1E4UA

N-terminal ring finger domain of human not-4
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
78
structure length
78
Chain Sequence
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the C4C4 Ring Finger of Human not4 Reveals Features Distinct from Those of C3Hc4 Ring Fingers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords TRANSCRIPTIONAL REPRESSOR NOT4
total genus 4
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14570 zf-RING_4 RING/Ubox like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1e4uA00
2VNFA 2Y43A 3I2DA 5LKUA 4IC2A 2MNZA 3KV6A 5KH3A 3ZNIA 2VPBA 2KWOA 3HCUA 5KH9A 4AYCB 3ASLA 3C5KA 4S3OC 2M85A 4X3GA 3LQHA 1V87A 2QJ0A 2K17A 2HYED 2K1JA 2H0DB 3LQIA 4R2YA 2F42A 4GNFA 2YT5A 2ECVA 4A49A 3IHPA 2MNYA 2YHNA 1X4JA 3L11A 2RSDA 4GB0A 4Q6FA 5H1VA 5LCWB 1HYJA 4LK9A 4A4BA 2AN6A 4BHWA 4YBSA 3U5NA 2MD7B 2LGLA 4N4FA 3O36A 2ECWA 2CKLB 2VJEA 4BBQA 3HCSA 4GNGA 2PNXA 4UP5A 2L80A 4C9ZA 4O64A 4FO9A 1WEWA 1X4IA 1WEOA 2YUCA 2EGPA 5G05B 4PPEA 2MT5A 2L0BA 5AIUA 3SOXA 1WILA 2HDPA 1FBVA 1HYIA 2LDRA 5LKXA 2FSAA 2VJFB 4FJCA 4YAXA 3U5PA 3EB5A 2D8SA 2JMJA 3N9QA 3DQVR 3L1ZB 1XWHA 1U6GB 2KIZA 3LQJA 4GNEA 2MIQA 2FUUA 5I3LA 5B77A 3KQIA 1MM2A 1WEEA 2M3HA 1G25A 1WE9A 2FUIA 1WESA 1VYXA 4LADB 3N9NA 5LKTA 2KR4A 2KYUA 4LLBA 2UZGA 2I50A 1Z60A 2K16A 2YSJA 3ZTGA 2Y1NA 2ZETC 4A4CA 2ECIA 1JOCA 3N9OA 3O35A 1E4UA 3SOUA 1N87A 3LRQA 2YW8A 5B76A 1WEPA 3C6WA 5FEYA 5TRBA 5FB0A 2KWNA 4I7CA 5DKAA 3DPLR 2LRIC 1WENA 3EB6A 4I7BA 3RPGC 3U5MA 1CHCA 2MA6A 1WFKA 4YBMA 4AUQB 3O34A 3V43A 2DX8A 4YADA 2E6SA 4WA6A 1WEMA 3M63A 2YURA 1WEQA 5B78A 2XEUA 3ZPVE 1WIMA 2YQLA 2CKLA 2CSYA 4P5OB 1LDKC 2G43A 2MUMA 4YATA 1K2FA 2LGVA 4QF3A 5D1MB 2E6RA 2KWJA 3MHSA 2EA6A 2G6QA 1RMDA 1BORA 4FIPA 3KNVA 2BAYA 3PURA 5C11A 2RI7A 2VJFA 5D1KB 5FB1A 4CA1A 3ZYQA 4N3WA 4WZ0A 5TABA 3RTRB 3PUQA 2M6MA 3N9MA 3O7AA 2L75A 3N9LA 2LQ6A 5C13A 3U5OA 2H0DA 3T6RA 1JM7A 3QZVA 1LDJB 5H1UA 2KWKA 4YBTA 1ZBDB 3GV4A 4GNDA 5TBNA 1WGMA 2LGKA 2Y1MA 2LXPC 2KU3A 3M62A 2IDAA 4V3KC 4V3LC 3M99A 1Z6UA 2VJEB 2F6NA 2LV9A 3FL2A 1WEVA 2QIZA 1WEUA 1Z2QA 4AP4A 2MA5A 4A0CD 3ZVZB 4WZ3B 4ZDTA 4AVXA 5H9MA 4I7DA 5B79A 1IYMA 2OXQC 2YU4A 4L7XA 4F52B 2LN0A 2VPEA 4QF2A 2QICA 3RPGB 3ZPV1 4ZQLA 2L5UA 2ECGA 2YSMA 5LKZA 3SOWA 2VPDA 4S3OB 4WZ2A 4TKPB 4NN2A 5TDWA 3NG2A 2KE1A 2L43A 5DINA 2VPGA 1X4UA 2VP7A 2PUYA 5D1LB 2ECTA 2KGIA 4PTBA 2KGGA 2CT2A 1T1HA 3VK6A 2JMDA 4AYCA 4CCGX 