1E4UA

N-terminal ring finger domain of human not-4
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
78
structure length
78
Chain Sequence
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the C4C4 Ring Finger of Human not4 Reveals Features Distinct from Those of C3Hc4 Ring Fingers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords TRANSCRIPTIONAL REPRESSOR NOT4
total genus 4
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14570 zf-RING_4 RING/Ubox like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1e4uA00
2JMJA 2ECGA 4YABA 2YT5A 5TABA 4FO9A 2MUMA 3O70A 2MT5A 4C9ZA 4UP0A 1HYJA 1Z2QA 1DVPA 5B78A 2KFTA 3HCSA 2FUUA 3MHSA 2YQLA 5FEYA 5TDRA 4GNFA 2KWJA 2ZETC 2KR4A 2KGIA 3L1XA 1WEUA 3FL2A 1JM7B 4XI1A 2F42A 3LQIA 2LRIC 1JOCA 3L1ZB 1JM7A 3ZPVE 2HDPA 2CKLB 2ECTA 2QJ0A 2DX8A 3M99A 1WEQA 3V43A 1FBVA 2YHNA 4CCGX 4ZQLA 2KGGA 4ZDTA 2AN6A 2M1RA 3M63A 4MSXA 4P5OB 2HYED 4V3KC 1WEEA 5I3LA 3PUQA 4LK9A 5FB1A 4QF3A 2OXQC 1U6GB 4AYCA 5AIUA 2G6QA 3PHDA 4WZ0A 4AP4A 2XB1A 4Q6FA 2YREA 2H0DA 5H1TA 3HCUA 5TDWA 2LGKA 3MHHA 2YYRA 3LQJA 2ECIA 5LKZA 1WILA 4FJCA 3O36A 5J3XA 4R2YA 2ECJA 3O37A 2LGGA 1Z6UA 3HTKC 4O64A 5H1UA 2CSZA 3N9MA 2MD7B 3T6RA 2G45A 4F52B 4WA6A 2LGLA 1WEVA 4A4BA 4R7EA 2ECWA 1RMDA 5B79A 4YATA 2RI7A 5D1LB 4FK5A 4FIPA 3QZVA 1WFKA 2K17A 3SHBA 2LQ6A 2ECNA 4W4UA 3RPGB 1WEPA 4YC9A 5H1VA 3ZPV1 1X4IA 3N9QA 2VJEA 4CA1A 5TRBA 1BORA 5B75A 2RSDA 5DINA 1WEMA 4L58A 5AITA 5DKAA 3U5OA 2FUIA 5KH3A 5FB0A 2K16A 2M3HA 2K1JA 3C6WA 5B8DA 2VPDA 4WZ2A 1VYXA 5D1KB 3EB5A 2YQMA 1WIMA 4ZUXU 1WENA 2L80A 4IC3A 4YADA 4GNDA 2PUYA 2MNZA 2YURA 3ZTGA 2LGVA 4GB0A 2L0BA 1IYMA 2L5UA 2MNYA 1F62A 2MA5A 5G05B 3KQIA 4PPEA 2C2LA 3ZYQA 4I7BA 4TKPB 1WEOA 4LJNA 2XEUA 3KNVA 2MD8C 3N9NA 4I7DA 3SOWA 3HCTA 5D1MB 1X4UA 1CHCA 5B76A 2EODA 3T7LA 4I7CA 2KREA 3U5MA 1LDKC 4A4CA 2YUCA 4YBMA 2KWKA 4R8PK 2YHOA 4BBQA 5B77A 2KE1A 4X3GA 2CSYA 5LKXA 1FP0A 1T1HA 2YSMA 4AYCB 3DQVR 2NAAA 4V3LC 4N4FA 2H0DB 4QF2A 2BAYA 4LLBA 4A49A 2YW8A 2Y1MA 3ZNIA 2VJEB 2JMIA 2LXHC 3LRQA 3GL6A 1HYIA 4GNEA 3VK6A 1XWHA 2CKLA 4UP5A 3N9LA 2E6RA 1MM2A 3KV6A 1G25A 2M6MA 2LDRA 2Y1NA 2VP7A 4NN2A 5KH7A 2FSAA 5EYAF 2MIQA 2JMDA 3U5NA 5TBNA 1VD4A 3M62A 3EB6A 2L43A 3KV5A 2VPGA 1X4JA 2LXPC 1ZBDB 3N9OA 1E4UA 4A0CD 3RPGC 5LKUA 3L11A 4UI9B 3C5KA 3ASLA 4LADB 3LQHA 3IHPA 2KIZA 3GV4A 4AUQB 4MVTA 4WZ3B 4AVXA 1WE9A 4YBTA 5C13A 1MM3A 5JG6A 4BHWA 2G43A 1N87A 5C11A 2CT2A 5LCWB 