1E4UA

N-terminal ring finger domain of human not-4
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
78
structure length
78
Chain Sequence
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REPRESSOR NOT4
publication title The Structure of the C4C4 Ring Finger of Human not4 Reveals Features Distinct from Those of C3Hc4 Ring Fingers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 4
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14570 zf-RING_4 RING/Ubox like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1e4uA00
4UP5A 5H1TA 2BAYA 2Y1NA 4UI9B 3KQIA 3O36A 5LKUA 4F52B 4IC2A 4FIPA 2KFTA 3EB5A 1V87A 5B78A 1CHCA 5B75A 3M99A 4V3KC 3O33A 3C6WA 2YHOA 4YBMA 2K17A 1N87A 4LKAA 2UZGA 2LGLA 1ZBDB 3L1XA 1X4IA 2EODA 2L5UA 5LKTA 4AYCA 1HYIA 5LCWB 1X4UA 4S3OB 2FSAA 4QF3A 3DPLR 2FUUA 3ASLA 5FB0A 4AVXA 1WEEA 2MT5A 5G04B 4UP0A 2LV9A 3LQIA 2QJ0A 1Z60A 5B77A 3KV6A 4GNFA 2YT5A 4PPEA 3QZVA 2VPDA 2H0DA 2F6JA 2VJFB 5TBNA 3O34A 3N9MA 2MNZA 2VPBA 3U5PA 1E4UA 4R8PK 5TDRA 1HYJA 4L7XA 2K4DA 2ECIA 5H1UA 5D1MB 4FK5A 4I7BA 4AP4A 5KH9A 2K1JA 1WIMA 4MVTA 2PNXA 3ZYQA 3SOWA 3PHDA 3SOXA 2Y1MA 3N9LA 5LKXA 2YUCA 3RTRB 2CT2A 2L75A 1X4JA 3C5KA 4N4FA 3FL2A 4A0CD 2KWKA 2G6QA 2JRJA 3V43A 4IC3A 4AYCB 4YABA 5D1KB 1Z6UA 2KE1A 3O7AA 2RI7A 2AN6A 2XB1A 3PURA 4YBSA 1WEOA 2KYUA 2M3HA 2KREA 3NG2A 3GV4A 2ECNA 1VD4A 2E6RA 2HYED 1LDKC 2L80A 4GNGA 2KGGA 5AIUA 2VP7A 2YU4A 1WGMA 1WEPA 2C2VS 4GNDA 3ZPVE 5B79A 4C9ZA 2YREA 1FBVA 3T7LA 4YAXA 4W4UA 2H0DB 3VK6A 3O37A 3HCSA 3N9PA 2KIZA 1WEUA 2NAAA 1G25A 3IHPA 2KWOA 5B8DA 3RPGC 1BORA 2LGGA 1U6GB 3U5MA 2ECVA 4N3WA 2LXPC 4R7EA 4ZQLA 2MD7B 2JMDA 4YC9A 2KWJA 4R2YA 3SOUA 3U5OA 3U5NA 4BHWA 5DKAA 2QIZA 5EYAF 2ECJA 2YSJA 4YBTA 2MA6A 2YQMA 1LDJB 2ECWA 2YSMA 2M6MA 4LJNA 2OXQC 5FEYA 3MHHA 2MUMA 3LQJA 5KH7A 5G0FA 2E6SA 1MM2A 3HTKC 5TRBA 2ECGA 5TABA 3L11A 1WILA 2CSZA 4A4CA 2ZETC 1IYMA 2EA6A 2YQLA 1WFKA 4Q6FA 4NN2A 3HCUA 2XEUA 2M1RA 3PUQA 2LDRA 4S3OC 2KR4A 4XI1A 1XWHA 2VNFA 4GNEA 5H1VA 5I3LA 4A49A 3O35A 2QICA 3ZNIA 1WEQA 3LRQA 2VPGA 2LQ6A 2VJEA 3MHSA 2ECTA 4LK9A 1T1HA 4LADB 2Y43A 5DINA 3ZVZB 4I7CA 5KH3A 5G05B 2F6NA 4WA6A 4QF2A 4WZ3B 4WZ0A 4LLBA 4X3GA 4B7YC 4P5OB 2EGPA 2JMJA 2CKLA 2LRIC 4GB0A 2MIQA 4CA1A 5H9MA 1WEVA 1JM7A 2K16A 2LGVA 3KV5A 5D1LB 3DQVR 3L1ZB 4PTBA 2L0BA 2M85A 4A4BA 2HDPA 2LGKA 2LXHC 4AUQB 3ZTGA 4WZ2A 3T6RA 5LKZA 4MSXA 2KU3A 1WENA 2VPEA 1FP0A 4FO9A 2YHNA 2G45A 3I2DA 2C2LA 3N9NA 