5JG6A 2YQMA 4R7EA 1VFYA 4UP0A 3N9PA 4XI1A 3T7LA 4W4UA 2ECNA 3ZVYA 4IC3A 2YHOA 3GL6A 2XB1A 4FK5A 5G04B 2JMIA 5G0FA 3HCTA 5TDRA 4UI9B 4B7YC 2ECJA 3L1XA 2G45A 5J3XA 2K4DA 2YREA 4MVTA 3O37A 2LGGA 4LKAA 2MD8C 2NAAA 5AITA 2CSZA 5H1TA 4LJNA 1DVPA 1MM3A 5B75A 4ZUXU 2EODA 4L58A 2F6JA 1VD4A 5KH7A 2C2LA 3PHDA 3SHBA 4YC9A 3O70A 5EYAF 5B8DA 3O33A 4B86C 1JM7B 2JRJA 4YABA 2KREA 2C2VS 2M1RA 2YYRA 2KFTA 5FERA 2LXHC 3KV5A 4MSXA 1FP0A 4R8PK 1F62A 3HTKC 3MHHA
chains in the Genus database with same CATH superfamily
2VNFA 2Y43A 3I2DA 5LKUA 2XOZA 4IC2A 3PLWA 2MNZA 2B0OE 3KV6A 5KH3A 3ZNIA 3O47A 2VPBA 2KWOA 3HCUA 3FM8C 5KH9A 4AYCB 3ASLA 3C5KA 2IQJA 4S3OC 2KKYA 2M85A 4X3GA 2XOYA 3LQHA 1V87A 1MBMA 2QJ0A 2K17A 2HYED 3E2DA 2K1JA 2H0DB 3KDEC 3DDTA 3LQIA 3FJUB 4R2YA 4OGCA 4Z0RA 3FANA 2F42A 4GNFA 2YT5A 2ECVA 4A49A 3IHPA 2MNYA 2YHNA 1X4JA 3L11A 2RSDA 4GB0A 4Q6FA 5H1VA 5LCWB 1HYJA 4LK9A 4A4BA 2AN6A 4BHWA 4YBSA 3U5NA 2MD7B 2LGLA 4N4FA 3JUEA 3O36A 2ECWA 2CKLB 2VJEA 4BBQA 3HCSA 4GNGA 2PNXA 2L7PA 4UP5A 2L80A 4C9ZA 4O64A 4FO9A 1WEWA 1X4IA 1WEOA 2YUCA 2EGPA 5G05B 4OGEA 4PPEA 2MT5A 2L0BA 5AIUA 3SOXA 3M7KA 1WILA 2HDPA 1FBVA 1HYIA 2LDRA 5LKXA 2FSAA 2VJFB 4FJCA 4YAXA 3SUBA 3U5PA 3EB5A 2D8SA 2JMJA 3N9QA 3DQVR 3L1ZB 1XWHA 1U6GB 2KIZA 2CRRA 3LQJA 2FFWA 4GNEA 2MIQA 2FUUA 5I3LA 5B77A 3KQIA 1MM2A 1WEEA 2M3HA 1G25A 1WE9A 2FUIA 1WESA 1VYXA 4LADB 3N9NA 3MDBC 5LKTA 2KR4A 2KYUA 4LLBA 2UZGA 2I50A 1Z60A 2K16A 4QQ4A 2YSJA 3ZTGA 2Y1NA 2ZETC 4A4CA 2ECIA 1JOCA 3N9OA 3O35A 1E4UA 3SOUA 1N87A 3LRQA 2YW8A 5B76A 1WEPA 3C6WA 5FEYA 5FB0A 2KWNA 4I7CA 5TRBA 5DKAA 3DPLR 2E61A 2LRIC 1WENA 3EB6A 4I7BA 3RPGC 3U5MA 1CHCA 2MA6A 1WFKA 4YBMA 4AUQB 3O34A 3V43A 3LJUX 2DX8A 3FEHA 4YADA 2MKEA 2E6SA 4WA6A 1WEMA 3M63A 2YURA 1WEQA 5B78A 2XEUA 3ZPVE 1WIMA 2YQLA 2CKLA 2CSYA 4P5OB 1LDKC 2G43A 2MUMA 4YATA 1K2FA 2LGVA 4QF3A 5D1MB 2E6RA 2KWJA 3MHSA 2EA6A 5SVYA 2G6QA 1RMDA 1BORA 4FIPA 3KNVA 2BAYA 3PURA 5C11A 2RI7A 4O62A 2VJFA 5D1KB 5FB1A 4CA1A 3ZYQA 4N3WA 4WZ0A 5TABA 3RTRB 3PUQA 2M6MA 3N9MA 3O7AA 2L75A 3N9LA 2LQ6A 5C13A 3U5OA 2H0DA 3T6RA 1JM7A 3QZVA 1LDJB 2DSMA 5H1UA 4F1PA 2KWKA 4YBTA 1ZBDB 3GV4A 4GNDA 5TBNA 1WGMA 2LGKA 2Y1MA 2LXPC 2DJAA 2M13A 2KU3A 3M62A 2IDAA 4V3KC 4V3LC 3M99A 1Z6UA 2VJEB 2F6NA 2LV9A 3FL2A 1WEVA 2QIZA 1WEUA 1Z2QA 4AP4A 2MA5A 4A0CD 3ZVZB 4WZ3B 2JM3A 4ZDTA 4AVXA 5H9MA 4I7DA 5B79A 1IYMA 2OXQC 2YU4A 4L7XA 4F52B 2LN0A 2XOCA 2VPEA 4QF2A 2QICA 2EGMA 3RPGB 