1V87A 4N3WA 5H9MA 4S3OC 2L75A 2KWOA 3SOXA 5LKTA 3SOUA 1K2FA 2LV9A 2ECVA 2YU4A 2C2VS 5G04B 4B86C 3U5PA 3N9PA 4LKAA 1VFYA 2M85A 3I2DA 2KWNA 2D8SA 4YBSA 2VJFA 1WEWA 2K4DA 2F6NA 3ZVZB 2PNXA 2QIZA 4GNGA 2KYUA 2JRJA 5G0FA 3PURA 4PTBA 4S3OB 2F6JA 2EA6A 1WGMA 2VPEA 1WESA 1LDJB 3O7AA 3O33A 2EGPA 4YAXA 5KH9A 2YSJA 3O35A 3ZVYA 2IDAA 2QICA 2VNFA 1Z60A 2LN0A 4IC2A 2E6SA 5FERA 2MA6A 3NG2A 2KU3A 3O34A 2UZGA 3DPLR 2VPBA 4B7YC 2Y43A 4L7XA 2VJFB 3RTRB 2I50A
chains in the Genus database with same CATH superfamily
3E2DA 2JMJA 2ECGA 4YABA 2YT5A 5TABA 4FO9A 2XOCA 2MUMA 3O70A 2MT5A 4C9ZA 4UP0A 1HYJA 2EXUA 1Z2QA 1DVPA 5B78A 2KFTA 3H7HA 3HCSA 2FUUA 3MHSA 2YQLA 5FEYA 5TDRA 4GNFA 2KWJA 2ZETC 2KR4A 2KGIA 3L1XA 3JUEA 2EGMA 3FJUB 3DDTA 1WEUA 2OWAA 3FL2A 1JM7B 2E61A 4XI1A 2F42A 3LQIA 2LRIC 1JOCA 3L1ZB 1JM7A 3ZPVE 2HDPA 2CKLB 2ECTA 2QJ0A 2DX8A 3M99A 1WEQA 3V43A 1FBVA 2YHNA 4CCGX 2L7PA 4ZQLA 2KGGA 4ZDTA 2AN6A 2M1RA 3M63A 4MSXA 2XOZA 4P5OB 2FD4A 2HYED 4V3KC 1WEEA 5I3LA 4Z0RA 3PUQA 5SVXA 4LK9A 5FB1A 4QF3A 4OGEA 2OXQC 1U6GB 4AYCA 5AIUA 2G6QA 3PHDA 4WZ0A 4AP4A 2XB1A 4Q6FA 2YREA 3FM8C 1MBMA 2H0DA 2XP0A 5H1TA 3HCUA 5TDWA 2LGKA 3MHHA 2YYRA 3LQJA 2ECIA 5LKZA 1WILA 2CONA 4FJCA 3O36A 5J3XA 4R2YA 2ECJA 3O37A 2LGGA 1Z6UA 3HTKC 3O47A 4O64A 5H1UA 3LVRE 2CSZA 3N9MA 2YVRA 2MD7B 3T6RA 2G45A 4F52B 4WA6A 3M7KA 2LGLA 1WEVA 4A4BA 4R7EA 2JM3A 3KDEC 2ECWA 1RMDA 5B79A 4YATA 2RI7A 5D1LB 4FK5A 4FIPA 3QZVA 1WFKA 2JUNA 2K17A 3SHBA 2LQ6A 2ECNA 4W4UA 3RPGB 1WEPA 3LVQE 4YC9A 5H1VA 1X4IA 3ZPV1 3N9QA 2VJEA 4CA1A 5SVYA 5TRBA 1BORA 5B75A 2RSDA 5DINA 1WEMA 4L58A 5AITA 5DKAA 3U5OA 2FUIA 5KH3A 5FB0A 3SUBA 2K16A 2M3HA 2K1JA 3C6WA 3PLWA 5B8DA 2VPDA 4WZ2A 1VYXA 5D1KB 3T9KA 3EB5A 2YQMA 1WIMA 4ZUXU 5SVIB 3FANA 1WENA 4H9DA 2L80A 3MDBC 4IC3A 4YADA 4GNDA 2PUYA 3LDYA 2MNZA 4F1PA 2YURA 3ZTGA 2LGVA 4GB0A 2L0BA 1IYMA 3Q1DA 2L5UA 2MNYA 1F62A 2MA5A 5G05B 3KQIA 4PPEA 2C2LA 3ZYQA 4I7BA 2M13A 2KKXA 4TKPB 1WEOA 4LJNA 2XEUA 3KNVA 2MD8C 3N9NA 4I7DA 3SOWA 3HCTA 5D1MB 1X4UA 1CHCA 5B76A 2EODA 3T7LA 4I7CA 2KREA 2DSMA 1LDKC 3U5MA 2YUCA 4A4CA 4YBMA 2KWKA 4R8PK 2YHOA 4BBQA 5B77A 2CSVA 2KE1A 4X3GA 2CSYA 5LKXA 1FP0A 1T1HA 2YSMA 4AYCB 3DQVR 2NAAA 1DCQA 3FEHA 4V3LC 4N4FA 2H0DB 4QF2A 2BAYA 4LLBA 4A49A 2YW8A 2Y1MA 3ZNIA 2VJEB 5SVIA 2JMIA 2LXHC 3LRQA 3GL6A 1HYIA 4GNEA 2I50A 3VK6A 1XWHA 2CKLA 2CRWA 4UP5A 3N9LA 2E6RA 1MM2A 3KV6A 1G25A 2M6MA 2LDRA 2Y1NA 2VP7A 4NN2A 5KH7A 2FSAA 2P57A 