4TKPB 3ZPV1 1WEMA 3M63A 4CCGX 1WEWA 3N9OA 4O64A 4V3LC 3ZVYA 3M62A 4ZDTA 2RSDA 4I7DA 5AITA 2KWNA 1MM3A 2L43A 4FJCA 2I50A 2FUIA 3N9QA 1VYXA 3LQHA 2VJEB 3GL6A 1WE9A 1K2FA 5B76A 4YATA 2MA5A 3SHBA 1RMDA 3HCTA 1Z2QA 5J3XA 5FERA 2PUYA 2MNYA 2JMIA 5FB1A 2CSYA 3O70A 1DVPA 2D8SA 4L58A 2YYRA 2KGIA 5C13A 2VJFA 3RPGB 4B86C 2CKLB 2YURA 2YW8A 1F62A 1VFYA 1JM7B 5JG6A 1JOCA 2F42A 4YADA 2IDAA 2MD8C 5C11A 4ZUXU 2DX8A 5TDWA 1WESA 2LN0A 3EB6A 3KNVA 4BBQA 2G43A
chains in the Genus database with same CATH superfamily
4UP5A 3LVRE 3FAOA 5H1TA 2BAYA 2Y1NA 4UI9B 3KQIA 3O36A 5LKUA 4F52B 4IC2A 4FIPA 2KFTA 3O47A 3EB5A 1V87A 5B78A 1CHCA 5B75A 3M99A 4V3KC 3O33A 3C6WA 2YHOA 4YBMA 2RR4A 2K17A 1N87A 4LKAA 2CSVA 2UZGA 2LGLA 1ZBDB 3L1XA 1X4IA 2EODA 2L5UA 5LKTA 4AYCA 1HYIA 4QQ4A 5LCWB 1X4UA 2MKEA 4S3OB 2FSAA 3LVQE 4QF3A 3DPLR 2FUUA 3ASLA 2DJAA 4Z0RA 5FB0A 4AVXA 1WEEA 2MT5A 3T9KA 5G04B 4UP0A 2LV9A 3LQIA 2XOYA 2IQJA 5SVYA 3E2DA 2QJ0A 1Z60A 5B77A 3KV6A 4GNFA 2YT5A 4PPEA 3QZVA 3LJUX 2VPDA 2H0DA 2F6JA 2VJFB 5TBNA 4F1PA 3O34A 2FFWA 3N9MA 3FEHA 2MNZA 2VPBA 3U5PA 1E4UA 4R8PK 5TDRA 1HYJA 3MDBC 4L7XA 2K4DA 2ECIA 2D8UA 5H1UA 5D1MB 4FK5A 2KKYA 4I7BA 4AP4A 5KH9A 2K1JA 1WIMA 2KKXA 4MVTA 2PNXA 3ZYQA 3SOWA 2XP0A 2EGMA 3PHDA 3SOXA 2Y1MA 3N9LA 5LKXA 2YUCA 3RTRB 2CT2A 2L75A 5SVXA 1X4JA 2B0OE 3C5KA 4N4FA 3FL2A 4A0CD 2KWKA 2G6QA 2JRJA 3V43A 4IC3A 4AYCB 4YABA 5D1KB 1Z6UA 2KE1A 3H7HA 3O7AA 2RI7A 2AN6A 2XB1A 3PURA 4YBSA 1WEOA 2KYUA 2M3HA 3JUEA 2KREA 3NG2A 3GV4A 3FJUB 2ECNA 1VD4A 2E6RA 2HYED 1LDKC 2L80A 4GNGA 2KGGA 5AIUA 3Q1DA 2VP7A 2YU4A 4OGCA 1WGMA 1WEPA 2C2VS 4GNDA 3ZPVE 5B79A 4C9ZA 2YREA 1FBVA 3T7LA 3LDYA 4YAXA 4W4UA 2OWAA 2LAUA 2H0DB 1DCQA 3VK6A 3O37A 3HCSA 3SUBA 3N9PA 2KIZA 1WEUA 2XOCA 2NAAA 1G25A 3IHPA 2KWOA 3FM8C 5B8DA 3RPGC 1BORA 2LGGA 1U6GB 3U5MA 2ECVA 4N3WA 2LXPC 4R7EA 2DSMA 4ZQLA 2MD7B 2JMDA 4YC9A 2KWJA 2JM3A 4R2YA 3SOUA 3U5OA 3U5NA 4BHWA 5DKAA 2QIZA 5EYAF 3PLWA 2ECJA 2YSJA 4YBTA 2MA6A 3FANA 2YQMA 1LDJB 2ECWA 2YSMA 2M6MA 4LJNA 2OXQC 5FEYA 3MHHA 2MUMA 3LQJA 5KH7A 5G0FA 2E6SA 1MM2A 3HTKC 5TRBA 2ECGA 5TABA 3L11A 1WILA 2CSZA 4A4CA 2ZETC 1IYMA 2L7PA 2EA6A 2YQLA 1WFKA 4Q6FA 4NN2A 4Z0OA 4H9DA 3HCUA 2XEUA 2M1RA 3PUQA 2LDRA 4S3OC 2KR4A 4XI1A 1XWHA 2VNFA 4GNEA 2XOZA 5H1VA 5I3LA 4A49A 3O35A 2QICA 3ZNIA 1WEQA 4OGEA 3LRQA 2VPGA 2LQ6A 2VJEA 3MHSA 2ECTA 4LK9A 1T1HA 4LADB 3KDEC 2Y43A 5DINA 3ZVZB 4I7CA 5KH3A 3DWDA 5G05B 2F6NA 4WA6A 4QF2A 4WZ3B 4WZ0A 3DDTA 4LLBA 4X3GA 4B7YC 4P5OB 2EGPA 2JMJA 2CKLA 5SVIA 2M13A 2LRIC 4GB0A 2MIQA 4CA1A 5H9MA 1WEVA 1JM7A 2K16A 2LGVA 3KV5A 5D1LB 2CONA 3DQVR 3L1ZB 4PTBA 2L0BA 2M85A 4A4BA 2P57A 2HDPA 2LGKA 2LXHC 4AUQB 3ZTGA 4WZ2A 3T6RA 5LKZA 4MSXA 2KU3A 1WENA 2VPEA 1FP0A 4FO9A 2YHNA 2G45A 3I2DA 2C2LA 3N9NA 3M7KA 4TKPB 3ZPV1 1WEMA 3M63A 4CCGX 1WEWA 3N9OA 4O64A 4V3LC 3ZVYA 3M62A 4O62A 4ZDTA 2RSDA 4I7DA 5AITA 2KWNA 1MM3A 2L43A 4FJCA 2I50A 2CRRA 2FD4A 2FUIA 3N9QA 2E61A 1VYXA 3LQHA 2VJEB 2CRWA 3GL6A 1WE9A 1K2FA 5B76A 4YATA 2JUNA 2MA5A 3SHBA 1RMDA 3HCTA 1Z2QA 5J3XA 5FERA 2PUYA 2MNYA 2JMIA 5FB1A 2YVRA 5K3QA 2CSYA 3O70A 1DVPA 2D8SA 4L58A 2YYRA 2KGIA 5C13A 2VJFA 3RPGB 4B86C 2CKLB 5SVIB 2EXUA 2YURA 1MBMA 2YW8A 1F62A 1VFYA 1JM7B 5JG6A 1JOCA 2F42A 4YADA 2IDAA 2MD8C 5C11A 4ZUXU 2DX8A 5TDWA 1WESA 2LN0A 3EB6A 3KNVA 4BBQA 2G43A
chains in the Genus database with same CATH topology
4UP5A 5H1TA 2BAYA 2Y1NA 4UI9B 3KQIA 3O36A 5LKUA 4F52B 4IC2A 4FIPA 2KFTA 3EB5A 1V87A 5B78A 1CHCA 5B75A 3M99A 4V3KC 3O33A 3C6WA 2YHOA 4YBMA 2K17A 1N87A 4LKAA 2UZGA 2LGLA 1ZBDB 3L1XA 1X4IA 2EODA 2L5UA 5LKTA 4AYCA 1HYIA 5LCWB 1X4UA 4S3OB 2FSAA 4QF3A 3DPLR 2FUUA 3ASLA 5FB0A 4AVXA 1WEEA 2MT5A 5G04B 4UP0A 2LV9A 3LQIA 2QJ0A 1Z60A 5B77A 3KV6A 4GNFA 2YT5A 4PPEA 3QZVA 2VPDA 2H0DA 2F6JA 2VJFB 5TBNA 3O34A 3N9MA 2MNZA 2VPBA 3U5PA 1E4UA 4R8PK 5TDRA 1HYJA 4L7XA 2K4DA 2ECIA 5H1UA 5D1MB 4FK5A 4I7BA 4AP4A 5KH9A 2K1JA 1WIMA 4MVTA 2PNXA 3ZYQA 3SOWA 3PHDA 3SOXA 2Y1MA 3N9LA 5LKXA 2YUCA 3RTRB 2CT2A 2L75A 1X4JA 3C5KA 4N4FA 3FL2A 4A0CD 2KWKA 2G6QA 2JRJA 3V43A 4IC3A 4AYCB 4YABA 5D1KB 1Z6UA 2KE1A 3O7AA 2RI7A 2AN6A 2XB1A 3PURA 4YBSA 1WEOA 2KYUA 2M3HA 2KREA 3NG2A 3GV4A 2ECNA 1VD4A 2E6RA 2HYED 1LDKC 2L80A 4GNGA 2KGGA 5AIUA 2VP7A 2YU4A 1WGMA 1WEPA 2C2VS 4GNDA 3ZPVE 5B79A 4C9ZA 2YREA 1FBVA 3T7LA 4YAXA 4W4UA 2H0DB 3VK6A 3O37A 3HCSA 3N9PA 2KIZA 1WEUA 2NAAA 1G25A 3IHPA 2KWOA 5B8DA 3RPGC 1BORA 2LGGA 1U6GB 3U5MA 2ECVA 4N3WA 2LXPC 4R7EA 4ZQLA 2MD7B 2JMDA 4YC9A 2KWJA 4R2YA 3SOUA 3U5OA 3U5NA 4BHWA 5DKAA 2QIZA 5EYAF 2ECJA 2YSJA 4YBTA 2MA6A 2YQMA 1LDJB 2ECWA 2YSMA 2M6MA 4LJNA 2OXQC 5FEYA 3MHHA 2MUMA 3LQJA 5KH7A 5G0FA 2E6SA 1MM2A 3HTKC 5TRBA 2ECGA 5TABA 3L11A 1WILA 2CSZA 4A4CA 2ZETC 1IYMA 2EA6A 2YQLA 1WFKA 4Q6FA 4NN2A 3HCUA 2XEUA 2M1RA 3PUQA 2LDRA 4S3OC 2KR4A 4XI1A 1XWHA 2VNFA 4GNEA 5H1VA 5I3LA 4A49A 3O35A 2QICA 3ZNIA 1WEQA 3LRQA 2VPGA 2LQ6A 2VJEA 3MHSA 2ECTA 4LK9A 1T1HA 4LADB 