3ZPV1 3LDYA 4ZQLA 2FD4A 2L5UA 2ECGA 2YSMA 5LKZA 3SOWA 2VPDA 4S3OB 4WZ2A 4TKPB 4NN2A 5TDWA 3NG2A 2KE1A 2L43A 2RR4A 5DINA 2VPGA 1X4UA 2VP7A 2PUYA 5D1LB 2ECTA 2KGIA 4PTBA 2KGGA 2CT2A 1T1HA 3VK6A 2JMDA 2D8UA 5K3QA 4AYCA 4CCGX 5JG6A 2YVRA 2YQMA 2P57A 4R7EA 1VFYA 4UP0A 3N9PA 4XI1A 3T7LA 4W4UA 1DCQA 2ECNA 3ZVYA 4IC3A 2YHOA 3GL6A 2XB1A 4Z0OA 5SVXA 3H7HA 4FK5A 5G04B 2JMIA 5G0FA 3HCTA 3Q1DA 5TDRA 4UI9B 4B7YC 2ECJA 3L1XA 2CSVA 2G45A 5SVIA 5J3XA 2K4DA 3T9KA 3FAOA 2YREA 4MVTA 3O37A 2CRWA 2LGGA 4LKAA 2MD8C 2NAAA 2EXUA 5AITA 2CSZA 5H1TA 2OWAA 3DWDA 4LJNA 2XP0A 1DVPA 1MM3A 5B75A 4ZUXU 2EODA 4L58A 2F6JA 1VD4A 2LAUA 5KH7A 2KKXA 2C2LA 3PHDA 2JUNA 3SHBA 4YC9A 2CONA 3O70A 5EYAF 5B8DA 3O33A 4B86C 3LVQE 1JM7B 2JRJA 4YABA 3LVRE 2KREA 2C2VS 2M1RA 2YYRA 2KFTA 5FERA 5SVIB 2LXHC 3KV5A 4H9DA 4MSXA 1FP0A 4R8PK 1F62A 3HTKC 3MHHA
chains in the Genus database with same CATH topology
2VNFA 2Y43A 3I2DA 5LKUA 4IC2A 2MNZA 3KV6A 5KH3A 3ZNIA 2VPBA 2KWOA 3HCUA 5KH9A 4AYCB 3ASLA 3C5KA 4S3OC 2M85A 4X3GA 3LQHA 1V87A 2QJ0A 2K17A 2HYED 2K1JA 2H0DB 3LQIA 4R2YA 2F42A 4GNFA 2YT5A 2ECVA 4A49A 3IHPA 2MNYA 2YHNA 1X4JA 3L11A 2RSDA 4GB0A 4Q6FA 5H1VA 5LCWB 1HYJA 4LK9A 4A4BA 2AN6A 4BHWA 4YBSA 3U5NA 2MD7B 2LGLA 4N4FA 3O36A 2ECWA 2CKLB 2VJEA 4BBQA 3HCSA 4GNGA 2PNXA 4UP5A 2L80A 4C9ZA 4O64A 4FO9A 1WEWA 1X4IA 1WEOA 2YUCA 2EGPA 5G05B 4PPEA 2MT5A 2L0BA 5AIUA 3SOXA 1WILA 2HDPA 1FBVA 1HYIA 2LDRA 5LKXA 2FSAA 2VJFB 4FJCA 4YAXA 3U5PA 3EB5A 2D8SA 2JMJA 3N9QA 3DQVR 3L1ZB 1XWHA 1U6GB 2KIZA 3LQJA 4GNEA 2MIQA 2FUUA 5I3LA 5B77A 3KQIA 1MM2A 1WEEA 2M3HA 1G25A 1WE9A 2FUIA 1WESA 1VYXA 4LADB 3N9NA 5LKTA 2KR4A 2KYUA 4LLBA 2UZGA 2I50A 1Z60A 2K16A 2YSJA 3ZTGA 2Y1NA 2ZETC 4A4CA 2ECIA 1JOCA 3N9OA 3O35A 1E4UA 3SOUA 1N87A 3LRQA 2YW8A 5B76A 1WEPA 3C6WA 5FEYA 5TRBA 5FB0A 2KWNA 4I7CA 5DKAA 3DPLR 2LRIC 1WENA 3EB6A 4I7BA 3RPGC 3U5MA 1CHCA 2MA6A 1WFKA 4YBMA 4AUQB 3O34A 3V43A 2DX8A 4YADA 2E6SA 4WA6A 1WEMA 3M63A 2YURA 1WEQA 5B78A 2XEUA 3ZPVE 1WIMA 2YQLA 2CKLA 2CSYA 4P5OB 1LDKC 2G43A 2MUMA 4YATA 1K2FA 2LGVA 4QF3A 5D1MB 2E6RA 2KWJA 3MHSA 2EA6A 2G6QA 1RMDA 1BORA 4FIPA 3KNVA 2BAYA 3PURA 5C11A 2RI7A 2VJFA 5D1KB 5FB1A 4CA1A 3ZYQA 4N3WA 4WZ0A 5TABA 3RTRB 3PUQA 2M6MA 3N9MA 3O7AA 2L75A 3N9LA 2LQ6A 5C13A 3U5OA 2H0DA 3T6RA 1JM7A 3QZVA 1LDJB 5H1UA 2KWKA 4YBTA 1ZBDB 3GV4A 4GNDA 5TBNA 1WGMA 2LGKA 2Y1MA 2LXPC 2KU3A 3M62A 2IDAA 4V3KC 4V3LC 3M99A 1Z6UA 2VJEB 2F6NA 2LV9A 3FL2A 1WEVA 2QIZA 