2L5UA

Structure of the first phd finger (phd1) from chd4 (mi2b)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
61
structure length
61
Chain Sequence
GPLGSYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plant Homeodomain (PHD) Fingers of CHD4 Are Histone H3-binding Modules with Preference for Unmodified H3K4 and Methylated H3K9
pubmed doi rcsb
molecule keywords Chromodomain-helicase-DNA-binding protein 4
molecule tags Metal binding protein
source organism Homo sapiens
total genus 8
structure length 61
sequence length 61
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2l5uA00
4N4FA 4YBSA 2ECIA 2FUIA 5FB1A 2KWJA 1WEVA 4AYCB 3C6WA 3EB5A 3LQIA 5B78A 2LDRA 2M6MA 1F62A 1X4IA 3M62A 4YADA 2LQ6A 1FBVA 3L11A 5DINA 1CHCA 2LGGA 1BORA 2YYRA 1G25A 4YATA 3SOWA 5G0FA 3KNVA 2QIZA 2EA6A 2Y43A 4IC2A 2ECJA 3RTRB 5FEYA 3GL6A 4O64A 2XB1A 2VP7A 2DX8A 2K1JA 4AP4A 3O35A 2VJEB 5TDRA 2CT2A 1WEOA 2MUMA 2E6RA 2YSJA 2VJFB 1WESA 2K17A 3T6RA 4GB0A 4NN2A 5DKAA 3O33A 1RMDA 1K2FA 3N9NA 4UP0A 4C9ZA 4R8PK 4WZ0A 4R7EA 3T7LA 2CSZA 4YBTA 4YBMA 2D8SA 3O34A 2LN0A 1MM2A 5G04B 2HYED 2L75A 2KWNA 4S3OB 4TKPB 1WEMA 1JM7B 3ZYQA 5D1LB 2MA6A 4V3KC 4IC3A 2VPGA 3SOUA 3HCUA 3DQVR 3MHSA 3KQIA 1HYIA 4LLBA 2FSAA 2UZGA 2C2LA 3LQJA 4QF3A 2ECTA 2KR4A 2I50A 2YHOA 2AN6A 1N87A 3N9PA 2VJEA 2G45A 4BBQA 5LKXA 2VJFA 2Y1MA 3ZVZB 2EODA 5EYAF 2KU3A 2NAAA 2E6SA 4R2YA 5AITA 5KH3A 2F6NA 2MT5A 4YABA 4X3GA 2MNZA 5TBNA 3RPGC 2VPDA 2LV9A 1FP0A 1Z6UA 3KV6A 3N9QA 4ZDTA 2F42A 4UP5A 2LRIC 4FJCA 2YQMA 2KIZA 1WILA 2RSDA 1T1HA 1X4JA 3QZVA 5H1TA 2KE1A 4LJNA 3HCSA 3RPGB 3N9OA 1JM7A 3N9LA 5C13A 2KREA 4L58A 2YSMA 3HTKC 3LRQA 5LKUA 4B7YC 1WEWA 5H9MA 3ZVYA 3SOXA 1WIMA 5LKZA 5KH7A 2L80A 1WENA 5B76A 1MM3A 2C2VS 2JMDA 4YC9A 1Z2QA 2MNYA 2EGPA 3KV5A 5H1VA 2L43A 4S3OC 3ZPV1 4ZUXU 4CCGX 2LXHC 2K16A 1LDJB 2YU4A 2ECGA 2YUCA 3U5PA 3N9MA 4A49A 5B77A 2ECWA 2FUUA 4Q6FA 1LDKC 3SHBA 1VFYA 1WEEA 1IYMA 4I7BA 4B86C 3MHHA 5FERA 2KWKA 3ASLA 3V43A 2G6QA 1U6GB 1HYJA 1JOCA 5B8DA 1Z60A 2MA5A 5I3LA 3PURA 5LCWB 4XI1A 1WEPA 3M99A 4LKAA 2MIQA 4ZQLA 1WE9A 4GNEA 2L0BA 2YREA 2JMJA 3LQHA 3NG2A 4AUQB 2KGIA 2CSYA 2LGVA 1WGMA 3EB6A 3C5KA 3PHDA 5TDWA 5TRBA 5H1UA 2YHNA 4A4CA 4I7CA 4GNGA 5J3XA 1ZBDB 1VD4A 2MD8C 3GV4A 3U5OA 2JRJA 2LGKA 3DPLR 2ECVA 2YW8A 4BHWA 4L7XA 4P5OB 2CKLB 2G43A 2YQLA 2Y1NA 3U5MA 1V87A 2RI7A 4AVXA 2K4DA 2JMIA 4GNDA 2OXQC 4CA1A 5JG6A 4WZ3B 2MD7B 3I2DA 5KH9A 4F52B 3M63A 2BAYA 