2Y43A 5DINA 3ZVZB 4I7CA 5KH3A 5G05B 2F6NA 4WA6A 4QF2A 4WZ3B 4WZ0A 4LLBA 4X3GA 4B7YC 4P5OB 2EGPA 2JMJA 2CKLA 2LRIC 4GB0A 2MIQA 4CA1A 5H9MA 1WEVA 1JM7A 2K16A 2LGVA 3KV5A 5D1LB 3DQVR 3L1ZB 4PTBA 2L0BA 2M85A 4A4BA 2HDPA 2LGKA 2LXHC 4AUQB 3ZTGA 4WZ2A 3T6RA 5LKZA 4MSXA 2KU3A 1WENA 2VPEA 1FP0A 4FO9A 2YHNA 2G45A 3I2DA 2C2LA 3N9NA 4TKPB 3ZPV1 1WEMA 3M63A 4CCGX 1WEWA 3N9OA 4O64A 4V3LC 3ZVYA 3M62A 4ZDTA 2RSDA 4I7DA 5AITA 2KWNA 1MM3A 2L43A 4FJCA 2I50A 2FUIA 3N9QA 1VYXA 3LQHA 2VJEB 3GL6A 1WE9A 1K2FA 5B76A 4YATA 2MA5A 3SHBA 1RMDA 3HCTA 1Z2QA 5J3XA 5FERA 2PUYA 2MNYA 2JMIA 5FB1A 2CSYA 3O70A 1DVPA 2D8SA 4L58A 2YYRA 2KGIA 5C13A 2VJFA 3RPGB 4B86C 2CKLB 2YURA 2YW8A 1F62A 1VFYA 1JM7B 5JG6A 1JOCA 2F42A 4YADA 2IDAA 2MD8C 5C11A 4ZUXU 2DX8A 5TDWA 1WESA 2LN0A 3EB6A 3KNVA 4BBQA 2G43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP5 A;  5H1T A;  2BAY A;  2Y1N A;  4UI9 B;  3KQI A;  3O36 A;  5LKU A;  4F52 B;  4IC2 A;  4FIP A;  2KFT A;  3EB5 A;  1V87 A;  5B78 A;  1CHC A;  5B75 A;  3M99 A;  4V3K C;  3O33 A;  3C6W A;  2YHO A;  4YBM A;  2K17 A;  1N87 A;  4LKA A;  2UZG A;  2LGL A;  1ZBD B;  3L1X A;  1X4I A;  2EOD A;  2L5U A;  5LKT A;  4AYC A;  1HYI A;  5LCW B;  1X4U A;  4S3O B;  2FSA A;  4QF3 A;  3DPL R;  2FUU A;  3ASL A;  5FB0 A;  4AVX A;  1WEE A;  2MT5 A;  5G04 B;  4UP0 A;  2LV9 A;  3LQI A;  2QJ0 A;  1Z60 A;  5B77 A;  3KV6 A;  4GNF A;  2YT5 A;  4PPE A;  3QZV A;  2VPD A;  2H0D A;  2F6J A;  2VJF B;  5TBN A;  3O34 A;  3N9M A;  2MNZ A;  2VPB A;  3U5P A;  1E4U A;  4R8P K;  5TDR A;  1HYJ A;  4L7X A;  2K4D A;  2ECI A;  5H1U A;  5D1M B;  4FK5 A;  4I7B A;  4AP4 A;  5KH9 A;  2K1J A;  1WIM A;  4MVT A;  2PNX A;  3ZYQ A;  3SOW A;  3PHD A;  3SOX A;  2Y1M A;  3N9L A;  5LKX A;  2YUC A;  3RTR B;  2CT2 A;  2L75 A;  1X4J A;  3C5K A;  4N4F A;  3FL2 A;  4A0C D;  2KWK A;  2G6Q A;  2JRJ A;  3V43 A;  4IC3 A;  4AYC B;  4YAB A;  5D1K B;  1Z6U A;  2KE1 A;  3O7A A;  2RI7 A;  2AN6 A;  2XB1 A;  3PUR A;  4YBS A;  1WEO A;  2KYU A;  2M3H A;  2KRE A;  3NG2 A;  3GV4 A;  2ECN A;  1VD4 A;  2E6R A;  2HYE D;  1LDK C;  2L80 A;  4GNG A;  2KGG A;  5AIU A;  2VP7 A;  2YU4 A;  1WGM A;  1WEP A;  2C2V S;  4GND A;  3ZPV E;  5B79 A;  4C9Z A;  2YRE A;  1FBV A;  3T7L A;  4YAX A;  4W4U A;  2H0D B;  3VK6 A;  3O37 A;  3HCS A;  3N9P A;  2KIZ A;  1WEU A;  2NAA A;  1G25 A;  3IHP A;  2KWO A;  5B8D A;  3RPG C;  1BOR A;  2LGG A;  1U6G B;  3U5M A;  2ECV A;  4N3W A;  