5EYAF 2MIQA 2JMDA 3U5NA 5TBNA 1VD4A 3M62A 3EB6A 2L43A 3KV5A 2VPGA 1X4JA 2LXPC 1ZBDB 2RR4A 3N9OA 2CRRA 1E4UA 4A0CD 2XOYA 3RPGC 5LKUA 3L11A 4UI9B 3C5KA 3ASLA 4LADB 3LQHA 3IHPA 2KIZA 3GV4A 4AUQB 4MVTA 4WZ3B 2FFWA 4AVXA 1WE9A 4YBTA 5C13A 1MM3A 2KKYA 5JG6A 4BHWA 2G43A 1N87A 5C11A 2CT2A 5LCWB 1V87A 4N3WA 5H9MA 4S3OC 3DWDA 2L75A 2KWOA 3SOXA 4Z0OA 2MKEA 5LKTA 3SOUA 3FAOA 1K2FA 2LV9A 2ECVA 2YU4A 2C2VS 5G04B 4B86C 3U5PA 3N9PA 4LKAA 1VFYA 2M85A 3I2DA 2KWNA 2D8SA 4YBSA 2VJFA 1WEWA 2K4DA 2F6NA 3ZVZB 2PNXA 2DJAA 2QIZA 4GNGA 5K3QA 2KYUA 2IQJA 2JRJA 5G0FA 3PURA 4PTBA 4S3OB 2F6JA 2EA6A 1WGMA 2VPEA 4OGCA 1WESA 1LDJB 3O7AA 3O33A 2B0OE 4QQ4A 2EGPA 4YAXA 5KH9A 2LAUA 2YSJA 3O35A 3ZVYA 2IDAA 2QICA 2VNFA 3LJUX 1Z60A 2LN0A 4IC2A 2E6SA 5FERA 2MA6A 3NG2A 2D8UA 2KU3A 3O34A 2UZGA 3DPLR 2VPBA 4B7YC 2Y43A 4L7XA 2VJFB 3RTRB 4O62A
chains in the Genus database with same CATH topology
2JMJA 2ECGA 4YABA 2YT5A 5TABA 4FO9A 2MUMA 3O70A 2MT5A 4C9ZA 4UP0A 1HYJA 1Z2QA 1DVPA 5B78A 2KFTA 3HCSA 2FUUA 3MHSA 2YQLA 5FEYA 5TDRA 4GNFA 2KWJA 2ZETC 2KR4A 2KGIA 3L1XA 1WEUA 3FL2A 1JM7B 4XI1A 2F42A 3LQIA 2LRIC 1JOCA 3L1ZB 1JM7A 3ZPVE 2HDPA 2CKLB 2ECTA 2QJ0A 2DX8A 3M99A 1WEQA 3V43A 1FBVA 2YHNA 4CCGX 4ZQLA 2KGGA 4ZDTA 2AN6A 2M1RA 3M63A 4MSXA 4P5OB 2HYED 4V3KC 1WEEA 5I3LA 3PUQA 4LK9A 5FB1A 4QF3A 2OXQC 1U6GB 4AYCA 5AIUA 2G6QA 3PHDA 4WZ0A 4AP4A 2XB1A 4Q6FA 2YREA 2H0DA 5H1TA 3HCUA 5TDWA 2LGKA 3MHHA 2YYRA 3LQJA 2ECIA 5LKZA 1WILA 4FJCA 3O36A 5J3XA 4R2YA 2ECJA 3O37A 2LGGA 1Z6UA 3HTKC 4O64A 5H1UA 2CSZA 3N9MA 2MD7B 3T6RA 2G45A 4F52B 4WA6A 2LGLA 1WEVA 4A4BA 4R7EA 2ECWA 1RMDA 5B79A 4YATA 2RI7A 5D1LB 4FK5A 4FIPA 3QZVA 1WFKA 2K17A 3SHBA 2LQ6A 2ECNA 4W4UA 3RPGB 1WEPA 4YC9A 5H1VA 3ZPV1 1X4IA 3N9QA 2VJEA 4CA1A 5TRBA 1BORA 5B75A 2RSDA 5DINA 1WEMA 4L58A 5AITA 5DKAA 3U5OA 2FUIA 5KH3A 5FB0A 2K16A 2M3HA 2K1JA 3C6WA 5B8DA 2VPDA 4WZ2A 1VYXA 5D1KB 3EB5A 2YQMA 1WIMA 4ZUXU 1WENA 2L80A 4IC3A 4YADA 4GNDA 2PUYA 2MNZA 2YURA 3ZTGA 2LGVA 4GB0A 2L0BA 1IYMA 2L5UA 2MNYA 1F62A 2MA5A 5G05B 3KQIA 4PPEA 2C2LA 3ZYQA 4I7BA 4TKPB 1WEOA 4LJNA 2XEUA 3KNVA 2MD8C 3N9NA 4I7DA 3SOWA 3HCTA 5D1MB 1X4UA 1CHCA 5B76A 2EODA 3T7LA 4I7CA 2KREA 3U5MA 1LDKC 4A4CA 2YUCA 4YBMA 2KWKA 4R8PK 2YHOA 4BBQA 5B77A 2KE1A 4X3GA 2CSYA 5LKXA 1FP0A 1T1HA 2YSMA 4AYCB 3DQVR 2NAAA 4V3LC 4N4FA 2H0DB 4QF2A 2BAYA 4LLBA 4A49A 2YW8A 2Y1MA 3ZNIA 2VJEB 2JMIA 2LXHC 3LRQA 3GL6A 1HYIA 4GNEA 3VK6A 1XWHA 2CKLA 4UP5A 3N9LA 