4I7DA 1E4UA 1XWHA 3L1ZB 4WA6A 4LK9A 4FO9A 4V3LC 3L1XA 4YAXA 1X4UA 4QF2A 1WEQA 4LADB 3O70A 5C11A 2YURA 2M85A 2PNXA 3O7AA 3ZTGA 4WZ2A 2ECNA 2IDAA 2H0DA 5AIUA 1DVPA 3VK6A 1WEUA 5LKTA 5G05B 2VPBA 2PUYA 3FL2A 3ZNIA 5D1MB 2LGLA 2HDPA 4MSXA 2M3HA 3PUQA 2YT5A 5B75A 2CKLA 4AYCA 2ZETC 1WFKA 1VYXA 2LXPC 2XEUA 5D1KB 3IHPA 3O36A 2VPEA 4GNFA 2KFTA 4PPEA 2L5UA 2M1RA 2KWOA 2QJ0A 4W4UA 4A4BA 2QICA 4FK5A 5FB0A 3U5NA 3HCTA 2VNFA 2KYUA 2H0DB 4FIPA 4MVTA 4N3WA 4UI9B 3O37A 4A0CD 2KGGA 5B79A 3ZPVE 4PTBA 2F6JA 5TABA
chains in the Genus database with same CATH superfamily
4N4FA 4YBSA 2ECIA 2FUIA 5FB1A 2KWJA 2DJAA 1WEVA 4AYCB 3C6WA 3EB5A 3LQIA 5B78A 1DCQA 2LDRA 2M6MA 1F62A 1X4IA 3M62A 4YADA 2LQ6A 1FBVA 3L11A 5DINA 1CHCA 2LGGA 1BORA 2YYRA 1G25A 4YATA 3SOWA 5G0FA 3KNVA 2QIZA 2EA6A 2Y43A 4IC2A 2ECJA 3RTRB 3JUEA 5FEYA 3M7KA 3GL6A 4O64A 2XB1A 2VP7A 2DX8A 2K1JA 4AP4A 3O35A 2VJEB 5TDRA 2CT2A 1WEOA 2MUMA 2E6RA 2YSJA 2VJFB 1WESA 2K17A 3T6RA 4GB0A 4NN2A 2M13A 5DKAA 3O33A 1RMDA 1K2FA 3N9NA 4UP0A 4C9ZA 4R8PK 4WZ0A 4R7EA 3T7LA 2CSZA 3H7HA 4YBTA 4YBMA 2D8SA 3O34A 2XOCA 2LN0A 1MM2A 5G04B 2HYED 2L75A 2KWNA 2XP0A 4S3OB 2LAUA 4TKPB 3FAOA 1WEMA 1JM7B 3ZYQA 5D1LB 2MA6A 4V3KC 4IC3A 1MBMA 2VPGA 3SOUA 3FEHA 3HCUA 3DQVR 3MHSA 3KQIA 3O47A 1HYIA 4LLBA 2FSAA 2UZGA 2C2LA 3LQJA 4QF3A 2ECTA 2KR4A 3E2DA 2I50A 2YHOA 2AN6A 1N87A 3N9PA 4Z0RA 2VJEA 2JUNA 2G45A 4BBQA 3KDEC 5LKXA 2VJFA 2Y1MA 3ZVZB 2EODA 3Q1DA 5EYAF 2KU3A 2NAAA 2E6SA 4R2YA 5AITA 5KH3A 2FFWA 2F6NA 2CSVA 2B0OE 2MT5A 4YABA 4X3GA 2MNZA 5TBNA 3RPGC 2VPDA 2LV9A 1FP0A 1Z6UA 3KV6A 3N9QA 4ZDTA 2F42A 4UP5A 2LRIC 4FJCA 2YQMA 2KIZA 1WILA 2RR4A 2RSDA 1T1HA 1X4JA 3QZVA 5H1TA 2KE1A 3LVRE 4LJNA 3HCSA 3RPGB 3N9OA 1JM7A 3N9LA 5C13A 2KREA 4L58A 2YSMA 3HTKC 3LRQA 5LKUA 4B7YC 3SUBA 1WEWA 5H9MA 3ZVYA 3SOXA 1WIMA 2MKEA 5LKZA 5KH7A 2L80A 1WENA 4H9DA 5B76A 1MM3A 2C2VS 2JMDA 4YC9A 1Z2QA 2MNYA 2EGPA 3KV5A 5H1VA 2L43A 2L7PA 4S3OC 3ZPV1 4ZUXU 4CCGX 2LXHC 2K16A 1LDJB 2YU4A 2ECGA 2YUCA 3U5PA 3N9MA 3FM8C 4A49A 5B77A 2ECWA 2FUUA 4Q6FA 1LDKC 3SHBA 1VFYA 1WEEA 1IYMA 4I7BA 4B86C 2OWAA 3MHHA 3DDTA 5FERA 2KWKA 3ASLA 3LVQE 3V43A 1U6GB 2G6QA 1HYJA 1JOCA 5B8DA 2E61A 4F1PA 1Z60A 2MA5A 5SVYA 5I3LA 3PURA 2FD4A 5LCWB 4XI1A 1WEPA 2YVRA 3M99A 4LKAA 2MIQA 4ZQLA 1WE9A 4GNEA 2L0BA 2YREA 2JMJA 3LQHA 3NG2A 4AUQB 2KGIA 2CSYA 2LGVA 1WGMA 2KKXA 2P57A 3EB6A 3C5KA 3PHDA 5TDWA 2IQJA 5TRBA 5H1UA 2YHNA 4A4CA 4I7CA 4GNGA 5J3XA 1ZBDB 1VD4A 2MD8C 