2LXP C;  4R7E A;  4ZQL A;  2MD7 B;  2JMD A;  4YC9 A;  2KWJ A;  4R2Y A;  3SOU A;  3U5O A;  3U5N A;  4BHW A;  5DKA A;  2QIZ A;  5EYA F;  2ECJ A;  2YSJ A;  4YBT A;  2MA6 A;  2YQM A;  1LDJ B;  2ECW A;  2YSM A;  2M6M A;  4LJN A;  2OXQ C;  5FEY A;  3MHH A;  2MUM A;  3LQJ A;  5KH7 A;  5G0F A;  2E6S A;  1MM2 A;  3HTK C;  5TRB A;  2ECG A;  5TAB A;  3L11 A;  1WIL A;  2CSZ A;  4A4C A;  2ZET C;  1IYM A;  2EA6 A;  2YQL A;  1WFK A;  4Q6F A;  4NN2 A;  3HCU A;  2XEU A;  2M1R A;  3PUQ A;  2LDR A;  4S3O C;  2KR4 A;  4XI1 A;  1XWH A;  2VNF A;  4GNE A;  5H1V A;  5I3L A;  4A49 A;  3O35 A;  2QIC A;  3ZNI A;  1WEQ A;  3LRQ A;  2VPG A;  2LQ6 A;  2VJE A;  3MHS A;  2ECT A;  4LK9 A;  1T1H A;  4LAD B;  2Y43 A;  5DIN A;  3ZVZ B;  4I7C A;  5KH3 A;  5G05 B;  2F6N A;  4WA6 A;  4QF2 A;  4WZ3 B;  4WZ0 A;  4LLB A;  4X3G A;  4B7Y C;  4P5O B;  2EGP A;  2JMJ A;  2CKL A;  2LRI C;  4GB0 A;  2MIQ A;  4CA1 A;  5H9M A;  1WEV A;  1JM7 A;  2K16 A;  2LGV A;  3KV5 A;  5D1L B;  3DQV R;  3L1Z B;  4PTB A;  2L0B A;  2M85 A;  4A4B A;  2HDP A;  2LGK A;  2LXH C;  4AUQ B;  3ZTG A;  4WZ2 A;  3T6R A;  5LKZ A;  4MSX A;  2KU3 A;  1WEN A;  2VPE A;  1FP0 A;  4FO9 A;  2YHN A;  2G45 A;  3I2D A;  2C2L A;  3N9N A;  4TKP B;  3ZPV 1;  1WEM A;  3M63 A;  4CCG X;  1WEW A;  3N9O A;  4O64 A;  4V3L C;  3ZVY A;  3M62 A;  4ZDT A;  2RSD A;  4I7D A;  5AIT A;  2KWN A;  1MM3 A;  2L43 A;  4FJC A;  2I50 A;  2FUI A;  3N9Q A;  1VYX A;  3LQH A;  2VJE B;  3GL6 A;  1WE9 A;  1K2F A;  5B76 A;  4YAT A;  2MA5 A;  3SHB A;  1RMD A;  3HCT A;  1Z2Q A;  5J3X A;  5FER A;  2PUY A;  2MNY A;  2JMI A;  5FB1 A;  2CSY A;  3O70 A;  1DVP A;  2D8S A;  4L58 A;  2YYR A;  2KGI A;  5C13 A;  2VJF A;  3RPG B;  4B86 C;  2CKL B;  2YUR A;  2YW8 A;  1F62 A;  1VFY A;  1JM7 B;  5JG6 A;  1JOC A;  2F42 A;  4YAD A;  2IDA A;  2MD8 C;  5C11 A;  4ZUX U;  2DX8 A;  5TDW A;  1WES A;  2LN0 A;  3EB6 A;  3KNV A;  4BBQ A;  2G43 A; 
#chains in the Genus database with same CATH topology
 4UP5 A;  3LVR E;  3FAO A;  5H1T A;  2BAY A;  2Y1N A;  4UI9 B;  3KQI A;  3O36 A;  5LKU A;  4F52 B;  4IC2 A;  4FIP A;  2KFT A;  3O47 A;  3EB5 A;  1V87 A;  5B78 A;  1CHC A;  5B75 A;  3M99 A;  4V3K C;  3O33 A;  3C6W A;  2YHO A;  4YBM A;  2RR4 A;  2K17 A;  1N87 A;  4LKA A;  2CSV A;  2UZG A;  2LGL A;  1ZBD B;  3L1X A;  1X4I A;  2EOD A;  2L5U A;  5LKT A;  4AYC A;  1HYI A;  4QQ4 A;  5LCW B;  1X4U A;  2MKE A;  4S3O B;  2FSA A;  3LVQ E;  4QF3 A;  3DPL R;  2FUU A;  3ASL A;  2DJA A;  4Z0R A;  5FB0 A;  4AVX A;  1WEE A;  2MT5 A;  3T9K A;  5G04 B;  4UP0 A;  2LV9 A;  3LQI A;  2XOY A;  2IQJ A;  5SVY A;  3E2D A;  2QJ0 A;  1Z60 A;  5B77 A;  3KV6 A;  4GNF A;  2YT5 A;  4PPE A;  3QZV A;  3LJU X;  2VPD A;  2H0D A;  2F6J A;  2VJF B;  5TBN A;  4F1P A;  3O34 A;  2FFW A;  3N9M A;  3FEH A;  2MNZ A;  2VPB A;  3U5P A;  1E4U A;  4R8P K;  5TDR A;  1HYJ A;  3MDB C;  4L7X A;  2K4D A;  2ECI A;  2D8U A;  5H1U A;  5D1M B;  4FK5 A;  2KKY A;  4I7B A;  4AP4 A;  5KH9 A;  2K1J A;  1WIM A;  2KKX A;  4MVT A;  2PNX A;  3ZYQ A;  3SOW A;  2XP0 A;  2EGM A;  3PHD A;  3SOX A;  2Y1M A;  3N9L A;  5LKX A;  2YUC A;  3RTR B;  2CT2 A;  2L75 A;  5SVX A;  1X4J A;  2B0O E;  3C5K A;  4N4F A;  3FL2 A;  4A0C D;  2KWK A;  2G6Q A;  2JRJ A;  3V43 A;  4IC3 A;  4AYC B;  4YAB A;  5D1K B;  1Z6U A;  2KE1 A;  3H7H A;  3O7A A;  2RI7 A;  2AN6 A;  2XB1 A;  3PUR A;  4YBS A;  1WEO A;  2KYU A;  2M3H A;  3JUE A;  2KRE A;  3NG2 A;  3GV4 A;  3FJU B;  2ECN A;  1VD4 A;  2E6R A;  2HYE D;  1LDK C;  2L80 A;  4GNG A;  2KGG A;  5AIU A;  3Q1D A;  2VP7 A;  2YU4 A;  4OGC A;  1WGM A;  1WEP A;  2C2V S;  4GND A;  3ZPV E;  5B79 A;  4C9Z A;  2YRE A;  1FBV A;  3T7L A;  3LDY A;  4YAX A;  4W4U A;  2OWA A;  2LAU A;  2H0D B;  1DCQ A;  3VK6 A;  3O37 A;  3HCS A;  3SUB A;  3N9P A;  2KIZ A;  1WEU A;  2XOC A;  2NAA A;  1G25 A;  3IHP A;  2KWO A;  3FM8 C;  5B8D A;  3RPG C;  1BOR A;  2LGG A;  1U6G B;  3U5M A;  2ECV A;  4N3W A;  2LXP C;  4R7E A;  2DSM A;  4ZQL A;  2MD7 B;  2JMD A;  4YC9 A;  2KWJ A;  2JM3 A;  4R2Y A;  3SOU A;  3U5O A;  3U5N A;  4BHW A;  5DKA A;  2QIZ A;  5EYA F;  3PLW A;  2ECJ A;  2YSJ A;  4YBT A;  2MA6 A;  3FAN A;  2YQM A;  1LDJ B;  2ECW A;  2YSM A;  2M6M A;  4LJN A;  2OXQ C;  5FEY A;  3MHH A;  2MUM A;  3LQJ A;  5KH7 A;  5G0F A;  2E6S A;  1MM2 A;  3HTK C;  5TRB A;  2ECG A;  5TAB A;  3L11 A;  1WIL A;  2CSZ A;  4A4C A;  2ZET C;  1IYM A;  2L7P A;  2EA6 A;  2YQL A;  1WFK A;  4Q6F A;  4NN2 A;  4Z0O A;  4H9D A;  3HCU A;  2XEU A;  2M1R A;  3PUQ A;  2LDR A;  4S3O C;  2KR4 A;  4XI1 A;  1XWH A;  2VNF A;  4GNE A;  2XOZ A;  5H1V A;  5I3L A;  4A49 A;  3O35 A;  2QIC A;  3ZNI A;  1WEQ A;  4OGE A;  3LRQ A;  2VPG A;  2LQ6 A;  2VJE A;  3MHS A;  2ECT A;  4LK9 A;  1T1H A;  4LAD B;  3KDE C;  2Y43 A;  5DIN A;  3ZVZ B;  4I7C A;  5KH3 A;  3DWD A;  5G05 B;  2F6N A;  4WA6 A;  4QF2 A;  4WZ3 B;  4WZ0 A;  3DDT A;  