2E6RA 1MM2A 3KV6A 1G25A 2M6MA 2LDRA 2Y1NA 2VP7A 4NN2A 5KH7A 2FSAA 5EYAF 2MIQA 2JMDA 3U5NA 5TBNA 1VD4A 3M62A 3EB6A 2L43A 3KV5A 2VPGA 1X4JA 2LXPC 1ZBDB 3N9OA 1E4UA 4A0CD 3RPGC 5LKUA 3L11A 4UI9B 3C5KA 3ASLA 4LADB 3LQHA 3IHPA 2KIZA 3GV4A 4AUQB 4MVTA 4WZ3B 4AVXA 1WE9A 4YBTA 5C13A 1MM3A 5JG6A 4BHWA 2G43A 1N87A 5C11A 2CT2A 5LCWB 1V87A 4N3WA 5H9MA 4S3OC 2L75A 2KWOA 3SOXA 5LKTA 3SOUA 1K2FA 2LV9A 2ECVA 2YU4A 2C2VS 5G04B 4B86C 3U5PA 3N9PA 4LKAA 1VFYA 2M85A 3I2DA 2KWNA 2D8SA 4YBSA 2VJFA 1WEWA 2K4DA 2F6NA 3ZVZB 2PNXA 2QIZA 4GNGA 2KYUA 2JRJA 5G0FA 3PURA 4PTBA 4S3OB 2F6JA 2EA6A 1WGMA 2VPEA 1WESA 1LDJB 3O7AA 3O33A 2EGPA 4YAXA 5KH9A 2YSJA 3O35A 3ZVYA 2IDAA 2QICA 2VNFA 1Z60A 2LN0A 4IC2A 2E6SA 5FERA 2MA6A 3NG2A 2KU3A 3O34A 2UZGA 3DPLR 2VPBA 4B7YC 2Y43A 4L7XA 2VJFB 3RTRB 2I50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMJ A;  2ECG A;  4YAB A;  2YT5 A;  5TAB A;  4FO9 A;  2MUM A;  3O70 A;  2MT5 A;  4C9Z A;  4UP0 A;  1HYJ A;  1Z2Q A;  1DVP A;  5B78 A;  2KFT A;  3HCS A;  2FUU A;  3MHS A;  2YQL A;  5FEY A;  5TDR A;  4GNF A;  2KWJ A;  2ZET C;  2KR4 A;  2KGI A;  3L1X A;  1WEU A;  3FL2 A;  1JM7 B;  4XI1 A;  2F42 A;  3LQI A;  2LRI C;  1JOC A;  3L1Z B;  1JM7 A;  3ZPV E;  2HDP A;  2CKL B;  2ECT A;  2QJ0 A;  2DX8 A;  3M99 A;  1WEQ A;  3V43 A;  1FBV A;  2YHN A;  4CCG X;  4ZQL A;  2KGG A;  4ZDT A;  2AN6 A;  2M1R A;  3M63 A;  4MSX A;  4P5O B;  2HYE D;  4V3K C;  1WEE A;  5I3L A;  3PUQ A;  4LK9 A;  5FB1 A;  4QF3 A;  2OXQ C;  1U6G B;  4AYC A;  5AIU A;  2G6Q A;  3PHD A;  4WZ0 A;  4AP4 A;  2XB1 A;  4Q6F A;  2YRE A;  2H0D A;  5H1T A;  3HCU A;  5TDW A;  2LGK A;  3MHH A;  2YYR A;  3LQJ A;  2ECI A;  5LKZ A;  1WIL A;  4FJC A;  3O36 A;  5J3X A;  4R2Y A;  2ECJ A;  3O37 A;  2LGG A;  1Z6U A;  3HTK C;  4O64 A;  5H1U A;  2CSZ A;  3N9M A;  2MD7 B;  3T6R A;  2G45 A;  4F52 B;  4WA6 A;  2LGL A;  1WEV A;  4A4B A;  4R7E A;  2ECW A;  1RMD A;  5B79 A;  4YAT A;  2RI7 A;  5D1L B;  4FK5 A;  4FIP A;  3QZV A;  1WFK A;  2K17 A;  3SHB A;  2LQ6 A;  2ECN A;  4W4U A;  3RPG B;  1WEP A;  4YC9 A;  5H1V A;  3ZPV 1;  1X4I A;  3N9Q A;  2VJE A;  4CA1 A;  5TRB A;  1BOR A;  5B75 A;  2RSD A;  5DIN A;  1WEM A;  4L58 A;  5AIT A;  5DKA A;  3U5O A;  2FUI A;  5KH3 A;  5FB0 A;  2K16 A;  2M3H A;  2K1J A;  3C6W A;  5B8D A;  2VPD A;  4WZ2 A;  1VYX A;  5D1K B;  3EB5 A;  2YQM A;  1WIM A;  4ZUX U;  1WEN A;  2L80 A;  4IC3 A;  4YAD A;  4GND A;  2PUY A;  2MNZ A;  