3GV4A 3U5OA 2JRJA 2LGKA 2XOYA 3DPLR 2ECVA 2YW8A 4BHWA 4L7XA 4P5OB 2CKLB 2CRWA 2G43A 2YQLA 2Y1NA 3U5MA 1V87A 2RI7A 5SVXA 4AVXA 2K4DA 4Z0OA 2JMIA 4GNDA 2OXQC 4CA1A 5JG6A 3MDBC 4QQ4A 4WZ3B 2MD7B 3I2DA 5KH9A 4F52B 3M63A 2EXUA 2BAYA 3PLWA 4I7DA 2XOZA 1E4UA 1XWHA 3L1ZB 4WA6A 4LK9A 2CONA 4FO9A 2JM3A 4V3LC 3LDYA 3L1XA 4OGEA 4YAXA 1X4UA 5SVIB 2EGMA 4QF2A 3FANA 4LADB 1WEQA 3O70A 5C11A 2YURA 2M85A 2PNXA 3O7AA 3ZTGA 4WZ2A 2ECNA 2IDAA 2H0DA 5AIUA 1DVPA 3VK6A 1WEUA 5LKTA 5G05B 2VPBA 2PUYA 5K3QA 3FL2A 3ZNIA 5D1MB 2LGLA 2HDPA 4MSXA 4OGCA 2M3HA 3PUQA 2YT5A 2DSMA 3T9KA 3DWDA 5B75A 2D8UA 2CKLA 4O62A 4AYCA 2ZETC 3FJUB 1WFKA 1VYXA 2LXPC 2XEUA 5D1KB 3IHPA 3O36A 2VPEA 4GNFA 2KFTA 4PPEA 2KKYA 2L5UA 2M1RA 2KWOA 2QJ0A 4W4UA 4A4BA 2QICA 4FK5A 5FB0A 3U5NA 3HCTA 2VNFA 2KYUA 2H0DB 3LJUX 4FIPA 4MVTA 4N3WA 4UI9B 3O37A 4A0CD 2KGGA 5B79A 3ZPVE 4PTBA 2CRRA 2F6JA 5SVIA 5TABA
chains in the Genus database with same CATH topology
4N4FA 4YBSA 2ECIA 2FUIA 5FB1A 2KWJA 1WEVA 4AYCB 3C6WA 3EB5A 3LQIA 5B78A 2LDRA 2M6MA 1F62A 1X4IA 3M62A 4YADA 2LQ6A 1FBVA 3L11A 5DINA 1CHCA 2LGGA 1BORA 2YYRA 1G25A 4YATA 3SOWA 5G0FA 3KNVA 2QIZA 2EA6A 2Y43A 4IC2A 2ECJA 3RTRB 5FEYA 3GL6A 4O64A 2XB1A 2VP7A 2DX8A 2K1JA 4AP4A 3O35A 2VJEB 5TDRA 2CT2A 1WEOA 2MUMA 2E6RA 2YSJA 2VJFB 1WESA 2K17A 3T6RA 4GB0A 4NN2A 5DKAA 3O33A 1RMDA 1K2FA 3N9NA 4UP0A 4C9ZA 4R8PK 4WZ0A 4R7EA 3T7LA 2CSZA 4YBTA 4YBMA 2D8SA 3O34A 2LN0A 1MM2A 5G04B 2HYED 2L75A 2KWNA 4S3OB 4TKPB 1WEMA 1JM7B 3ZYQA 5D1LB 2MA6A 4V3KC 4IC3A 2VPGA 3SOUA 3HCUA 3DQVR 3MHSA 3KQIA 1HYIA 4LLBA 2FSAA 2UZGA 2C2LA 3LQJA 4QF3A 2ECTA 2KR4A 2I50A 2YHOA 2AN6A 1N87A 3N9PA 2VJEA 2G45A 4BBQA 5LKXA 2VJFA 2Y1MA 3ZVZB 2EODA 5EYAF 2KU3A 2NAAA 2E6SA 4R2YA 5AITA 5KH3A 2F6NA 2MT5A 4YABA 4X3GA 2MNZA 5TBNA 3RPGC 2VPDA 2LV9A 1FP0A 1Z6UA 3KV6A 3N9QA 4ZDTA 2F42A 4UP5A 2LRIC 4FJCA 2YQMA 2KIZA 1WILA 2RSDA 1T1HA 1X4JA 3QZVA 5H1TA 2KE1A 4LJNA 3HCSA 3RPGB 3N9OA 1JM7A 3N9LA 5C13A 2KREA 4L58A 2YSMA 3HTKC 3LRQA 5LKUA 4B7YC 1WEWA 5H9MA 3ZVYA 3SOXA 1WIMA 5LKZA 5KH7A 2L80A 1WENA 5B76A 1MM3A 2C2VS 2JMDA 4YC9A 1Z2QA 2MNYA 2EGPA 3KV5A 5H1VA 2L43A 4S3OC 3ZPV1 4ZUXU 4CCGX 2LXHC 2K16A 1LDJB 2YU4A 2ECGA 2YUCA 3U5PA 3N9MA 4A49A 5B77A 2ECWA 2FUUA 4Q6FA 1LDKC 3SHBA 1VFYA 1WEEA 1IYMA 4I7BA 4B86C 3MHHA 5FERA 2KWKA 3ASLA 3V43A 2G6QA 1U6GB 1HYJA 1JOCA 5B8DA 1Z60A 2MA5A 5I3LA 3PURA 5LCWB 4XI1A 1WEPA 3M99A 4LKAA 2MIQA 4ZQLA 1WE9A 4GNEA 2L0BA 2YREA 2JMJA 3LQHA 