  3ZYQ A;  3SOU A;  2ECV A;  1JM7 B;  4N3W A;  4PPE A;  1N87 A;  5TAB A;  1WEO A;  2LN0 A;  4QF3 A;  2AN6 A;  2QJ0 A;  3PUQ A;  2XB1 A;  3RPG B;  4WZ3 B;  4AVX A;  3SHB A;  4LAD B;  2JMJ A;  2KWJ A;  2F42 A;  4N4F A;  1HYI A;  2LGK A;  2LXH C;  2VPD A;  3C6W A;  5KH9 A;  1RMD A;  4FK5 A;  3HCU A;  2YRE A;  5TRB A;  2EOD A;  2LV9 A;  2E6R A;  2DX8 A;  2JMD A;  3O35 A;  3QZV A;  3O33 A;  4NN2 A;  3ZNI A;  1IYM A;  4AYC B;  2ECW A;  4C9Z A;  2K1J A;  3I2D A;  2MNY A;  2K17 A;  1MM3 A;  2M85 A;  3IHP A;  2JMI A;  4IC3 A;  2FUU A;  1BOR A;  4L7X A;  3N9M A;  5AIT A;  5J3X A;  3MHS A;  2YW8 A;  2YQL A;  3NG2 A;  2FUI A;  5B75 A;  4R7E A;  3T7L A;  4I7B A;  3V43 A;  1WEN A;  2YHN A;  2MT5 A;  5EYA F;  5B77 A;  5FER A;  5H1T A;  2ECG A;  4A4B A;  2C2L A;  2CKL B;  3N9L A;  5B78 A;  4YC9 A;  2Y43 A;  4TKP B;  2ECT A;  4A49 A;  1LDK C;  2K16 A;  4YBM A;  5TBN A;  4WZ0 A;  1G25 A;  3DPL R;  3T6R A;  4GNG A;  4ZDT A;  3RPG C;  3ZVY A;  2KWK A;  4Q6F A;  4QF2 A;  5H9M A;  4L58 A;  2M6M A;  2YSJ A;  5D1L B;  2LDR A;  1U6G B;  2QIZ A;  4W4U A;  3DQV R;  2FSA A;  2H0D B;  2L0B A;  4A0C D;  3KV6 A;  2KR4 A;  2Y1M A;  2EGP A;  3ZPV 1;  5H1U A;  3VK6 A;  2VPE A;  1WEV A;  1WGM A;  5FB1 A;  2KFT A;  4O64 A;  2HDP A;  1WIM A;  3U5P A;  3L1Z B;  5TDW A;  4B7Y C;  5LKU A;  4X3G A;  4LKA A;  2BAY A;  2NAA A;  4GNE A;  4XI1 A;  2HYE D;  4YAB A;  3U5O A;  3U5N A;  1WIL A;  1WEQ A;  2LGL A;  3L1X A;  4GNF A;  1DVP A;  2C2V S;  2KIZ A;  2MIQ A;  2ECN A;  2ECJ A;  4YAD A;  3FL2 A;  1X4I A;  2VJF A;  3M99 A;  2L5U A;  4FO9 A;  1FP0 A;  2LRI C;  5LKX A;  1XWH A;  2CT2 A;  4YAX A;  2KYU A;  5JG6 A;  3ZTG A;  1Z2Q A;  5I3L A;  2CSZ A;  2E6S A;  2LQ6 A;  3EB5 A;  3RTR B;  1WFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...