1E4UA

N-terminal ring finger domain of human not-4
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
78
structure length
78
Chain Sequence
b'MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REPRESSOR NOT4
publication title The Structure of the C4C4 Ring Finger of Human not4 Reveals Features Distinct from Those of C3Hc4 Ring Fingers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 4
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14570 zf-RING_4 RING/Ubox like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1e4uA00
3PHDA 4V3LC 1X4JA 4MSXA 4YBSA 2CSZA 2L43A 2YSJA 5TDWA 2I50A 4LK9A 3L1ZB 1HYIA 5D1LB 2M85A 2M6MA 2VJFB 1WFKA 3LQIA 5H1UA 3HCTA 4PPEA 1IYMA 3FL2A 3DQVR 3KNVA 4WZ0A 4P5OB 1G25A 1WEWA 2QIZA 2E6SA 3O70A 3T7LA 4IC2A 1VD4A 5KH7A 2K17A 4L58A 4A49A 2AN6A 3GV4A 4B86C 3VK6A 2YURA 1WENA 1WEOA 4V3KC 5LKTA 5TDRA 4X3GA 3GL6A 2OXQC 5B78A 2VJFA 1WEVA 4WZ2A 4FO9A 3ZNIA 4I7DA 1DVPA 5LKUA 1XWHA 4ZQLA 2EA6A 2VPDA 4WZ3B 5FB1A 1VYXA 2FUUA 1JOCA 3ZPVE 3M63A 4AUQB 3C5KA 3LQHA 4YBTA 1LDKC 1WILA 2JMJA 2ECTA 5FB0A 2LN0A 4UP5A 2MIQA 1LDJB 5TBNA 2L0BA 2LGVA 5KH9A 2CSYA 4N4FA 1WEPA 2ECJA 2LGGA 3KQIA 3ZTGA 3O37A 4FJCA 4LLBA 2YYRA 2YSMA 2FUIA 2IDAA 2YW8A 5C13A 2MNYA 5B76A 1RMDA 4A4CA 3RPGC 3SOUA 3U5PA 2YU4A 1V87A 2KU3A 3U5MA 3ZPV1 2L75A 5C11A 5H9MA 4YBMA 4ZUXU 2BAYA 4NN2A 1BORA 2LRIC 1FP0A 2YHOA 5LKXA 4AYCB 4CA1A 2CKLB 2F42A 3N9OA 3N9MA 2MT5A 2KIZA 1HYJA 1Z6UA 4MVTA 1WEEA 2LXPC 1X4IA 2KWNA 2D8SA 2KFTA 3O36A 4AVXA 5B75A 5FERA 5FEYA 3EB5A 1WEMA 2MA5A 4F52B 3C6WA 2G43A 4L7XA 4QF3A 4B7YC 4YAXA 3O34A 2MNZA 4N3WA 2LQ6A 3U5OA 1X4UA 2HDPA 1T1HA 2VJEB 4AYCA 2ECVA 3RPGB 4GNGA 2YQLA 4R7EA 3DPLR 4W4UA 3IHPA 2CKLA 5G0FA 2LDRA 2EGPA 4UI9B 5AITA 4R8PK 3SOWA 2MD8C 2KGGA 4PTBA 2PNXA 2FSAA 2ZETC 3O7AA 2XB1A 2QICA 5G05B 2MUMA 5LKZA 1FBVA 4YC9A 3EB6A 2C2LA 5DINA 3SHBA 2MD7B 5JG6A 5EYAF 2VPBA 4BHWA 2YQMA 2VJEA 2L5UA 2QJ0A 4IC3A 4FIPA 1Z2QA 2ECWA 4YABA 4I7CA 2CT2A 3ZYQA 4A0CD 1MM2A 4LJNA 4FK5A 4I7BA 2MA6A 1WIMA 2ECIA 4GNEA 1F62A 1Z60A 5G04B 2YUCA 3NG2A 2KE1A 5LCWB 2Y1MA 1ZBDB 4YATA 1K2FA 2KYUA 5B77A 2F6NA 2E6RA 2VP7A 2JMDA 5TRBA 3M99A 3PUQA 2M3HA 1VFYA 5D1KB 4R2YA 2ECGA 5D1MB 2LV9A 3HCUA 2G45A 1WGMA 4GB0A 2Y43A 4QF2A 2Y1NA 2VNFA 1JM7B 2KGIA 5I3LA 4TKPB 2KWKA 3N9LA 4GNDA 2YT5A 1WE9A 3ZVYA 3LRQA 4S3OC 3MHSA 4XI1A 4A4BA 4BBQA 2KR4A 3HCSA 2K16A 2KWJA 4C9ZA 2VPGA 4CCGX 2VPEA 2M1RA 3MHHA 3KV6A 2XEUA 5AIUA 