3NG2A 4AUQB 2KGIA 2CSYA 2LGVA 1WGMA 3EB6A 3C5KA 3PHDA 5TDWA 5TRBA 5H1UA 2YHNA 4A4CA 4I7CA 4GNGA 5J3XA 1ZBDB 1VD4A 2MD8C 3GV4A 3U5OA 2JRJA 2LGKA 3DPLR 2ECVA 2YW8A 4BHWA 4L7XA 4P5OB 2CKLB 2G43A 2YQLA 2Y1NA 3U5MA 1V87A 2RI7A 4AVXA 2K4DA 2JMIA 4GNDA 2OXQC 4CA1A 5JG6A 4WZ3B 2MD7B 3I2DA 5KH9A 4F52B 3M63A 2BAYA 4I7DA 1E4UA 1XWHA 3L1ZB 4WA6A 4LK9A 4FO9A 4V3LC 3L1XA 4YAXA 1X4UA 4QF2A 1WEQA 4LADB 3O70A 5C11A 2YURA 2M85A 2PNXA 3O7AA 3ZTGA 4WZ2A 2ECNA 2IDAA 2H0DA 5AIUA 1DVPA 3VK6A 1WEUA 5LKTA 5G05B 2VPBA 2PUYA 3FL2A 3ZNIA 5D1MB 2LGLA 2HDPA 4MSXA 2M3HA 3PUQA 2YT5A 5B75A 2CKLA 4AYCA 2ZETC 1WFKA 1VYXA 2LXPC 2XEUA 5D1KB 3IHPA 3O36A 2VPEA 4GNFA 2KFTA 4PPEA 2L5UA 2M1RA 2KWOA 2QJ0A 4W4UA 4A4BA 2QICA 4FK5A 5FB0A 3U5NA 3HCTA 2VNFA 2KYUA 2H0DB 4FIPA 4MVTA 4N3WA 4UI9B 3O37A 4A0CD 2KGGA 5B79A 3ZPVE 4PTBA 2F6JA 5TABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4F A;  4YBS A;  2ECI A;  2FUI A;  5FB1 A;  2KWJ A;  1WEV A;  4AYC B;  3C6W A;  3EB5 A;  3LQI A;  5B78 A;  2LDR A;  2M6M A;  1F62 A;  1X4I A;  3M62 A;  4YAD A;  2LQ6 A;  1FBV A;  3L11 A;  5DIN A;  1CHC A;  2LGG A;  1BOR A;  2YYR A;  1G25 A;  4YAT A;  3SOW A;  5G0F A;  3KNV A;  2QIZ A;  2EA6 A;  2Y43 A;  4IC2 A;  2ECJ A;  3RTR B;  5FEY A;  3GL6 A;  4O64 A;  2XB1 A;  2VP7 A;  2DX8 A;  2K1J A;  4AP4 A;  3O35 A;  2VJE B;  5TDR A;  2CT2 A;  1WEO A;  2MUM A;  2E6R A;  2YSJ A;  2VJF B;  1WES A;  2K17 A;  3T6R A;  4GB0 A;  4NN2 A;  5DKA A;  3O33 A;  1RMD A;  1K2F A;  3N9N A;  4UP0 A;  4C9Z A;  4R8P K;  4WZ0 A;  4R7E A;  3T7L A;  2CSZ A;  4YBT A;  4YBM A;  2D8S A;  3O34 A;  2LN0 A;  1MM2 A;  5G04 B;  2HYE D;  2L75 A;  2KWN A;  4S3O B;  4TKP B;  1WEM A;  1JM7 B;  3ZYQ A;  5D1L B;  2MA6 A;  4V3K C;  4IC3 A;  2VPG A;  3SOU A;  3HCU A;  3DQV R;  3MHS A;  3KQI A;  1HYI A;  4LLB A;  2FSA A;  2UZG A;  2C2L A;  3LQJ A;  4QF3 A;  2ECT A;  2KR4 A;  2I50 A;  2YHO A;  2AN6 A;  1N87 A;  3N9P A;  2VJE A;  2G45 A;  4BBQ A;  5LKX A;  2VJF A;  2Y1M A;  3ZVZ B;  2EOD A;  5EYA F;  2KU3 A;  2NAA A;  2E6S A;  4R2Y A;  5AIT A;  5KH3 A;  2F6N A;  2MT5 A;  4YAB A;  4X3G A;  2MNZ A;  5TBN A;  3RPG C;  2VPD A;  2LV9 A;  1FP0 A;  1Z6U A;  3KV6 A;  3N9Q A;  4ZDT A;  2F42 A;  4UP5 A;  2LRI C;  4FJC A;  2YQM A;  2KIZ A;  1WIL A;  2RSD A;  1T1H A;  1X4J A;  3QZV A;  5H1T A;  2KE1 A;  4LJN A;  3HCS A;  3RPG B;  3N9O A;  1JM7 A;  3N9L A;  5C13 A;  2KRE A;  4L58 A;  2YSM A;  3HTK C;  3LRQ A;  5LKU A;  4B7Y C;  1WEW A;  5H9M A;  3ZVY A;  3SOX A;  1WIM A;  5LKZ A;  5KH7 A;  2L80 A;  1WEN A;  5B76 A;  1MM3 A;  2C2V S;  2JMD A;  4YC9 A;  1Z2Q A;  2MNY A;  2EGP A;  3KV5 A;  5H1V A;  2L43 A;  4S3O C;  3ZPV 1;  4ZUX U;  4CCG X;  2LXH C;  2K16 A;  1LDJ B;  2YU4 A;  2ECG A;  2YUC A;  3U5P A;  3N9M A;  4A49 A;  5B77 A;  2ECW A;  2FUU A;  4Q6F A;  1LDK C;  3SHB A;  1VFY A;  1WEE A;  1IYM A;  4I7B A;  4B86 C;  3MHH A;  5FER A;  2KWK A;  3ASL A;  3V43 A;  2G6Q A;  1U6G B;  1HYJ A;  1JOC A;  5B8D A;  1Z60 A;  2MA5 A;  5I3L A;  3PUR A;  5LCW B;  4XI1 A;  1WEP A;  3M99 A;  4LKA A;  2MIQ A;  4ZQL A;  1WE9 A;  4GNE A;  2L0B A;  2YRE A;  2JMJ A;  3LQH A;  3NG2 A;  4AUQ B;  2KGI A;  2CSY A;  2LGV A;  1WGM A;  3EB6 A;  3C5K A;  3PHD A;  5TDW A;  5TRB A;  5H1U A;  2YHN A;  4A4C A;  4I7C A;  4GNG A;  5J3X A;  1ZBD B;  1VD4 A;  2MD8 C;  3GV4 A;  3U5O A;  2JRJ A;  2LGK A;  3DPL R;  2ECV A;  2YW8 A;  4BHW A;  4L7X A;  4P5O B;  2CKL B;  2G43 A;  2YQL A;  2Y1N A;  3U5M A;  1V87 A;  2RI7 A;  4AVX A;  2K4D A;  2JMI A;  4GND A;  2OXQ C;  4CA1 A;  5JG6 A;  4WZ3 B;  2MD7 B;  3I2D A;  5KH9 A;  4F52 B;  3M63 A;  2BAY A;  4I7D A;  1E4U A;  1XWH A;  3L1Z B;  4WA6 A;  4LK9 A;  4FO9 A;  4V3L C;  3L1X A;  4YAX A;  1X4U A;  4QF2 A;  1WEQ A;  4LAD B;  3O70 A;  5C11 A;  2YUR A;  2M85 A;  2PNX A;  3O7A A;  3ZTG A;  4WZ2 A;  2ECN A;  2IDA A;  2H0D A;  5AIU A;  1DVP A;  3VK6 A;  1WEU A;  5LKT A;  5G05 B;  2VPB A;  2PUY A;  3FL2 A;  3ZNI A;  5D1M B;  2LGL A;  2HDP A;  4MSX A;  2M3H A;  3PUQ A;  2YT5 A;  5B75 A;  2CKL A;  4AYC A;  2ZET C;  1WFK A;  1VYX A;  2LXP C;  2XEU A;  5D1K B;  3IHP A;  3O36 A;  2VPE A;  4GNF A;  2KFT A;  4PPE A;  2L5U A;  2M1R A;  2KWO A;  2QJ0 A;  4W4U A;  4A4B A;  2QIC A;  4FK5 A;  5FB0 A;  3U5N A;  3HCT A;  2VNF A;  2KYU A;  2H0D B;  4FIP A;  4MVT A;  4N3W A;  4UI9 B;  3O37 A;  4A0C D;  2KGG A;  5B79 A;  3ZPV E;  4PTB A;  2F6J A;  5TAB A; 
#chains in the Genus database with same CATH topology
 4N4F A;  4YBS A;  2ECI A;  2FUI A;  5FB1 A;  2KWJ A;  2DJA A;  1WEV A;  4AYC B;  3C6W A;  3EB5 A;  3LQI A;  5B78 A;  1DCQ A;  2LDR A;  2M6M A;  1F62 A;  1X4I A;  3M62 A;  4YAD A;  2LQ6 A;  1FBV A;  3L11 A;  5DIN A;  1CHC A;  2LGG A;  1BOR A;  2YYR A;  1G25 A;  4YAT A;  3SOW A;  5G0F A;  3KNV A;  2QIZ A;  2EA6 A;  2Y43 A;  4IC2 A;  2ECJ A;  3RTR B;  3JUE A;  5FEY A;  3M7K A;  3GL6 A;  4O64 A;  2XB1 A;  