2YUR A;  3ZTG A;  2LGV A;  4GB0 A;  2L0B A;  1IYM A;  2L5U A;  2MNY A;  1F62 A;  2MA5 A;  5G05 B;  3KQI A;  4PPE A;  2C2L A;  3ZYQ A;  4I7B A;  4TKP B;  1WEO A;  4LJN A;  2XEU A;  3KNV A;  2MD8 C;  3N9N A;  4I7D A;  3SOW A;  3HCT A;  5D1M B;  1X4U A;  1CHC A;  5B76 A;  2EOD A;  3T7L A;  4I7C A;  2KRE A;  3U5M A;  1LDK C;  4A4C A;  2YUC A;  4YBM A;  2KWK A;  4R8P K;  2YHO A;  4BBQ A;  5B77 A;  2KE1 A;  4X3G A;  2CSY A;  5LKX A;  1FP0 A;  1T1H A;  2YSM A;  4AYC B;  3DQV R;  2NAA A;  4V3L C;  4N4F A;  2H0D B;  4QF2 A;  2BAY A;  4LLB A;  4A49 A;  2YW8 A;  2Y1M A;  3ZNI A;  2VJE B;  2JMI A;  2LXH C;  3LRQ A;  3GL6 A;  1HYI A;  4GNE A;  3VK6 A;  1XWH A;  2CKL A;  4UP5 A;  3N9L A;  2E6R A;  1MM2 A;  3KV6 A;  1G25 A;  2M6M A;  2LDR A;  2Y1N A;  2VP7 A;  4NN2 A;  5KH7 A;  2FSA A;  5EYA F;  2MIQ A;  2JMD A;  3U5N A;  5TBN A;  1VD4 A;  3M62 A;  3EB6 A;  2L43 A;  3KV5 A;  2VPG A;  1X4J A;  2LXP C;  1ZBD B;  3N9O A;  1E4U A;  4A0C D;  3RPG C;  5LKU A;  3L11 A;  4UI9 B;  3C5K A;  3ASL A;  4LAD B;  3LQH A;  3IHP A;  2KIZ A;  3GV4 A;  4AUQ B;  4MVT A;  4WZ3 B;  4AVX A;  1WE9 A;  4YBT A;  5C13 A;  1MM3 A;  5JG6 A;  4BHW A;  2G43 A;  1N87 A;  5C11 A;  2CT2 A;  5LCW B;  1V87 A;  4N3W A;  5H9M A;  4S3O C;  2L75 A;  2KWO A;  3SOX A;  5LKT A;  3SOU A;  1K2F A;  2LV9 A;  2ECV A;  2YU4 A;  2C2V S;  5G04 B;  4B86 C;  3U5P A;  3N9P A;  4LKA A;  1VFY A;  2M85 A;  3I2D A;  2KWN A;  2D8S A;  4YBS A;  2VJF A;  1WEW A;  2K4D A;  2F6N A;  3ZVZ B;  2PNX A;  2QIZ A;  4GNG A;  2KYU A;  2JRJ A;  5G0F A;  3PUR A;  4PTB A;  4S3O B;  2F6J A;  2EA6 A;  1WGM A;  2VPE A;  1WES A;  1LDJ B;  3O7A A;  3O33 A;  2EGP A;  4YAX A;  5KH9 A;  2YSJ A;  3O35 A;  3ZVY A;  2IDA A;  2QIC A;  2VNF A;  1Z60 A;  2LN0 A;  4IC2 A;  2E6S A;  5FER A;  2MA6 A;  3NG2 A;  2KU3 A;  3O34 A;  2UZG A;  3DPL R;  2VPB A;  4B7Y C;  2Y43 A;  4L7X A;  2VJF B;  3RTR B;  2I50 A; 
#chains in the Genus database with same CATH topology
 3E2D A;  2JMJ A;  2ECG A;  4YAB A;  2YT5 A;  5TAB A;  4FO9 A;  2XOC A;  2MUM A;  3O70 A;  2MT5 A;  4C9Z A;  4UP0 A;  1HYJ A;  2EXU A;  1Z2Q A;  1DVP A;  5B78 A;  2KFT A;  3H7H A;  3HCS A;  2FUU A;  3MHS A;  2YQL A;  5FEY A;  5TDR A;  4GNF A;  2KWJ A;  2ZET C;  2KR4 A;  2KGI A;  3L1X A;  3JUE A;  2EGM A;  3FJU B;  3DDT A;  1WEU A;  2OWA A;  3FL2 A;  1JM7 B;  2E61 A;  4XI1 A;  2F42 A;  3LQI A;  2LRI C;  1JOC A;  3L1Z B;  1JM7 