1WEUA 1Z2QA 4AP4A 2MA5A 4A0CD 3ZVZB 4WZ3B 4ZDTA 4AVXA 5H9MA 4I7DA 5B79A 1IYMA 2OXQC 2YU4A 4L7XA 4F52B 2LN0A 2VPEA 4QF2A 2QICA 3RPGB 3ZPV1 4ZQLA 2L5UA 2ECGA 2YSMA 5LKZA 3SOWA 2VPDA 4S3OB 4WZ2A 4TKPB 4NN2A 5TDWA 3NG2A 2KE1A 2L43A 5DINA 2VPGA 1X4UA 2VP7A 2PUYA 5D1LB 2ECTA 2KGIA 4PTBA 2KGGA 2CT2A 1T1HA 3VK6A 2JMDA 4AYCA 4CCGX 5JG6A 2YQMA 4R7EA 1VFYA 4UP0A 3N9PA 4XI1A 3T7LA 4W4UA 2ECNA 3ZVYA 4IC3A 2YHOA 3GL6A 2XB1A 4FK5A 5G04B 2JMIA 5G0FA 3HCTA 5TDRA 4UI9B 4B7YC 2ECJA 3L1XA 2G45A 5J3XA 2K4DA 2YREA 4MVTA 3O37A 2LGGA 4LKAA 2MD8C 2NAAA 5AITA 2CSZA 5H1TA 4LJNA 1DVPA 1MM3A 5B75A 4ZUXU 2EODA 4L58A 2F6JA 1VD4A 5KH7A 2C2LA 3PHDA 3SHBA 4YC9A 3O70A 5EYAF 5B8DA 3O33A 4B86C 1JM7B 2JRJA 4YABA 2KREA 2C2VS 2M1RA 2YYRA 2KFTA 5FERA 2LXHC 3KV5A 4MSXA 1FP0A 4R8PK 1F62A 3HTKC 3MHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VNF A;  2Y43 A;  3I2D A;  5LKU A;  4IC2 A;  2MNZ A;  3KV6 A;  5KH3 A;  3ZNI A;  2VPB A;  2KWO A;  3HCU A;  5KH9 A;  4AYC B;  3ASL A;  3C5K A;  4S3O C;  2M85 A;  4X3G A;  3LQH A;  1V87 A;  2QJ0 A;  2K17 A;  2HYE D;  2K1J A;  2H0D B;  3LQI A;  4R2Y A;  2F42 A;  4GNF A;  2YT5 A;  2ECV A;  4A49 A;  3IHP A;  2MNY A;  2YHN A;  1X4J A;  3L11 A;  2RSD A;  4GB0 A;  4Q6F A;  5H1V A;  5LCW B;  1HYJ A;  4LK9 A;  4A4B A;  2AN6 A;  4BHW A;  4YBS A;  3U5N A;  2MD7 B;  2LGL A;  4N4F A;  3O36 A;  2ECW A;  2CKL B;  2VJE A;  4BBQ A;  3HCS A;  4GNG A;  2PNX A;  4UP5 A;  2L80 A;  4C9Z A;  4O64 A;  4FO9 A;  1WEW A;  1X4I A;  1WEO A;  2YUC A;  2EGP A;  5G05 B;  4PPE A;  2MT5 A;  2L0B A;  5AIU A;  3SOX A;  1WIL A;  2HDP A;  1FBV A;  1HYI A;  2LDR A;  5LKX A;  2FSA A;  2VJF B;  4FJC A;  4YAX A;  3U5P A;  3EB5 A;  2D8S A;  2JMJ A;  3N9Q A;  3DQV R;  3L1Z B;  1XWH A;  1U6G B;  2KIZ A;  3LQJ A;  4GNE A;  2MIQ A;  2FUU A;  5I3L A;  5B77 A;  3KQI A;  1MM2 A;  1WEE A;  2M3H A;  1G25 A;  1WE9 A;  2FUI A;  1WES A;  1VYX A;  4LAD B;  3N9N A;  5LKT A;  2KR4 A;  2KYU A;  4LLB A;  2UZG A;  2I50 A;  1Z60 A;  2K16 A;  2YSJ A;  3ZTG A;  2Y1N A;  2ZET C;  4A4C A;  2ECI A;  1JOC A;  3N9O A;  3O35 A;  1E4U A;  3SOU A;  1N87 A;  3LRQ A;  2YW8 A;  5B76 A;  1WEP A;  3C6W A;  5FEY A;  5TRB A;  5FB0 A;  2KWN A;  4I7C A;  5DKA A;  3DPL R;  2LRI C;  1WEN A;  3EB6 A;  4I7B A;  3RPG C;  3U5M A;  1CHC A;  2MA6 A;  1WFK A;  4YBM A;  4AUQ B;  3O34 A;  3V43 A;  2DX8 A;  4YAD A;  2E6S A;  4WA6 A;  1WEM A;  3M63 A;  2YUR A;  1WEQ A;  