2VP7 A;  2DX8 A;  2K1J A;  4AP4 A;  3O35 A;  2VJE B;  5TDR A;  2CT2 A;  1WEO A;  2MUM A;  2E6R A;  2YSJ A;  2VJF B;  1WES A;  2K17 A;  3T6R A;  4GB0 A;  4NN2 A;  2M13 A;  5DKA A;  3O33 A;  1RMD A;  1K2F A;  3N9N A;  4UP0 A;  4C9Z A;  4R8P K;  4WZ0 A;  4R7E A;  3T7L A;  2CSZ A;  3H7H A;  4YBT A;  4YBM A;  2D8S A;  3O34 A;  2XOC A;  2LN0 A;  1MM2 A;  5G04 B;  2HYE D;  2L75 A;  2KWN A;  2XP0 A;  4S3O B;  2LAU A;  4TKP B;  3FAO A;  1WEM A;  1JM7 B;  3ZYQ A;  5D1L B;  2MA6 A;  4V3K C;  4IC3 A;  1MBM A;  2VPG A;  3SOU A;  3FEH A;  3HCU A;  3DQV R;  3MHS A;  3KQI A;  3O47 A;  1HYI A;  4LLB A;  2FSA A;  2UZG A;  2C2L A;  3LQJ A;  4QF3 A;  2ECT A;  2KR4 A;  3E2D A;  2I50 A;  2YHO A;  2AN6 A;  1N87 A;  3N9P A;  4Z0R A;  2VJE A;  2JUN A;  2G45 A;  4BBQ A;  3KDE C;  5LKX A;  2VJF A;  2Y1M A;  3ZVZ B;  2EOD A;  3Q1D A;  5EYA F;  2KU3 A;  2NAA A;  2E6S A;  4R2Y A;  5AIT A;  5KH3 A;  2FFW A;  2F6N A;  2CSV A;  2B0O E;  2MT5 A;  4YAB A;  4X3G A;  2MNZ A;  5TBN A;  3RPG C;  2VPD A;  2LV9 A;  1FP0 A;  1Z6U A;  3KV6 A;  3N9Q A;  4ZDT A;  2F42 A;  4UP5 A;  2LRI C;  4FJC A;  2YQM A;  2KIZ A;  1WIL A;  2RR4 A;  2RSD A;  1T1H A;  1X4J A;  3QZV A;  5H1T A;  2KE1 A;  3LVR E;  4LJN A;  3HCS A;  3RPG B;  3N9O A;  1JM7 A;  3N9L A;  5C13 A;  2KRE A;  4L58 A;  2YSM A;  3HTK C;  3LRQ A;  5LKU A;  4B7Y C;  3SUB A;  1WEW A;  5H9M A;  3ZVY A;  3SOX A;  1WIM A;  2MKE A;  5LKZ A;  5KH7 A;  2L80 A;  1WEN A;  4H9D A;  5B76 A;  1MM3 A;  2C2V S;  2JMD A;  4YC9 A;  1Z2Q A;  2MNY A;  2EGP A;  3KV5 A;  5H1V A;  2L43 A;  2L7P A;  4S3O C;  3ZPV 1;  4ZUX U;  4CCG X;  2LXH C;  2K16 A;  1LDJ B;  2YU4 A;  2ECG A;  2YUC A;  3U5P A;  3N9M A;  3FM8 C;  4A49 A;  5B77 A;  2ECW A;  2FUU A;  4Q6F A;  1LDK C;  3SHB A;  1VFY A;  1WEE A;  1IYM A;  4I7B A;  4B86 C;  2OWA A;  3MHH A;  3DDT A;  5FER A;  2KWK A;  3ASL A;  3LVQ E;  3V43 A;  1U6G B;  2G6Q A;  1HYJ A;  1JOC A;  5B8D A;  2E61 A;  4F1P A;  1Z60 A;  2MA5 A;  5SVY A;  5I3L A;  3PUR A;  2FD4 A;  5LCW B;  4XI1 A;  1WEP A;  2YVR A;  3M99 A;  4LKA A;  2MIQ A;  4ZQL A;  1WE9 A;  4GNE A;  2L0B A;  2YRE A;  2JMJ A;  3LQH A;  3NG2 A;  4AUQ B;  2KGI A;  2CSY A;  2LGV A;  1WGM A;  2KKX A;  2P57 A;  3EB6 A;  3C5K A;  3PHD A;  5TDW A;  2IQJ A;  5TRB A;  5H1U A;  2YHN A;  4A4C A;  4I7C A;  4GNG A;  5J3X A;  1ZBD B;  1VD4 A;  2MD8 C;  3GV4 A;  3U5O A;  2JRJ A;  2LGK A;  2XOY A;  3DPL R;  2ECV A;  2YW8 A;  4BHW A;  4L7X A;  4P5O B;  2CKL B;  2CRW A;  2G43 A;  2YQL A;  2Y1N A;  3U5M A;  1V87 A;  2RI7 A;  5SVX A;  4AVX A;  2K4D A;  4Z0O A;  2JMI A;  4GND A;  2OXQ C;  4CA1 A;  5JG6 A;  3MDB C;  4QQ4 A;  4WZ3 B;  2MD7 B;  3I2D A;  5KH9 A;  4F52 B;  3M63 A;  2EXU A;  2BAY A;  3PLW A;  4I7D A;  2XOZ A;  1E4U A;  1XWH A;  3L1Z B;  4WA6 A;  4LK9 A;  2CON A;  4FO9 A;  2JM3 A;  4V3L C;  3LDY A;  3L1X A;  4OGE A;  4YAX A;  1X4U A;  5SVI B;  2EGM A;  4QF2 A;  3FAN A;  4LAD B;  1WEQ A;  3O70 A;  5C11 A;  2YUR A;  2M85 A;  2PNX A;  3O7A A;  3ZTG A;  4WZ2 A;  2ECN A;  2IDA A;  2H0D A;  5AIU A;  1DVP A;  3VK6 A;  1WEU A;  5LKT A;  5G05 B;  2VPB A;  2PUY A;  5K3Q A;  3FL2 A;  3ZNI A;  5D1M B;  2LGL A;  2HDP A;  4MSX A;  4OGC A;  2M3H A;  3PUQ A;  2YT5 A;  2DSM A;  3T9K A;  3DWD A;  5B75 A;  2D8U A;  2CKL A;  4O62 A;  4AYC A;  2ZET C;  3FJU B;  1WFK A;  1VYX A;  2LXP C;  2XEU A;  5D1K B;  3IHP A;  3O36 A;  2VPE A;  4GNF A;  2KFT A;  4PPE A;  2KKY A;  2L5U A;  2M1R A;  2KWO A;  2QJ0 A;  4W4U A;  4A4B A;  2QIC A;  4FK5 A;  5FB0 A;  3U5N A;  3HCT A;  2VNF A;  2KYU A;  2H0D B;  3LJU X;  4FIP A;  4MVT A;  4N3W A;  4UI9 B;  3O37 A;  4A0C D;  2KGG A;  5B79 A;  3ZPV E;  4PTB A;  2CRR A;  2F6J A;  5SVI A;  5TAB A; 
#chains in the Genus database with same CATH homology
 4N4F A;  4YBS A;  2ECI A;  2FUI A;  5FB1 A;  2KWJ A;  1WEV A;  4AYC B;  3C6W A;  3EB5 A;  3LQI A;  5B78 A;  2LDR A;  2M6M A;  1F62 A;  1X4I A;  3M62 A;  4YAD A;  2LQ6 A;  1FBV A;  3L11 A;  5DIN A;  1CHC A;  2LGG A;  1BOR A;  2YYR A;  1G25 A;  4YAT A;  3SOW A;  5G0F A;  3KNV A;  2QIZ A;  2EA6 A;  2Y43 A;  4IC2 A;  2ECJ A;  3RTR B;  5FEY A;  3GL6 A;  4O64 A;  2XB1 A;  2VP7 A;  2DX8 A;  2K1J A;  4AP4 A;  3O35 A;  2VJE B;  5TDR A;  2CT2 A;  1WEO A;  2MUM A;  2E6R A;  2YSJ A;  2VJF B;  1WES A;  2K17 A;  3T6R A;  4GB0 A;  4NN2 A;  5DKA A;  3O33 A;  1RMD A;  1K2F A;  3N9N A;  4UP0 A;  4C9Z A;  4R8P K;  4WZ0 A;  4R7E A;  3T7L A;  2CSZ A;  4YBT A;  4YBM A;  2D8S A;  3O34 A;  2LN0 A;  1MM2 A;  5G04 B;  2HYE D;  2L75 A;  2KWN A;  4S3O B;  4TKP B;  1WEM A;  1JM7 B;  3ZYQ A;  5D1L B;  2MA6 A;  4V3K C;  4IC3 A;  2VPG A;  3SOU A;  3HCU A;  3DQV R;  3MHS A;  3KQI A;  1HYI A;  4LLB A;  2FSA A;  2UZG A;  2C2L A;  3LQJ A;  4QF3 A;  2ECT A;  2KR4 A;  2I50 A;  2YHO A;  2AN6 A;  1N87 A;  3N9P A;  2VJE A;  2G45 A;  4BBQ A;  5LKX A;  2VJF A;  2Y1M A;  3ZVZ B;  2EOD A;  