A;  3ZPV E;  2HDP A;  2CKL B;  2ECT A;  2QJ0 A;  2DX8 A;  3M99 A;  1WEQ A;  3V43 A;  1FBV A;  2YHN A;  4CCG X;  2L7P A;  4ZQL A;  2KGG A;  4ZDT A;  2AN6 A;  2M1R A;  3M63 A;  4MSX A;  2XOZ A;  4P5O B;  2FD4 A;  2HYE D;  4V3K C;  1WEE A;  5I3L A;  4Z0R A;  3PUQ A;  5SVX A;  4LK9 A;  5FB1 A;  4QF3 A;  4OGE A;  2OXQ C;  1U6G B;  4AYC A;  5AIU A;  2G6Q A;  3PHD A;  4WZ0 A;  4AP4 A;  2XB1 A;  4Q6F A;  2YRE A;  3FM8 C;  1MBM A;  2H0D A;  2XP0 A;  5H1T A;  3HCU A;  5TDW A;  2LGK A;  3MHH A;  2YYR A;  3LQJ A;  2ECI A;  5LKZ A;  1WIL A;  2CON A;  4FJC A;  3O36 A;  5J3X A;  4R2Y A;  2ECJ A;  3O37 A;  2LGG A;  1Z6U A;  3HTK C;  3O47 A;  4O64 A;  5H1U A;  3LVR E;  2CSZ A;  3N9M A;  2YVR A;  2MD7 B;  3T6R A;  2G45 A;  4F52 B;  4WA6 A;  3M7K A;  2LGL A;  1WEV A;  4A4B A;  4R7E A;  2JM3 A;  3KDE C;  2ECW A;  1RMD A;  5B79 A;  4YAT A;  2RI7 A;  5D1L B;  4FK5 A;  4FIP A;  3QZV A;  1WFK A;  2JUN A;  2K17 A;  3SHB A;  2LQ6 A;  2ECN A;  4W4U A;  3RPG B;  1WEP A;  3LVQ E;  4YC9 A;  5H1V A;  1X4I A;  3ZPV 1;  3N9Q A;  2VJE A;  4CA1 A;  5SVY A;  5TRB A;  1BOR A;  5B75 A;  2RSD A;  5DIN A;  1WEM A;  4L58 A;  5AIT A;  5DKA A;  3U5O A;  2FUI A;  5KH3 A;  5FB0 A;  3SUB A;  2K16 A;  2M3H A;  2K1J A;  3C6W A;  3PLW A;  5B8D A;  2VPD A;  4WZ2 A;  1VYX A;  5D1K B;  3T9K A;  3EB5 A;  2YQM A;  1WIM A;  4ZUX U;  5SVI B;  3FAN A;  1WEN A;  4H9D A;  2L80 A;  3MDB C;  4IC3 A;  4YAD A;  4GND A;  2PUY A;  3LDY A;  2MNZ A;  4F1P A;  2YUR A;  3ZTG A;  2LGV A;  4GB0 A;  2L0B A;  1IYM A;  3Q1D A;  2L5U A;  2MNY A;  1F62 A;  2MA5 A;  5G05 B;  3KQI A;  4PPE A;  2C2L A;  3ZYQ A;  4I7B A;  2M13 A;  2KKX A;  4TKP B;  1WEO A;  4LJN A;  2XEU A;  3KNV A;  2MD8 C;  3N9N A;  4I7D A;  3SOW A;  3HCT A;  5D1M B;  1X4U A;  1CHC A;  5B76 A;  2EOD A;  3T7L A;  4I7C A;  2KRE A;  2DSM A;  1LDK C;  3U5M A;  2YUC A;  4A4C A;  4YBM A;  2KWK A;  4R8P K;  2YHO A;  4BBQ A;  5B77 A;  2CSV A;  2KE1 A;  4X3G A;  2CSY A;  5LKX A;  1FP0 A;  1T1H A;  2YSM A;  4AYC B;  3DQV R;  2NAA A;  1DCQ A;  3FEH A;  4V3L C;  4N4F A;  2H0D B;  4QF2 A;  2BAY A;  4LLB A;  4A49 A;  2YW8 A;  2Y1M A;  3ZNI A;  2VJE B;  5SVI A;  2JMI A;  2LXH C;  3LRQ A;  3GL6 A;  1HYI A;  4GNE A;  2I50 A;  3VK6 A;  1XWH A;  2CKL A;  2CRW A;  4UP5 A;  3N9L A;  2E6R A;  1MM2 A;  3KV6 A;  1G25 A;  2M6M A;  2LDR A;  2Y1N A;  2VP7 A;  4NN2 A;  5KH7 A;  2FSA A;  2P57 A;  5EYA F;  2MIQ A;  2JMD