5B78 A;  2XEU A;  3ZPV E;  1WIM A;  2YQL A;  2CKL A;  2CSY A;  4P5O B;  1LDK C;  2G43 A;  2MUM A;  4YAT A;  1K2F A;  2LGV A;  4QF3 A;  5D1M B;  2E6R A;  2KWJ A;  3MHS A;  2EA6 A;  2G6Q A;  1RMD A;  1BOR A;  4FIP A;  3KNV A;  2BAY A;  3PUR A;  5C11 A;  2RI7 A;  2VJF A;  5D1K B;  5FB1 A;  4CA1 A;  3ZYQ A;  4N3W A;  4WZ0 A;  5TAB A;  3RTR B;  3PUQ A;  2M6M A;  3N9M A;  3O7A A;  2L75 A;  3N9L A;  2LQ6 A;  5C13 A;  3U5O A;  2H0D A;  3T6R A;  1JM7 A;  3QZV A;  1LDJ B;  5H1U A;  2KWK A;  4YBT A;  1ZBD B;  3GV4 A;  4GND A;  5TBN A;  1WGM A;  2LGK A;  2Y1M A;  2LXP C;  2KU3 A;  3M62 A;  2IDA A;  4V3K C;  4V3L C;  3M99 A;  1Z6U A;  2VJE B;  2F6N A;  2LV9 A;  3FL2 A;  1WEV A;  2QIZ A;  1WEU A;  1Z2Q A;  4AP4 A;  2MA5 A;  4A0C D;  3ZVZ B;  4WZ3 B;  4ZDT A;  4AVX A;  5H9M A;  4I7D A;  5B79 A;  1IYM A;  2OXQ C;  2YU4 A;  4L7X A;  4F52 B;  2LN0 A;  2VPE A;  4QF2 A;  2QIC A;  3RPG B;  3ZPV 1;  4ZQL A;  2L5U A;  2ECG A;  2YSM A;  5LKZ A;  3SOW A;  2VPD A;  4S3O B;  4WZ2 A;  4TKP B;  4NN2 A;  5TDW A;  3NG2 A;  2KE1 A;  2L43 A;  5DIN A;  2VPG A;  1X4U A;  2VP7 A;  2PUY A;  5D1L B;  2ECT A;  2KGI A;  4PTB A;  2KGG A;  2CT2 A;  1T1H A;  3VK6 A;  2JMD A;  4AYC A;  4CCG X;  5JG6 A;  2YQM A;  4R7E A;  1VFY A;  4UP0 A;  3N9P A;  4XI1 A;  3T7L A;  4W4U A;  2ECN A;  3ZVY A;  4IC3 A;  2YHO A;  3GL6 A;  2XB1 A;  4FK5 A;  5G04 B;  2JMI A;  5G0F A;  3HCT A;  5TDR A;  4UI9 B;  4B7Y C;  2ECJ A;  3L1X A;  2G45 A;  5J3X A;  2K4D A;  2YRE A;  4MVT A;  3O37 A;  2LGG A;  4LKA A;  2MD8 C;  2NAA A;  5AIT A;  2CSZ A;  5H1T A;  4LJN A;  1DVP A;  1MM3 A;  5B75 A;  4ZUX U;  2EOD A;  4L58 A;  2F6J A;  1VD4 A;  5KH7 A;  2C2L A;  3PHD A;  3SHB A;  4YC9 A;  3O70 A;  5EYA F;  5B8D A;  3O33 A;  4B86 C;  1JM7 B;  2JRJ A;  4YAB A;  2KRE A;  2C2V S;  2M1R A;  2YYR A;  2KFT A;  5FER A;  2LXH C;  3KV5 A;  4MSX A;  1FP0 A;  4R8P K;  1F62 A;  3HTK C;  3MHH A; 
#chains in the Genus database with same CATH topology
 2VNF A;  2Y43 A;  3I2D A;  5LKU A;  2XOZ A;  4IC2 A;  3PLW A;  2MNZ A;  2B0O E;  3KV6 A;  5KH3 A;  3ZNI A;  3O47 A;  2VPB A;  2KWO A;  3HCU A;  3FM8 C;  5KH9 A;  4AYC B;  3ASL A;  3C5K A;  2IQJ A;  4S3O C;  2KKY A;  2M85 A;  4X3G A;  2XOY A;  3LQH A;  1V87 A;  1MBM A;  2QJ0 A;  2K17 A;  2HYE D;  3E2D A;  2K1J A;  2H0D B;  3KDE C;  3DDT A;  3LQI A;  3FJU B;  4R2Y A;  4OGC A;  4Z0R A;  3FAN A;  2F42 A;  4GNF A;  2YT5 A;  2ECV