2YREA 1MM3A 1JM7A 3LQJA 2F6JA 5H1VA 3KV5A 3O35A 5B8DA 4AP4A 3V43A 2LGLA 5TABA 2LGKA 4LADB 2DX8A 2G6QA 5B79A 3PURA 3HTKC 3SOXA 4LKAA 4YADA 2YHNA 2UZGA 1CHCA 1WEQA 3O33A 1WESA 3I2DA 1N87A 4ZDTA 2LXHC 2H0DB 3L1XA 2JMIA 3N9QA 3ZVZB 5DKAA 3L11A 2L80A 3RTRB 4Q6FA 4S3OB 1U6GB 3M62A 1WEUA 2K4DA 3N9PA 2HYED 3ASLA 2NAAA 5KH3A 4WA6A 4GNFA 2C2VS 2PUYA 2ECNA 2RI7A 5H1TA 5J3XA 2JRJA 2KWOA 2K1JA 4O64A 4UP0A 3N9NA 3U5NA 1E4UA 3QZVA 2H0DA 2KREA 2EODA 2RSDA 3T6RA
chains in the Genus database with same CATH superfamily
3PHDA 2CRRA 3E2DA 4V3LC 1X4JA 2B0OE 3MDBC 4MSXA 2XOZA 4YBSA 2CSZA 2L43A 2YSJA 5TDWA 2I50A 4LK9A 3L1ZB 1HYIA 5D1LB 2M85A 2DJAA 4OGCA 2M6MA 2VJFB 1WFKA 2CRWA 3LQIA 5H1UA 2D8UA 3HCTA 2XOYA 4PPEA 1IYMA 3FL2A 3DQVR 3KNVA 3FANA 4WZ0A 4P5OB 1G25A 1WEWA 2QIZA 2E6SA 3O70A 3T7LA 4IC2A 1VD4A 5KH7A 2K17A 4L58A 4A49A 2AN6A 3GV4A 4B86C 3VK6A 2YURA 1WENA 1WEOA 4V3KC 5LKTA 5TDRA 4X3GA 2P57A 3GL6A 2OXQC 5SVIB 2YVRA 5B78A 2VJFA 1WEVA 4WZ2A 4FO9A 3ZNIA 4I7DA 1DVPA 5LKUA 1XWHA 4ZQLA 3FEHA 2EA6A 2VPDA 4WZ3B 5FB1A 1VYXA 2FUUA 1JOCA 3ZPVE 3M63A 4AUQB 3C5KA 3LQHA 4YBTA 1LDKC 1WILA 5SVYA 2JMJA 2ECTA 5FB0A 2LN0A 4UP5A 2CONA 2MIQA 1LDJB 5TBNA 2L0BA 2LGVA 5KH9A 2CSYA 4N4FA 1WEPA 2ECJA 5SVIA 2LGGA 3KQIA 3ZTGA 3O37A 4FJCA 4LLBA 2YYRA 2YSMA 2FUIA 2IDAA 2YW8A 5C13A 2MNYA 5B76A 3DWDA 1RMDA 4A4CA 3RPGC 3SOUA 3U5PA 2YU4A 2XOCA 1V87A 2KU3A 3U5MA 3ZPV1 2L75A 2JUNA 5C11A 5H9MA 4YBMA 4ZUXU 2BAYA 4NN2A 1BORA 2LRIC 1FP0A 2YHOA 5LKXA 4Z0OA 4AYCB 4CA1A 2RR4A 2M13A 3H7HA 2CKLB 2F42A 3N9OA 1DCQA 2MT5A 2KIZA 3N9MA 1HYJA 1Z6UA 4MVTA 1WEEA 2LXPC 1X4IA 2KWNA 2D8SA 3M7KA 2KFTA 3O36A 4AVXA 5B75A 5FERA 5FEYA 3EB5A 1WEMA 2MA5A 4F52B 3C6WA 2G43A 4L7XA 4QF3A 4B7YC 2OWAA 4YAXA 3O34A 2MNZA 4N3WA 2LQ6A 3U5OA 1X4UA 2XP0A 2HDPA 1T1HA 2VJEB 4AYCA 3KDEC 2MKEA 2ECVA 3RPGB 4GNGA 2YQLA 4R7EA 3DPLR 4W4UA 3IHPA 2CKLA 5G0FA 2LDRA 2EGPA 4UI9B 5AITA 4R8PK 3SOWA 2MD8C 2KGGA 4PTBA 2PNXA 2FSAA 2ZETC 3O7AA 2XB1A 2QICA 5G05B 3LJUX 2MUMA 5LKZA 1FBVA 4YC9A 4O62A 3EB6A 2C2LA 5DINA 2CSVA 3SHBA 2MD7B 5JG6A 5EYAF 4H9DA 2VPBA 4BHWA 2YQMA 2VJEA 2L5UA 2QJ0A 4IC3A 3FM8C 4FIPA 1Z2QA 2ECWA 4YABA 4I7CA 2CT2A 3ZYQA 4A0CD 1MM2A 4LJNA 4FK5A 2L7PA 4I7BA 2MA6A 1WIMA 3LVRE 2ECIA 4GNEA 1F62A 1Z60A 5G04B 2YUCA 3NG2A 2KE1A 5LCWB 2Y1MA 1ZBDB 4YATA 1K2FA 2KYUA 5B77A 2F6NA 2E6RA 2FFWA 2EGMA 2VP7A 2JMDA 5TRBA 3M99A 3PUQA 2M3HA 2IQJA 1VFYA 5D1KB 4R2YA 2ECGA 5D1MB 2LV9A 3HCUA 2G45A 