A;  3U5N A;  5TBN A;  1VD4 A;  3M62 A;  3EB6 A;  2L43 A;  3KV5 A;  2VPG A;  1X4J A;  2LXP C;  1ZBD B;  2RR4 A;  3N9O A;  2CRR A;  1E4U A;  4A0C D;  2XOY A;  3RPG C;  5LKU A;  3L11 A;  4UI9 B;  3C5K A;  3ASL A;  4LAD B;  3LQH A;  3IHP A;  2KIZ A;  3GV4 A;  4AUQ B;  4MVT A;  4WZ3 B;  2FFW A;  4AVX A;  1WE9 A;  4YBT A;  5C13 A;  1MM3 A;  2KKY A;  5JG6 A;  4BHW A;  2G43 A;  1N87 A;  5C11 A;  2CT2 A;  5LCW B;  1V87 A;  4N3W A;  5H9M A;  4S3O C;  3DWD A;  2L75 A;  2KWO A;  3SOX A;  4Z0O A;  2MKE A;  5LKT A;  3SOU A;  3FAO A;  1K2F A;  2LV9 A;  2ECV A;  2YU4 A;  2C2V S;  5G04 B;  4B86 C;  3U5P A;  3N9P A;  4LKA A;  1VFY A;  2M85 A;  3I2D A;  2KWN A;  2D8S A;  4YBS A;  2VJF A;  1WEW A;  2K4D A;  2F6N A;  3ZVZ B;  2PNX A;  2DJA A;  2QIZ A;  4GNG A;  5K3Q A;  2KYU A;  2IQJ A;  2JRJ A;  5G0F A;  3PUR A;  4PTB A;  4S3O B;  2F6J A;  2EA6 A;  1WGM A;  2VPE A;  4OGC A;  1WES A;  1LDJ B;  3O7A A;  3O33 A;  2B0O E;  4QQ4 A;  2EGP A;  4YAX A;  5KH9 A;  2LAU A;  2YSJ A;  3O35 A;  3ZVY A;  2IDA A;  2QIC A;  2VNF A;  3LJU X;  1Z60 A;  2LN0 A;  4IC2 A;  2E6S A;  5FER A;  2MA6 A;  3NG2 A;  2D8U A;  2KU3 A;  3O34 A;  2UZG A;  3DPL R;  2VPB A;  4B7Y C;  2Y43 A;  4L7X A;  2VJF B;  3RTR B;  4O62 A; 
#chains in the Genus database with same CATH homology
 2JMJ A;  2ECG A;  4YAB A;  2YT5 A;  5TAB A;  4FO9 A;  2MUM A;  3O70 A;  2MT5 A;  4C9Z A;  4UP0 A;  1HYJ A;  1Z2Q A;  1DVP A;  5B78 A;  2KFT A;  3HCS A;  2FUU A;  3MHS A;  2YQL A;  5FEY A;  5TDR A;  4GNF A;  2KWJ A;  2ZET C;  2KR4 A;  2KGI A;  3L1X A;  1WEU A;  3FL2 A;  1JM7 B;  4XI1 A;  2F42 A;  3LQI A;  2LRI C;  1JOC A;  3L1Z B;  1JM7 A;  3ZPV E;  2HDP A;  2CKL B;  2ECT A;  2QJ0 A;  2DX8 A;  3M99 A;  1WEQ A;  3V43 A;  1FBV A;  2YHN A;  4CCG X;  4ZQL A;  2KGG A;  4ZDT A;  2AN6 A;  2M1R A;  3M63 A;  4MSX A;  4P5O B;  2HYE D;  4V3K C;  1WEE A;  5I3L A;  3PUQ A;  4LK9 A;  5FB1 A;  4QF3 A;  2OXQ C;  1U6G B;  4AYC A;  5AIU A;  2G6Q A;  3PHD A;  4WZ0 A;  4AP4 A;  2XB1 A;  4Q6F A;  2YRE A;  2H0D A;  5H1T A;  3HCU A;  5TDW A;  2LGK A;  3MHH A;  2YYR A;  3LQJ A;  2ECI A;  5LKZ A;  1WIL A;  4FJC A;  3O36 A;  5J3X A;  4R2Y A;  2ECJ A;  3O37 A;  2LGG A;  1Z6U A;  3HTK C;  4O64 A;  5H1U A;  2CSZ A;  3N9M A;  2MD7 B;  3T6R A;  2G45 A;  4F52 B;  4WA6 A;  2LGL A;  1WEV A;  4A4B A;  4R7E A;  2ECW A;  1RMD A;  5B79 A;  4YAT A;  2RI7 A;  5D1L B;  4FK5 A;  4FIP A;  3QZV A;  