5EYA F;  2KU3 A;  2NAA A;  2E6S A;  4R2Y A;  5AIT A;  5KH3 A;  2F6N A;  2MT5 A;  4YAB A;  4X3G A;  2MNZ A;  5TBN A;  3RPG C;  2VPD A;  2LV9 A;  1FP0 A;  1Z6U A;  3KV6 A;  3N9Q A;  4ZDT A;  2F42 A;  4UP5 A;  2LRI C;  4FJC A;  2YQM A;  2KIZ A;  1WIL A;  2RSD A;  1T1H A;  1X4J A;  3QZV A;  5H1T A;  2KE1 A;  4LJN A;  3HCS A;  3RPG B;  3N9O A;  1JM7 A;  3N9L A;  5C13 A;  2KRE A;  4L58 A;  2YSM A;  3HTK C;  3LRQ A;  5LKU A;  4B7Y C;  1WEW A;  5H9M A;  3ZVY A;  3SOX A;  1WIM A;  5LKZ A;  5KH7 A;  2L80 A;  1WEN A;  5B76 A;  1MM3 A;  2C2V S;  2JMD A;  4YC9 A;  1Z2Q A;  2MNY A;  2EGP A;  3KV5 A;  5H1V A;  2L43 A;  4S3O C;  3ZPV 1;  4ZUX U;  4CCG X;  2LXH C;  2K16 A;  1LDJ B;  2YU4 A;  2ECG A;  2YUC A;  3U5P A;  3N9M A;  4A49 A;  5B77 A;  2ECW A;  2FUU A;  4Q6F A;  1LDK C;  3SHB A;  1VFY A;  1WEE A;  1IYM A;  4I7B A;  4B86 C;  3MHH A;  5FER A;  2KWK A;  3ASL A;  3V43 A;  2G6Q A;  1U6G B;  1HYJ A;  1JOC A;  5B8D A;  1Z60 A;  2MA5 A;  5I3L A;  3PUR A;  5LCW B;  4XI1 A;  1WEP A;  3M99 A;  4LKA A;  2MIQ A;  4ZQL A;  1WE9 A;  4GNE A;  2L0B A;  2YRE A;  2JMJ A;  3LQH A;  3NG2 A;  4AUQ B;  2KGI A;  2CSY A;  2LGV A;  1WGM A;  3EB6 A;  3C5K A;  3PHD A;  5TDW A;  5TRB A;  5H1U A;  2YHN A;  4A4C A;  4I7C A;  4GNG A;  5J3X A;  1ZBD B;  1VD4 A;  2MD8 C;  3GV4 A;  3U5O A;  2JRJ A;  2LGK A;  3DPL R;  2ECV A;  2YW8 A;  4BHW A;  4L7X A;  4P5O B;  2CKL B;  2G43 A;  2YQL A;  2Y1N A;  3U5M A;  1V87 A;  2RI7 A;  4AVX A;  2K4D A;  2JMI A;  4GND A;  2OXQ C;  4CA1 A;  5JG6 A;  4WZ3 B;  2MD7 B;  3I2D A;  5KH9 A;  4F52 B;  3M63 A;  2BAY A;  4I7D A;  1E4U A;  1XWH A;  3L1Z B;  4WA6 A;  4LK9 A;  4FO9 A;  4V3L C;  3L1X A;  4YAX A;  1X4U A;  4QF2 A;  1WEQ A;  4LAD B;  3O70 A;  5C11 A;  2YUR A;  2M85 A;  2PNX A;  3O7A A;  3ZTG A;  4WZ2 A;  2ECN A;  2IDA A;  2H0D A;  5AIU A;  1DVP A;  3VK6 A;  1WEU A;  5LKT A;  5G05 B;  2VPB A;  2PUY A;  3FL2 A;  3ZNI A;  5D1M B;  2LGL A;  2HDP A;  4MSX A;  2M3H A;  3PUQ A;  2YT5 A;  5B75 A;  2CKL A;  4AYC A;  2ZET C;  1WFK A;  1VYX A;  2LXP C;  2XEU A;  5D1K B;  3IHP A;  3O36 A;  2VPE A;  4GNF A;  2KFT A;  4PPE A;  2L5U A;  2M1R A;  2KWO A;  2QJ0 A;  4W4U A;  4A4B A;  2QIC A;  4FK5 A;  5FB0 A;  3U5N A;  3HCT A;  2VNF A;  2KYU A;  2H0D B;  4FIP A;  4MVT A;  4N3W A;  4UI9 B;  3O37 A;  4A0C D;  2KGG A;  5B79 A;  3ZPV E;  4PTB A;  2F6J A;  5TAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...