1WGMA 4GB0A 2Y43A 2LAUA 4QF2A 2Y1NA 2VNFA 1JM7B 2KGIA 5I3LA 4TKPB 2KWKA 4F1PA 3N9LA 2E61A 4GNDA 3LDYA 2YT5A 1WE9A 3ZVYA 3LRQA 4S3OC 3MHSA 4XI1A 4A4BA 4BBQA 4Z0RA 2KR4A 3HCSA 2K16A 2KWJA 4C9ZA 2VPGA 4CCGX 2VPEA 2M1RA 3MHHA 3KV6A 2XEUA 4QQ4A 2FD4A 4OGEA 5AIUA 2YREA 1MM3A 3FJUB 1JM7A 3LQJA 2F6JA 5H1VA 3KV5A 3O35A 5B8DA 4AP4A 3V43A 2LGLA 5TABA 2LGKA 4LADB 2DX8A 2G6QA 5B79A 3PURA 3HTKC 3O47A 3SOXA 2JM3A 4LKAA 3LVQE 4YADA 2YHNA 2UZGA 1CHCA 1WEQA 3O33A 1WESA 3I2DA 1N87A 4ZDTA 2LXHC 2H0DB 3L1XA 2JMIA 2KKYA 3N9QA 3JUEA 5SVXA 1MBMA 3ZVZB 3FAOA 3DDTA 5DKAA 3L11A 2L80A 3RTRB 4Q6FA 4S3OB 1U6GB 3M62A 1WEUA 2K4DA 2DSMA 3N9PA 2HYED 3ASLA 2NAAA 5KH3A 3PLWA 4GNFA 4WA6A 3T9KA 2C2VS 2PUYA 2ECNA 2RI7A 2KKXA 5H1TA 5J3XA 2JRJA 2KWOA 2K1JA 4O64A 4UP0A 3N9NA 3Q1DA 3U5NA 1E4UA 3SUBA 5K3QA 3QZVA 2H0DA 2KREA 2EXUA 2EODA 2RSDA 3T6RA
chains in the Genus database with same CATH topology
3PHDA 4V3LC 1X4JA 4MSXA 4YBSA 2CSZA 2L43A 2YSJA 5TDWA 2I50A 4LK9A 3L1ZB 1HYIA 5D1LB 2M85A 2M6MA 2VJFB 1WFKA 3LQIA 5H1UA 3HCTA 4PPEA 1IYMA 3FL2A 3DQVR 3KNVA 4WZ0A 4P5OB 1G25A 1WEWA 2QIZA 2E6SA 3O70A 3T7LA 4IC2A 1VD4A 5KH7A 2K17A 4L58A 4A49A 2AN6A 3GV4A 4B86C 3VK6A 2YURA 1WENA 1WEOA 4V3KC 5LKTA 5TDRA 4X3GA 3GL6A 2OXQC 5B78A 2VJFA 1WEVA 4WZ2A 4FO9A 3ZNIA 4I7DA 1DVPA 5LKUA 1XWHA 4ZQLA 2EA6A 2VPDA 4WZ3B 5FB1A 1VYXA 2FUUA 1JOCA 3ZPVE 3M63A 4AUQB 3C5KA 3LQHA 4YBTA 1LDKC 1WILA 2JMJA 2ECTA 5FB0A 2LN0A 4UP5A 2MIQA 1LDJB 5TBNA 2L0BA 2LGVA 5KH9A 2CSYA 4N4FA 1WEPA 2ECJA 2LGGA 3KQIA 3ZTGA 3O37A 4FJCA 4LLBA 2YYRA 2YSMA 2FUIA 2IDAA 2YW8A 5C13A 2MNYA 5B76A 1RMDA 4A4CA 3RPGC 3SOUA 3U5PA 2YU4A 1V87A 2KU3A 3U5MA 3ZPV1 2L75A 5C11A 5H9MA 4YBMA 4ZUXU 2BAYA 4NN2A 1BORA 2LRIC 1FP0A 2YHOA 5LKXA 4AYCB 4CA1A 2CKLB 2F42A 3N9OA 3N9MA 2MT5A 2KIZA 1HYJA 1Z6UA 4MVTA 1WEEA 2LXPC 1X4IA 2KWNA 2D8SA 2KFTA 3O36A 4AVXA 5B75A 5FERA 5FEYA 3EB5A 1WEMA 2MA5A 4F52B 3C6WA 2G43A 4L7XA 4QF3A 4B7YC 4YAXA 3O34A 2MNZA 4N3WA 2LQ6A 3U5OA 1X4UA 2HDPA 1T1HA 2VJEB 4AYCA 2ECVA 3RPGB 4GNGA 2YQLA 4R7EA 3DPLR 4W4UA 3IHPA 2CKLA 5G0FA 2LDRA 2EGPA 4UI9B 5AITA 4R8PK 3SOWA 2MD8C 2KGGA 4PTBA 2PNXA 2FSAA 2ZETC 3O7AA 2XB1A 2QICA 5G05B 2MUMA 5LKZA 1FBVA 4YC9A 3EB6A 2C2LA 5DINA 3SHBA 2MD7B 5JG6A 5EYAF 2VPBA 4BHWA 2YQMA 2VJEA 2L5UA 2QJ0A 4IC3A 4FIPA 1Z2QA 2ECWA 4YABA 4I7CA 2CT2A 3ZYQA 4A0CD 1MM2A 4LJNA 4FK5A 4I7BA 2MA6A 1WIMA 2ECIA 4GNEA 1F62A 1Z60A 5G04B 2YUCA 3NG2A 2KE1A 5LCWB 2Y1MA 1ZBDB 4YATA 