4LLB A;  4X3G A;  4B7Y C;  4P5O B;  2EGP A;  2JMJ A;  2CKL A;  5SVI A;  2M13 A;  2LRI C;  4GB0 A;  2MIQ A;  4CA1 A;  5H9M A;  1WEV A;  1JM7 A;  2K16 A;  2LGV A;  3KV5 A;  5D1L B;  2CON A;  3DQV R;  3L1Z B;  4PTB A;  2L0B A;  2M85 A;  4A4B A;  2P57 A;  2HDP A;  2LGK A;  2LXH C;  4AUQ B;  3ZTG A;  4WZ2 A;  3T6R A;  5LKZ A;  4MSX A;  2KU3 A;  1WEN A;  2VPE A;  1FP0 A;  4FO9 A;  2YHN A;  2G45 A;  3I2D A;  2C2L A;  3N9N A;  3M7K A;  4TKP B;  3ZPV 1;  1WEM A;  3M63 A;  4CCG X;  1WEW A;  3N9O A;  4O64 A;  4V3L C;  3ZVY A;  3M62 A;  4O62 A;  4ZDT A;  2RSD A;  4I7D A;  5AIT A;  2KWN A;  1MM3 A;  2L43 A;  4FJC A;  2I50 A;  2CRR A;  2FD4 A;  2FUI A;  3N9Q A;  2E61 A;  1VYX A;  3LQH A;  2VJE B;  2CRW A;  3GL6 A;  1WE9 A;  1K2F A;  5B76 A;  4YAT A;  2JUN A;  2MA5 A;  3SHB A;  1RMD A;  3HCT A;  1Z2Q A;  5J3X A;  5FER A;  2PUY A;  2MNY A;  2JMI A;  5FB1 A;  2YVR A;  5K3Q A;  2CSY A;  3O70 A;  1DVP A;  2D8S A;  4L58 A;  2YYR A;  2KGI A;  5C13 A;  2VJF A;  3RPG B;  4B86 C;  2CKL B;  5SVI B;  2EXU A;  2YUR A;  1MBM A;  2YW8 A;  1F62 A;  1VFY A;  1JM7 B;  5JG6 A;  1JOC A;  2F42 A;  4YAD A;  2IDA A;  2MD8 C;  5C11 A;  4ZUX U;  2DX8 A;  5TDW A;  1WES A;  2LN0 A;  3EB6 A;  3KNV A;  4BBQ A;  2G43 A; 
#chains in the Genus database with same CATH homology
 4UP5 A;  5H1T A;  2BAY A;  2Y1N A;  4UI9 B;  3KQI A;  3O36 A;  5LKU A;  4F52 B;  4IC2 A;  4FIP A;  2KFT A;  3EB5 A;  1V87 A;  5B78 A;  1CHC A;  5B75 A;  3M99 A;  4V3K C;  3O33 A;  3C6W A;  2YHO A;  4YBM A;  2K17 A;  1N87 A;  4LKA A;  2UZG A;  2LGL A;  1ZBD B;  3L1X A;  1X4I A;  2EOD A;  2L5U A;  5LKT A;  4AYC A;  1HYI A;  5LCW B;  1X4U A;  4S3O B;  2FSA A;  4QF3 A;  3DPL R;  2FUU A;  3ASL A;  5FB0 A;  4AVX A;  1WEE A;  2MT5 A;  5G04 B;  4UP0 A;  2LV9 A;  3LQI A;  2QJ0 A;  1Z60 A;  5B77 A;  3KV6 A;  4GNF A;  2YT5 A;  4PPE A;  3QZV A;  2VPD A;  2H0D A;  2F6J A;  2VJF B;  5TBN A;  3O34 A;  3N9M A;  2MNZ A;  2VPB A;  3U5P A;  1E4U A;  4R8P K;  5TDR A;  1HYJ A;  4L7X A;  2K4D A;  2ECI A;  5H1U A;  5D1M B;  4FK5 A;  4I7B A;  4AP4 A;  5KH9 A;  2K1J A;  1WIM A;  4MVT A;  2PNX A;  3ZYQ A;  3SOW A;  3PHD A;  3SOX A;  2Y1M A;  3N9L A;  5LKX A;  2YUC A;  3RTR B;  2CT2 A;  2L75 A;  1X4J A;  3C5K A;  4N4F A;  3FL2 A;  4A0C D;  2KWK A;  2G6Q A;  2JRJ A;  3V43 A;  4IC3 A;  4AYC B;  4YAB A;  5D1K B;  1Z6U A;  2KE1 A;  3O7A A;  2RI7 A;  2AN6 A;  2XB1 A;  3PUR A;  4YBS A;  