A;  4A49 A;  3IHP A;  2MNY A;  2YHN A;  1X4J A;  3L11 A;  2RSD A;  4GB0 A;  4Q6F A;  5H1V A;  5LCW B;  1HYJ A;  4LK9 A;  4A4B A;  2AN6 A;  4BHW A;  4YBS A;  3U5N A;  2MD7 B;  2LGL A;  4N4F A;  3JUE A;  3O36 A;  2ECW A;  2CKL B;  2VJE A;  4BBQ A;  3HCS A;  4GNG A;  2PNX A;  2L7P A;  4UP5 A;  2L80 A;  4C9Z A;  4O64 A;  4FO9 A;  1WEW A;  1X4I A;  1WEO A;  2YUC A;  2EGP A;  5G05 B;  4OGE A;  4PPE A;  2MT5 A;  2L0B A;  5AIU A;  3SOX A;  3M7K A;  1WIL A;  2HDP A;  1FBV A;  1HYI A;  2LDR A;  5LKX A;  2FSA A;  2VJF B;  4FJC A;  4YAX A;  3SUB A;  3U5P A;  3EB5 A;  2D8S A;  2JMJ A;  3N9Q A;  3DQV R;  3L1Z B;  1XWH A;  1U6G B;  2KIZ A;  2CRR A;  3LQJ A;  2FFW A;  4GNE A;  2MIQ A;  2FUU A;  5I3L A;  5B77 A;  3KQI A;  1MM2 A;  1WEE A;  2M3H A;  1G25 A;  1WE9 A;  2FUI A;  1WES A;  1VYX A;  4LAD B;  3N9N A;  3MDB C;  5LKT A;  2KR4 A;  2KYU A;  4LLB A;  2UZG A;  2I50 A;  1Z60 A;  2K16 A;  4QQ4 A;  2YSJ A;  3ZTG A;  2Y1N A;  2ZET C;  4A4C A;  2ECI A;  1JOC A;  3N9O A;  3O35 A;  1E4U A;  3SOU A;  1N87 A;  3LRQ A;  2YW8 A;  5B76 A;  1WEP A;  3C6W A;  5FEY A;  5FB0 A;  2KWN A;  4I7C A;  5TRB A;  5DKA A;  3DPL R;  2E61 A;  2LRI C;  1WEN A;  3EB6 A;  4I7B A;  3RPG C;  3U5M A;  1CHC A;  2MA6 A;  1WFK A;  4YBM A;  4AUQ B;  3O34 A;  3V43 A;  3LJU X;  2DX8 A;  3FEH A;  4YAD A;  2MKE A;  2E6S A;  4WA6 A;  1WEM A;  3M63 A;  2YUR A;  1WEQ A;  5B78 A;  2XEU A;  3ZPV E;  1WIM A;  2YQL A;  2CKL A;  2CSY A;  4P5O B;  1LDK C;  2G43 A;  2MUM A;  4YAT A;  1K2F A;  2LGV A;  4QF3 A;  5D1M B;  2E6R A;  2KWJ A;  3MHS A;  2EA6 A;  5SVY A;  2G6Q A;  1RMD A;  1BOR A;  4FIP A;  3KNV A;  2BAY A;  3PUR A;  5C11 A;  2RI7 A;  4O62 A;  2VJF A;  5D1K B;  5FB1 A;  4CA1 A;  3ZYQ A;  4N3W A;  4WZ0 A;  5TAB A;  3RTR B;  3PUQ A;  2M6M A;  3N9M A;  3O7A A;  2L75 A;  3N9L A;  2LQ6 A;  5C13 A;  3U5O A;  2H0D A;  3T6R A;  1JM7 A;  3QZV A;  1LDJ B;  2DSM A;  5H1U A;  4F1P A;  2KWK A;  4YBT A;  1ZBD B;  3GV4 A;  4GND A;  5TBN A;  1WGM A;  2LGK A;  2Y1M A;  2LXP C;  2DJA A;  2M13 A;  2KU3 A;  3M62 A;  2IDA A;  4V3K C;  4V3L C;  3M99 A;  1Z6U A;  2VJE B;  2F6N A;  2LV9 A;  3FL2 A;  1WEV A;  2QIZ A;  1WEU A;  1Z2Q A;  4AP4 A;  2MA5 A;  4A0C D;  3ZVZ B;  4WZ3 B;  2JM3 A;  4ZDT A;  4AVX A;  5H9M A;  4I7D A;  5B79 A;  1IYM A;  2OXQ C;  2YU4 A;  4L7X A;  4F52 B;  2LN0 A;  2XOC A;  2VPE A;  4QF2 A;  2QIC A;  2EGM A;  3RPG B;  3ZPV 1;  3LDY A;  