1K2FA 2KYUA 5B77A 2F6NA 2E6RA 2VP7A 2JMDA 5TRBA 3M99A 3PUQA 2M3HA 1VFYA 5D1KB 4R2YA 2ECGA 5D1MB 2LV9A 3HCUA 2G45A 1WGMA 4GB0A 2Y43A 4QF2A 2Y1NA 2VNFA 1JM7B 2KGIA 5I3LA 4TKPB 2KWKA 3N9LA 4GNDA 2YT5A 1WE9A 3ZVYA 3LRQA 4S3OC 3MHSA 4XI1A 4A4BA 4BBQA 2KR4A 3HCSA 2K16A 2KWJA 4C9ZA 2VPGA 4CCGX 2VPEA 2M1RA 3MHHA 3KV6A 2XEUA 5AIUA 2YREA 1MM3A 1JM7A 3LQJA 2F6JA 5H1VA 3KV5A 3O35A 5B8DA 4AP4A 3V43A 2LGLA 5TABA 2LGKA 4LADB 2DX8A 2G6QA 5B79A 3PURA 3HTKC 3SOXA 4LKAA 4YADA 2YHNA 2UZGA 1CHCA 1WEQA 3O33A 1WESA 3I2DA 1N87A 4ZDTA 2LXHC 2H0DB 3L1XA 2JMIA 3N9QA 3ZVZB 5DKAA 3L11A 2L80A 3RTRB 4Q6FA 4S3OB 1U6GB 3M62A 1WEUA 2K4DA 3N9PA 2HYED 3ASLA 2NAAA 5KH3A 4WA6A 4GNFA 2C2VS 2PUYA 2ECNA 2RI7A 5H1TA 5J3XA 2JRJA 2KWOA 2K1JA 4O64A 4UP0A 3N9NA 3U5NA 1E4UA 3QZVA 2H0DA 2KREA 2EODA 2RSDA 3T6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHD A;  4V3L C;  1X4J A;  4MSX A;  4YBS A;  2CSZ A;  2L43 A;  2YSJ A;  5TDW A;  2I50 A;  4LK9 A;  3L1Z B;  1HYI A;  5D1L B;  2M85 A;  2M6M A;  2VJF B;  1WFK A;  3LQI A;  5H1U A;  3HCT A;  4PPE A;  1IYM A;  3FL2 A;  3DQV R;  3KNV A;  4WZ0 A;  4P5O B;  1G25 A;  1WEW A;  2QIZ A;  2E6S A;  3O70 A;  3T7L A;  4IC2 A;  1VD4 A;  5KH7 A;  2K17 A;  4L58 A;  4A49 A;  2AN6 A;  3GV4 A;  4B86 C;  3VK6 A;  2YUR A;  1WEN A;  1WEO A;  4V3K C;  5LKT A;  5TDR A;  4X3G A;  3GL6 A;  2OXQ C;  5B78 A;  2VJF A;  1WEV A;  4WZ2 A;  4FO9 A;  3ZNI A;  4I7D A;  1DVP A;  5LKU A;  1XWH A;  4ZQL A;  2EA6 A;  2VPD A;  4WZ3 B;  5FB1 A;  1VYX A;  2FUU A;  1JOC A;  3ZPV E;  3M63 A;  4AUQ B;  3C5K A;  3LQH A;  4YBT A;  1LDK C;  1WIL A;  2JMJ A;  2ECT A;  5FB0 A;  2LN0 A;  4UP5 A;  2MIQ A;  1LDJ B;  5TBN A;  2L0B A;  2LGV A;  5KH9 A;  2CSY A;  4N4F A;  1WEP A;  2ECJ A;  2LGG A;  3KQI A;  3ZTG A;  3O37 A;  4FJC A;  4LLB A;  2YYR A;  2YSM A;  2FUI A;  2IDA A;  2YW8 A;  5C13 A;  2MNY A;  5B76 A;  1RMD A;  4A4C A;  3RPG C;  3SOU A;  3U5P A;  2YU4 A;  1V87 A;  2KU3 A;  3U5M A;  3ZPV 1;  2L75 A;  5C11 A;  5H9M A;  4YBM A;  4ZUX U;  2BAY A;  4NN2 A;  1BOR A;  2LRI C;  1FP0 A;  2YHO A;  5LKX A;  4AYC B;  4CA1 A;  2CKL B;  2F42 A;  3N9O A;  3N9M A;  2MT5 A;  2KIZ A;  1HYJ A;  1Z6U A;  4MVT A;  1WEE A;  2LXP C;  1X4I A;  2KWN A;  2D8S A;  2KFT A;  3O36 A;  4AVX A;  5B75 A;  5FER A;  5FEY A;  3EB5 A;  1WEM A;  2MA5 A;  4F52 B;  3C6W A;  2G43 A;  4L7X A;  4QF3 A;  4B7Y C;  4YAX A;  3O34 A;  2MNZ A;  4N3W A;  2LQ6 A;  3U5O