1WEO A;  2KYU A;  2M3H A;  2KRE A;  3NG2 A;  3GV4 A;  2ECN A;  1VD4 A;  2E6R A;  2HYE D;  1LDK C;  2L80 A;  4GNG A;  2KGG A;  5AIU A;  2VP7 A;  2YU4 A;  1WGM A;  1WEP A;  2C2V S;  4GND A;  3ZPV E;  5B79 A;  4C9Z A;  2YRE A;  1FBV A;  3T7L A;  4YAX A;  4W4U A;  2H0D B;  3VK6 A;  3O37 A;  3HCS A;  3N9P A;  2KIZ A;  1WEU A;  2NAA A;  1G25 A;  3IHP A;  2KWO A;  5B8D A;  3RPG C;  1BOR A;  2LGG A;  1U6G B;  3U5M A;  2ECV A;  4N3W A;  2LXP C;  4R7E A;  4ZQL A;  2MD7 B;  2JMD A;  4YC9 A;  2KWJ A;  4R2Y A;  3SOU A;  3U5O A;  3U5N A;  4BHW A;  5DKA A;  2QIZ A;  5EYA F;  2ECJ A;  2YSJ A;  4YBT A;  2MA6 A;  2YQM A;  1LDJ B;  2ECW A;  2YSM A;  2M6M A;  4LJN A;  2OXQ C;  5FEY A;  3MHH A;  2MUM A;  3LQJ A;  5KH7 A;  5G0F A;  2E6S A;  1MM2 A;  3HTK C;  5TRB A;  2ECG A;  5TAB A;  3L11 A;  1WIL A;  2CSZ A;  4A4C A;  2ZET C;  1IYM A;  2EA6 A;  2YQL A;  1WFK A;  4Q6F A;  4NN2 A;  3HCU A;  2XEU A;  2M1R A;  3PUQ A;  2LDR A;  4S3O C;  2KR4 A;  4XI1 A;  1XWH A;  2VNF A;  4GNE A;  5H1V A;  5I3L A;  4A49 A;  3O35 A;  2QIC A;  3ZNI A;  1WEQ A;  3LRQ A;  2VPG A;  2LQ6 A;  2VJE A;  3MHS A;  2ECT A;  4LK9 A;  1T1H A;  4LAD B;  2Y43 A;  5DIN A;  3ZVZ B;  4I7C A;  5KH3 A;  5G05 B;  2F6N A;  4WA6 A;  4QF2 A;  4WZ3 B;  4WZ0 A;  4LLB A;  4X3G A;  4B7Y C;  4P5O B;  2EGP A;  2JMJ A;  2CKL A;  2LRI C;  4GB0 A;  2MIQ A;  4CA1 A;  5H9M A;  1WEV A;  1JM7 A;  2K16 A;  2LGV A;  3KV5 A;  5D1L B;  3DQV R;  3L1Z B;  4PTB A;  2L0B A;  2M85 A;  4A4B A;  2HDP A;  2LGK A;  2LXH C;  4AUQ B;  3ZTG A;  4WZ2 A;  3T6R A;  5LKZ A;  4MSX A;  2KU3 A;  1WEN A;  2VPE A;  1FP0 A;  4FO9 A;  2YHN A;  2G45 A;  3I2D A;  2C2L A;  3N9N A;  4TKP B;  3ZPV 1;  1WEM A;  3M63 A;  4CCG X;  1WEW A;  3N9O A;  4O64 A;  4V3L C;  3ZVY A;  3M62 A;  4ZDT A;  2RSD A;  4I7D A;  5AIT A;  2KWN A;  1MM3 A;  2L43 A;  4FJC A;  2I50 A;  2FUI A;  3N9Q A;  1VYX A;  3LQH A;  2VJE B;  3GL6 A;  1WE9 A;  1K2F A;  5B76 A;  4YAT A;  2MA5 A;  3SHB A;  1RMD A;  3HCT A;  1Z2Q A;  5J3X A;  5FER A;  2PUY A;  2MNY A;  2JMI A;  5FB1 A;  2CSY A;  3O70 A;  1DVP A;  2D8S A;  4L58 A;  2YYR A;  2KGI A;  5C13 A;  2VJF A;  3RPG B;  4B86 C;  2CKL B;  2YUR A;  2YW8 A;  1F62 A;  1VFY A;  1JM7 B;  5JG6 A;  1JOC A;  2F42 A;  4YAD A;  2IDA A;  2MD8 C;  5C11 A;  4ZUX U;  2DX8 A;  5TDW A;  1WES A;  2LN0 A;  3EB6 A;  3KNV A;  4BBQ A;  2G43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...