4ZQL A;  2FD4 A;  2L5U A;  2ECG A;  2YSM A;  5LKZ A;  3SOW A;  2VPD A;  4S3O B;  4WZ2 A;  4TKP B;  4NN2 A;  5TDW A;  3NG2 A;  2KE1 A;  2L43 A;  2RR4 A;  5DIN A;  2VPG A;  1X4U A;  2VP7 A;  2PUY A;  5D1L B;  2ECT A;  2KGI A;  4PTB A;  2KGG A;  2CT2 A;  1T1H A;  3VK6 A;  2JMD A;  2D8U A;  5K3Q A;  4AYC A;  4CCG X;  5JG6 A;  2YVR A;  2YQM A;  2P57 A;  4R7E A;  1VFY A;  4UP0 A;  3N9P A;  4XI1 A;  3T7L A;  4W4U A;  1DCQ A;  2ECN A;  3ZVY A;  4IC3 A;  2YHO A;  3GL6 A;  2XB1 A;  4Z0O A;  5SVX A;  3H7H A;  4FK5 A;  5G04 B;  2JMI A;  5G0F A;  3HCT A;  3Q1D A;  5TDR A;  4UI9 B;  4B7Y C;  2ECJ A;  3L1X A;  2CSV A;  2G45 A;  5SVI A;  5J3X A;  2K4D A;  3T9K A;  3FAO A;  2YRE A;  4MVT A;  3O37 A;  2CRW A;  2LGG A;  4LKA A;  2MD8 C;  2NAA A;  2EXU A;  5AIT A;  2CSZ A;  5H1T A;  2OWA A;  3DWD A;  4LJN A;  2XP0 A;  1DVP A;  1MM3 A;  5B75 A;  4ZUX U;  2EOD A;  4L58 A;  2F6J A;  1VD4 A;  2LAU A;  5KH7 A;  2KKX A;  2C2L A;  3PHD A;  2JUN A;  3SHB A;  4YC9 A;  2CON A;  3O70 A;  5EYA F;  5B8D A;  3O33 A;  4B86 C;  3LVQ E;  1JM7 B;  2JRJ A;  4YAB A;  3LVR E;  2KRE A;  2C2V S;  2M1R A;  2YYR A;  2KFT A;  5FER A;  5SVI B;  2LXH C;  3KV5 A;  4H9D A;  4MSX A;  1FP0 A;  4R8P K;  1F62 A;  3HTK C;  3MHH A; 
#chains in the Genus database with same CATH homology
 2VNF A;  2Y43 A;  3I2D A;  5LKU A;  4IC2 A;  2MNZ A;  3KV6 A;  5KH3 A;  3ZNI A;  2VPB A;  2KWO A;  3HCU A;  5KH9 A;  4AYC B;  3ASL A;  3C5K A;  4S3O C;  2M85 A;  4X3G A;  3LQH A;  1V87 A;  2QJ0 A;  2K17 A;  2HYE D;  2K1J A;  2H0D B;  3LQI A;  4R2Y A;  2F42 A;  4GNF A;  2YT5 A;  2ECV A;  4A49 A;  3IHP A;  2MNY A;  2YHN A;  1X4J A;  3L11 A;  2RSD A;  4GB0 A;  4Q6F A;  5H1V A;  5LCW B;  1HYJ A;  4LK9 A;  4A4B A;  2AN6 A;  4BHW A;  4YBS A;  3U5N A;  2MD7 B;  2LGL A;  4N4F A;  3O36 A;  2ECW A;  2CKL B;  2VJE A;  4BBQ A;  3HCS A;  4GNG A;  2PNX A;  4UP5 A;  2L80 A;  4C9Z A;  4O64 A;  4FO9 A;  1WEW A;  1X4I A;  1WEO A;  2YUC A;  2EGP A;  5G05 B;  4PPE A;  2MT5 A;  2L0B A;  5AIU A;  3SOX A;  1WIL A;  2HDP A;  1FBV A;  1HYI A;  2LDR A;  5LKX A;  2FSA A;  2VJF B;  4FJC A;  4YAX A;  3U5P A;  3EB5 A;  2D8S A;  2JMJ A;  3N9Q A;  3DQV R;  3L1Z B;  1XWH A;  1U6G B;  2KIZ A;  3LQJ A;  4GNE A;  2MIQ A;  2FUU A;  5I3L A;  5B77 A;  3KQI A;  1MM2 A;  1WEE A;  2M3H A;  1G25 A;  1WE9 A;  2FUI A;  1WES A;  1VYX A;  4LAD B;  3N9N A;  5LKT A;  2KR4 A;  2KYU A;  4LLB A;  2UZG A;  