A;  1X4U A;  2HDP A;  1T1H A;  2VJE B;  4AYC A;  2ECV A;  3RPG B;  4GNG A;  2YQL A;  4R7E A;  3DPL R;  4W4U A;  3IHP A;  2CKL A;  5G0F A;  2LDR A;  2EGP A;  4UI9 B;  5AIT A;  4R8P K;  3SOW A;  2MD8 C;  2KGG A;  4PTB A;  2PNX A;  2FSA A;  2ZET C;  3O7A A;  2XB1 A;  2QIC A;  5G05 B;  2MUM A;  5LKZ A;  1FBV A;  4YC9 A;  3EB6 A;  2C2L A;  5DIN A;  3SHB A;  2MD7 B;  5JG6 A;  5EYA F;  2VPB A;  4BHW A;  2YQM A;  2VJE A;  2L5U A;  2QJ0 A;  4IC3 A;  4FIP A;  1Z2Q A;  2ECW A;  4YAB A;  4I7C A;  2CT2 A;  3ZYQ A;  4A0C D;  1MM2 A;  4LJN A;  4FK5 A;  4I7B A;  2MA6 A;  1WIM A;  2ECI A;  4GNE A;  1F62 A;  1Z60 A;  5G04 B;  2YUC A;  3NG2 A;  2KE1 A;  5LCW B;  2Y1M A;  1ZBD B;  4YAT A;  1K2F A;  2KYU A;  5B77 A;  2F6N A;  2E6R A;  2VP7 A;  2JMD A;  5TRB A;  3M99 A;  3PUQ A;  2M3H A;  1VFY A;  5D1K B;  4R2Y A;  2ECG A;  5D1M B;  2LV9 A;  3HCU A;  2G45 A;  1WGM A;  4GB0 A;  2Y43 A;  4QF2 A;  2Y1N A;  2VNF A;  1JM7 B;  2KGI A;  5I3L A;  4TKP B;  2KWK A;  3N9L A;  4GND A;  2YT5 A;  1WE9 A;  3ZVY A;  3LRQ A;  4S3O C;  3MHS A;  4XI1 A;  4A4B A;  4BBQ A;  2KR4 A;  3HCS A;  2K16 A;  2KWJ A;  4C9Z A;  2VPG A;  4CCG X;  2VPE A;  2M1R A;  3MHH A;  3KV6 A;  2XEU A;  5AIU A;  2YRE A;  1MM3 A;  1JM7 A;  3LQJ A;  2F6J A;  5H1V A;  3KV5 A;  3O35 A;  5B8D A;  4AP4 A;  3V43 A;  2LGL A;  5TAB A;  2LGK A;  4LAD B;  2DX8 A;  2G6Q A;  5B79 A;  3PUR A;  3HTK C;  3SOX A;  4LKA A;  4YAD A;  2YHN A;  2UZG A;  1CHC A;  1WEQ A;  3O33 A;  1WES A;  3I2D A;  1N87 A;  4ZDT A;  2LXH C;  2H0D B;  3L1X A;  2JMI A;  3N9Q A;  3ZVZ B;  5DKA A;  3L11 A;  2L80 A;  3RTR B;  4Q6F A;  4S3O B;  1U6G B;  3M62 A;  1WEU A;  2K4D A;  3N9P A;  2HYE D;  3ASL A;  2NAA A;  5KH3 A;  4WA6 A;  4GNF A;  2C2V S;  2PUY A;  2ECN A;  2RI7 A;  5H1T A;  5J3X A;  2JRJ A;  2KWO A;  2K1J A;  4O64 A;  4UP0 A;  3N9N A;  3U5N A;  1E4U A;  3QZV A;  2H0D A;  2KRE A;  2EOD A;  2RSD A;  3T6R A; 
#chains in the Genus database with same CATH topology
 3PHD A;  2CRR A;  3E2D A;  4V3L C;  1X4J A;  2B0O E;  3MDB C;  4MSX A;  2XOZ A;  4YBS A;  2CSZ A;  2L43 A;  2YSJ A;  5TDW A;  2I50 A;  4LK9 A;  3L1Z B;  1HYI A;  5D1L B;  2M85 A;  2DJA A;  4OGC A;  2M6M A;  2VJF B;  1WFK A;  2CRW A;  3LQI A;  5H1U A;  2D8U A;  3HCT A;  2XOY A;  4PPE A;  1IYM A;  3FL2 A;  3DQV R;  3KNV A;  3FAN A;  4WZ0 A;  4P5O B;  1G25 A;  1WEW A;  2QIZ A;  2E6S A;  3O70 A;  3T7L A;  4IC2 A;  1VD4 A;  5KH7 