1WFK A;  2K17 A;  3SHB A;  2LQ6 A;  2ECN A;  4W4U A;  3RPG B;  1WEP A;  4YC9 A;  5H1V A;  3ZPV 1;  1X4I A;  3N9Q A;  2VJE A;  4CA1 A;  5TRB A;  1BOR A;  5B75 A;  2RSD A;  5DIN A;  1WEM A;  4L58 A;  5AIT A;  5DKA A;  3U5O A;  2FUI A;  5KH3 A;  5FB0 A;  2K16 A;  2M3H A;  2K1J A;  3C6W A;  5B8D A;  2VPD A;  4WZ2 A;  1VYX A;  5D1K B;  3EB5 A;  2YQM A;  1WIM A;  4ZUX U;  1WEN A;  2L80 A;  4IC3 A;  4YAD A;  4GND A;  2PUY A;  2MNZ A;  2YUR A;  3ZTG A;  2LGV A;  4GB0 A;  2L0B A;  1IYM A;  2L5U A;  2MNY A;  1F62 A;  2MA5 A;  5G05 B;  3KQI A;  4PPE A;  2C2L A;  3ZYQ A;  4I7B A;  4TKP B;  1WEO A;  4LJN A;  2XEU A;  3KNV A;  2MD8 C;  3N9N A;  4I7D A;  3SOW A;  3HCT A;  5D1M B;  1X4U A;  1CHC A;  5B76 A;  2EOD A;  3T7L A;  4I7C A;  2KRE A;  3U5M A;  1LDK C;  4A4C A;  2YUC A;  4YBM A;  2KWK A;  4R8P K;  2YHO A;  4BBQ A;  5B77 A;  2KE1 A;  4X3G A;  2CSY A;  5LKX A;  1FP0 A;  1T1H A;  2YSM A;  4AYC B;  3DQV R;  2NAA A;  4V3L C;  4N4F A;  2H0D B;  4QF2 A;  2BAY A;  4LLB A;  4A49 A;  2YW8 A;  2Y1M A;  3ZNI A;  2VJE B;  2JMI A;  2LXH C;  3LRQ A;  3GL6 A;  1HYI A;  4GNE A;  3VK6 A;  1XWH A;  2CKL A;  4UP5 A;  3N9L A;  2E6R A;  1MM2 A;  3KV6 A;  1G25 A;  2M6M A;  2LDR A;  2Y1N A;  2VP7 A;  4NN2 A;  5KH7 A;  2FSA A;  5EYA F;  2MIQ A;  2JMD A;  3U5N A;  5TBN A;  1VD4 A;  3M62 A;  3EB6 A;  2L43 A;  3KV5 A;  2VPG A;  1X4J A;  2LXP C;  1ZBD B;  3N9O A;  1E4U A;  4A0C D;  3RPG C;  5LKU A;  3L11 A;  4UI9 B;  3C5K A;  3ASL A;  4LAD B;  3LQH A;  3IHP A;  2KIZ A;  3GV4 A;  4AUQ B;  4MVT A;  4WZ3 B;  4AVX A;  1WE9 A;  4YBT A;  5C13 A;  1MM3 A;  5JG6 A;  4BHW A;  2G43 A;  1N87 A;  5C11 A;  2CT2 A;  5LCW B;  1V87 A;  4N3W A;  5H9M A;  4S3O C;  2L75 A;  2KWO A;  3SOX A;  5LKT A;  3SOU A;  1K2F A;  2LV9 A;  2ECV A;  2YU4 A;  2C2V S;  5G04 B;  4B86 C;  3U5P A;  3N9P A;  4LKA A;  1VFY A;  2M85 A;  3I2D A;  2KWN A;  2D8S A;  4YBS A;  2VJF A;  1WEW A;  2K4D A;  2F6N A;  3ZVZ B;  2PNX A;  2QIZ A;  4GNG A;  2KYU A;  2JRJ A;  5G0F A;  3PUR A;  4PTB A;  4S3O B;  2F6J A;  2EA6 A;  1WGM A;  2VPE A;  1WES A;  1LDJ B;  3O7A A;  3O33 A;  2EGP A;  4YAX A;  5KH9 A;  2YSJ A;  3O35 A;  3ZVY A;  2IDA A;  2QIC A;  2VNF A;  1Z60 A;  2LN0 A;  4IC2 A;  2E6S A;  5FER A;  2MA6 A;  3NG2 A;  2KU3 A;  3O34 A;  2UZG A;  3DPL R;  2VPB A;  4B7Y C;  2Y43 A;  4L7X A;  2VJF B;  3RTR B;  2I50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...