2I50 A;  1Z60 A;  2K16 A;  2YSJ A;  3ZTG A;  2Y1N A;  2ZET C;  4A4C A;  2ECI A;  1JOC A;  3N9O A;  3O35 A;  1E4U A;  3SOU A;  1N87 A;  3LRQ A;  2YW8 A;  5B76 A;  1WEP A;  3C6W A;  5FEY A;  5TRB A;  5FB0 A;  2KWN A;  4I7C A;  5DKA A;  3DPL R;  2LRI C;  1WEN A;  3EB6 A;  4I7B A;  3RPG C;  3U5M A;  1CHC A;  2MA6 A;  1WFK A;  4YBM A;  4AUQ B;  3O34 A;  3V43 A;  2DX8 A;  4YAD A;  2E6S A;  4WA6 A;  1WEM A;  3M63 A;  2YUR A;  1WEQ A;  5B78 A;  2XEU A;  3ZPV E;  1WIM A;  2YQL A;  2CKL A;  2CSY A;  4P5O B;  1LDK C;  2G43 A;  2MUM A;  4YAT A;  1K2F A;  2LGV A;  4QF3 A;  5D1M B;  2E6R A;  2KWJ A;  3MHS A;  2EA6 A;  2G6Q A;  1RMD A;  1BOR A;  4FIP A;  3KNV A;  2BAY A;  3PUR A;  5C11 A;  2RI7 A;  2VJF A;  5D1K B;  5FB1 A;  4CA1 A;  3ZYQ A;  4N3W A;  4WZ0 A;  5TAB A;  3RTR B;  3PUQ A;  2M6M A;  3N9M A;  3O7A A;  2L75 A;  3N9L A;  2LQ6 A;  5C13 A;  3U5O A;  2H0D A;  3T6R A;  1JM7 A;  3QZV A;  1LDJ B;  5H1U A;  2KWK A;  4YBT A;  1ZBD B;  3GV4 A;  4GND A;  5TBN A;  1WGM A;  2LGK A;  2Y1M A;  2LXP C;  2KU3 A;  3M62 A;  2IDA A;  4V3K C;  4V3L C;  3M99 A;  1Z6U A;  2VJE B;  2F6N A;  2LV9 A;  3FL2 A;  1WEV A;  2QIZ A;  1WEU A;  1Z2Q A;  4AP4 A;  2MA5 A;  4A0C D;  3ZVZ B;  4WZ3 B;  4ZDT A;  4AVX A;  5H9M A;  4I7D A;  5B79 A;  1IYM A;  2OXQ C;  2YU4 A;  4L7X A;  4F52 B;  2LN0 A;  2VPE A;  4QF2 A;  2QIC A;  3RPG B;  3ZPV 1;  4ZQL A;  2L5U A;  2ECG A;  2YSM A;  5LKZ A;  3SOW A;  2VPD A;  4S3O B;  4WZ2 A;  4TKP B;  4NN2 A;  5TDW A;  3NG2 A;  2KE1 A;  2L43 A;  5DIN A;  2VPG A;  1X4U A;  2VP7 A;  2PUY A;  5D1L B;  2ECT A;  2KGI A;  4PTB A;  2KGG A;  2CT2 A;  1T1H A;  3VK6 A;  2JMD A;  4AYC A;  4CCG X;  5JG6 A;  2YQM A;  4R7E A;  1VFY A;  4UP0 A;  3N9P A;  4XI1 A;  3T7L A;  4W4U A;  2ECN A;  3ZVY A;  4IC3 A;  2YHO A;  3GL6 A;  2XB1 A;  4FK5 A;  5G04 B;  2JMI A;  5G0F A;  3HCT A;  5TDR A;  4UI9 B;  4B7Y C;  2ECJ A;  3L1X A;  2G45 A;  5J3X A;  2K4D A;  2YRE A;  4MVT A;  3O37 A;  2LGG A;  4LKA A;  2MD8 C;  2NAA A;  5AIT A;  2CSZ A;  5H1T A;  4LJN A;  1DVP A;  1MM3 A;  5B75 A;  4ZUX U;  2EOD A;  4L58 A;  2F6J A;  1VD4 A;  5KH7 A;  2C2L A;  3PHD A;  3SHB A;  4YC9 A;  3O70 A;  5EYA F;  5B8D A;  3O33 A;  4B86 C;  1JM7 B;  2JRJ A;  4YAB A;  2KRE A;  2C2V S;  2M1R A;  2YYR A;  2KFT A;  5FER A;  2LXH C;  3KV5 A;  4MSX A;  1FP0 A;  4R8P K;  1F62 A;  3HTK C;  3MHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...