A;  2K17 A;  4L58 A;  4A49 A;  2AN6 A;  3GV4 A;  4B86 C;  3VK6 A;  2YUR A;  1WEN A;  1WEO A;  4V3K C;  5LKT A;  5TDR A;  4X3G A;  2P57 A;  3GL6 A;  2OXQ C;  5SVI B;  2YVR A;  5B78 A;  2VJF A;  1WEV A;  4WZ2 A;  4FO9 A;  3ZNI A;  4I7D A;  1DVP A;  5LKU A;  1XWH A;  4ZQL A;  3FEH A;  2EA6 A;  2VPD A;  4WZ3 B;  5FB1 A;  1VYX A;  2FUU A;  1JOC A;  3ZPV E;  3M63 A;  4AUQ B;  3C5K A;  3LQH A;  4YBT A;  1LDK C;  1WIL A;  5SVY A;  2JMJ A;  2ECT A;  5FB0 A;  2LN0 A;  4UP5 A;  2CON A;  2MIQ A;  1LDJ B;  5TBN A;  2L0B A;  2LGV A;  5KH9 A;  2CSY A;  4N4F A;  1WEP A;  2ECJ A;  5SVI A;  2LGG A;  3KQI A;  3ZTG A;  3O37 A;  4FJC A;  4LLB A;  2YYR A;  2YSM A;  2FUI A;  2IDA A;  2YW8 A;  5C13 A;  2MNY A;  5B76 A;  3DWD A;  1RMD A;  4A4C A;  3RPG C;  3SOU A;  3U5P A;  2YU4 A;  2XOC A;  1V87 A;  2KU3 A;  3U5M A;  3ZPV 1;  2L75 A;  2JUN A;  5C11 A;  5H9M A;  4YBM A;  4ZUX U;  2BAY A;  4NN2 A;  1BOR A;  2LRI C;  1FP0 A;  2YHO A;  5LKX A;  4Z0O A;  4AYC B;  4CA1 A;  2RR4 A;  2M13 A;  3H7H A;  2CKL B;  2F42 A;  3N9O A;  1DCQ A;  2MT5 A;  2KIZ A;  3N9M A;  1HYJ A;  1Z6U A;  4MVT A;  1WEE A;  2LXP C;  1X4I A;  2KWN A;  2D8S A;  3M7K A;  2KFT A;  3O36 A;  4AVX A;  5B75 A;  5FER A;  5FEY A;  3EB5 A;  1WEM A;  2MA5 A;  4F52 B;  3C6W A;  2G43 A;  4L7X A;  4QF3 A;  4B7Y C;  2OWA A;  4YAX A;  3O34 A;  2MNZ A;  4N3W A;  2LQ6 A;  3U5O A;  1X4U A;  2XP0 A;  2HDP A;  1T1H A;  2VJE B;  4AYC A;  3KDE C;  2MKE A;  2ECV A;  3RPG B;  4GNG A;  2YQL A;  4R7E A;  3DPL R;  4W4U A;  3IHP A;  2CKL A;  5G0F A;  2LDR A;  2EGP A;  4UI9 B;  5AIT A;  4R8P K;  3SOW A;  2MD8 C;  2KGG A;  4PTB A;  2PNX A;  2FSA A;  2ZET C;  3O7A A;  2XB1 A;  2QIC A;  5G05 B;  3LJU X;  2MUM A;  5LKZ A;  1FBV A;  4YC9 A;  4O62 A;  3EB6 A;  2C2L A;  5DIN A;  2CSV A;  3SHB A;  2MD7 B;  5JG6 A;  5EYA F;  4H9D A;  2VPB A;  4BHW A;  2YQM A;  2VJE A;  2L5U A;  2QJ0 A;  4IC3 A;  3FM8 C;  4FIP A;  1Z2Q A;  2ECW A;  4YAB A;  4I7C A;  2CT2 A;  3ZYQ A;  4A0C D;  1MM2 A;  4LJN A;  4FK5 A;  2L7P A;  4I7B A;  2MA6 A;  1WIM A;  3LVR E;  2ECI A;  4GNE A;  1F62 A;  1Z60 A;  5G04 B;  2YUC A;  3NG2 A;  2KE1 A;  5LCW B;  2Y1M A;  1ZBD B;  4YAT A;  1K2F A;  2KYU A;  5B77 A;  2F6N A;  2E6R A;  2FFW A;  2EGM A;  2VP7 A;  2JMD A;  5TRB A;  3M99 A;  3PUQ A;  2M3H A;  2IQJ A;  1VFY A;  5D1K B;  4R2Y A;  2ECG A;  5D1M B;  2LV9 A;  3HCU A;  2G45 A;  1WGM A;  4GB0 A;  2Y43 A;  2LAU A;  4QF2 A;  2Y1N A;  2VNF A;  1JM7 B;  2KGI A;  5I3L A;  4TKP B;  2KWK A;  4F1P A;  3N9L A;  2E61 A;  4GND A;  3LDY A;  2YT5 A;  1WE9 A;  3ZVY A;  3LRQ A;  4S3O C;  3MHS A;  4XI1 A;  4A4B A;  4BBQ A;  4Z0R A;  2KR4 A;  3HCS A;  2K16 A;  2KWJ A;  4C9Z A;  2VPG A;  4CCG X;  2VPE A;  2M1R A;  3MHH A;  3KV6 A;  2XEU A;  4QQ4 A;  2FD4 A;  4OGE A;  5AIU A;  2YRE A;  1MM3 A;  3FJU B;  1JM7 A;  3LQJ A;  2F6J A;  5H1V A;  3KV5 A;  3O35 A;  5B8D A;  4AP4 A;  3V43 A;  2LGL A;  5TAB A;  2LGK A;  4LAD B;  2DX8 A;  2G6Q A;  5B79 A;  3PUR A;  3HTK C;  3O47 A;  3SOX A;  2JM3 A;  4LKA A;  3LVQ E;  4YAD A;  2YHN A;  2UZG A;  1CHC A;  1WEQ A;  3O33 A;  1WES A;  3I2D A;  1N87 A;  4ZDT A;  2LXH C;  2H0D B;  3L1X A;  2JMI A;  2KKY A;  3N9Q A;  3JUE A;  5SVX A;  1MBM A;  3ZVZ B;  3FAO A;  3DDT A;  5DKA A;  3L11 A;  2L80 A;  3RTR B;  4Q6F A;  4S3O B;  1U6G B;  3M62 A;  1WEU A;  2K4D A;  2DSM A;  3N9P A;  2HYE D;  3ASL A;  2NAA A;  5KH3 A;  3PLW A;  4GNF A;  4WA6 A;  3T9K A;  2C2V S;  2PUY A;  2ECN A;  2RI7 A;  2KKX A;  5H1T A;  5J3X A;  2JRJ A;  2KWO A;  2K1J A;  4O64 A;  4UP0 A;  3N9N A;  3Q1D A;  3U5N A;  1E4U A;  3SUB A;  5K3Q A;  3QZV A;  2H0D A;  2KRE A;  2EXU A;  2EOD A;  2RSD A;  3T6R A; 
#chains in the Genus database with same CATH homology
 3PHD A;  4V3L C;  1X4J A;  4MSX A;  4YBS A;  2CSZ A;  2L43 A;  2YSJ A;  5TDW A;  2I50 A;  4LK9 A;  3L1Z B;  1HYI A;  5D1L B;  2M85 A;  2M6M A;  2VJF B;  1WFK A;  3LQI A;  5H1U A;  3HCT A;  4PPE A;  1IYM A;  3FL2 A;  3DQV R;  3KNV A;  4WZ0 A;  4P5O B;  1G25 A;  1WEW A;  2QIZ A;  2E6S A;  3O70 A;  3T7L A;  4IC2 A;  1VD4 A;  5KH7 A;  2K17 A;  4L58 A;  4A49 A;  2AN6 A;  3GV4 A;  4B86 C;  3VK6 A;  2YUR A;  1WEN A;  1WEO A;  4V3K C;  5LKT A;  5TDR A;  4X3G A;  3GL6 A;  2OXQ C;  5B78 A;  2VJF A;  1WEV A;  4WZ2 A;  4FO9 A;  3ZNI A;  4I7D A;  1DVP A;  5LKU A;  1XWH A;  4ZQL A;  2EA6 A;  2VPD A;  4WZ3 B;  5FB1 A;  1VYX A;  2FUU A;  1JOC A;  3ZPV E;  3M63 A;  4AUQ B;  3C5K A;  3LQH A;  4YBT A;  1LDK C;  1WIL A;  2JMJ A;  2ECT A;  5FB0 A;  2LN0 A;  4UP5 A;  2MIQ A;  1LDJ B;  5TBN A;  2L0B A;  2LGV A;  5KH9 A;  2CSY A;  4N4F A;  1WEP A;  2ECJ A;  2LGG A;  3KQI A;  3ZTG A;  3O37 A;  4FJC A;  4LLB A;  2YYR A;  2YSM A;  2FUI A;  2IDA A;  2YW8 A;  5C13 A;  2MNY A;  5B76 A;  1RMD A;  4A4C A;  3RPG C;  3SOU A;  3U5P A;  2YU4 A;  1V87 A;  2KU3 A;  3U5M A;  3ZPV 1;  2L75 A;  5C11 A;  5H9M A;  4YBM A;  4ZUX U;  2BAY A;  4NN2 A;  1BOR A;  2LRI C;  1FP0 A;  2YHO A;  5LKX A;  4AYC B;  4CA1 A;  2CKL B;  2F42 A;  3N9O A;  3N9M A;  2MT5 A;  2KIZ A;  1HYJ A;  1Z6U A;  4MVT A;  1WEE A;  2LXP C;  1X4I A;  2KWN A;  2D8S A;  2KFT A;  3O36 A;  4AVX A;  5B75 A;  5FER A;  5FEY A;  3EB5 A;  1WEM A;  2MA5 A;  4F52 B;  3C6W A;  2G43 A;  4L7X A;  4QF3 A;  4B7Y C;  4YAX A;  3O34 A;  2MNZ A;  4N3W A;  2LQ6 A;  3U5O A;  1X4U A;  2HDP A;  1T1H A;  2VJE B;  4AYC A;  2ECV A;  3RPG B;  4GNG A;  2YQL A;  4R7E A;  3DPL R;  4W4U A;  3IHP A;  2CKL A;  5G0F A;  2LDR A;  2EGP A;  4UI9 B;  5AIT A;  4R8P K;  3SOW A;  2MD8 C;  2KGG A;  4PTB A;  2PNX A;  2FSA A;  2ZET C;  3O7A A;  2XB1 A;  2QIC A;  5G05 B;  2MUM A;  5LKZ A;  1FBV A;  4YC9 A;  3EB6 A;  2C2L A;  5DIN A;  3SHB A;  2MD7 B;  5JG6 A;  5EYA F;  2VPB A;  4BHW A;  2YQM A;  2VJE A;  2L5U A;  2QJ0 A;  4IC3 A;  4FIP A;  1Z2Q A;  2ECW A;  4YAB A;  4I7C A;  2CT2 A;  3ZYQ A;  4A0C D;  1MM2 A;  4LJN A;  4FK5 A;  4I7B A;  2MA6 A;  1WIM A;  2ECI A;  4GNE A;  1F62 A;  1Z60 A;  5G04 B;  2YUC A;  3NG2 A;  2KE1 A;  5LCW B;  2Y1M A;  1ZBD B;  4YAT A;  1K2F A;  2KYU A;  5B77 A;  2F6N A;  2E6R A;  2VP7 A;  2JMD A;  5TRB A;  3M99 A;  3PUQ A;  2M3H A;  1VFY A;  5D1K B;  4R2Y A;  2ECG A;  5D1M B;  2LV9 A;  3HCU A;  2G45 A;  1WGM A;  4GB0 A;  2Y43 A;  4QF2 A;  2Y1N A;  2VNF A;  1JM7 B;  2KGI A;  5I3L A;  4TKP B;  2KWK A;  3N9L A;  4GND A;  2YT5 A;  1WE9 A;  3ZVY A;  3LRQ A;  4S3O C;  3MHS A;  4XI1 A;  4A4B A;  4BBQ A;  2KR4 A;  3HCS A;  2K16 A;  2KWJ A;  4C9Z A;  2VPG A;  4CCG X;  2VPE A;  2M1R A;  3MHH A;  3KV6 A;  2XEU A;  5AIU A;  2YRE A;  1MM3 A;  1JM7 A;  3LQJ A;  2F6J A;  5H1V A;  3KV5 A;  3O35 A;  5B8D A;  4AP4 A;  3V43 A;  2LGL A;  5TAB A;  2LGK A;  4LAD B;  2DX8 A;  2G6Q A;  5B79 A;  3PUR A;  3HTK C;  3SOX A;  4LKA A;  4YAD A;  2YHN A;  2UZG A;  1CHC A;  1WEQ A;  3O33 A;  1WES A;  3I2D A;  1N87 A;  4ZDT A;  2LXH C;  2H0D B;  3L1X A;  2JMI A;  3N9Q A;  3ZVZ B;  5DKA A;  3L11 A;  2L80 A;  3RTR B;  4Q6F A;  4S3O B;  1U6G B;  3M62 A;  1WEU A;  2K4D A;  3N9P A;  2HYE D;  3ASL A;  2NAA A;  5KH3 A;  4WA6 A;  4GNF A;  2C2V S;  2PUY A;  2ECN A;  2RI7 A;  5H1T A;  5J3X A;  2JRJ A;  2KWO A;  2K1J A;  4O64 A;  4UP0 A;  3N9N A;  3U5N A;  1E4U A;  3QZV A;  2H0D A;  2KRE A;  2EOD A;  2RSD A;  3T6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...