1VD4A

Solution structure of the zinc finger domain of tfiie alpha
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
62
structure length
62
Chain Sequence
b'RIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor IIE, alpha subunit
publication title A novel zinc finger structure in the large subunit of human general transcription factor TFIIE.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2004-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1vd4A00
5FERA 5EYAF 5TDWA 2JMJA 4B86C 1CHCA 3FL2A 1U6GB 4WZ0A 2VJEA 1WEWA 2YQMA 1N87A 5TABA 1X4UA 5LKUA 3KV6A 2KYUA 5FEYA 5AIUA 2ECIA 2MD8C 2VPBA 5B77A 5G05B 3SOWA 2KU3A 1FBVA 2C2LA 3SOUA 3SOXA 3EB5A 2KWNA 3PURA 4L7XA 4AP4A 2PUYA 2ECTA 2KWKA 2VPGA 1FP0A 4A4BA 5I3LA 4QF3A 2MA6A 4GNFA 2YT5A 2NAAA 3T7LA 4ZQLA 2YSMA 2IDAA 2E6RA 1WE9A 3U5OA 5TBNA 1WFKA 4GNGA 3L1XA 4YABA 2M6MA 3M63A 5B75A 2E6SA 4GNEA 1VFYA 1JOCA 3N9LA 3NG2A 4QF2A 2F6JA 2MNZA 5DKAA 2XB1A 5C11A 3ZPV1 4LK9A 2YHNA 5H1UA 4I7BA 4V3LC 1X4JA 3U5PA 4V3KC 3C6WA 3RTRB 3KV5A 4CCGX 3MHSA 2M3HA 4A4CA 3LRQA 4LJNA 2VPDA 3KNVA 3IHPA 1VYXA 2AN6A 2L5UA 1F62A 5LCWB 1IYMA 2XEUA 2HYED 1WEQA 2KREA 4LLBA 5D1KB 4YBSA 4AYCA 4L58A 3ZYQA 2K1JA 4I7DA 4R2YA 3T6RA 2YW8A 2CT2A 5G04B 2HDPA 2LRIC 4S3OB 4R7EA 3HCTA 2LN0A 2LGVA 1WEMA 5FB1A 2JRJA 3SHBA 3ZNIA 5C13A 1WEPA 1LDKC 3LQIA 1WIMA 2BAYA 1VD4A 2VJFB 2C2VS 1WEUA 3O33A 1T1HA 5D1LB 1WGMA 2G45A 4FK5A 4A0CD 2VNFA 4PTBA 1WEEA 5B76A 2KE1A 2I50A 4UI9B 5D1MB 3N9QA 2ECWA 2LXPC 3C5KA 2KFTA 3N9PA 2CKLB 2FUIA 3PUQA 4Q6FA 3U5MA 5LKZA 5LKTA 1G25A 1Z2QA 4AVXA 5KH7A 3HTKC 1BORA 4YC9A 5AITA 4UP0A 2Y1MA 4FJCA 2EGPA 2LV9A 2KWJA 3KQIA 4ZDTA 4F52B 4NN2A 1JM7B 4YBMA 5KH9A 1K2FA 4LADB 4YATA 1DVPA 4S3OC 2F42A 2ECNA 4X3GA 2L0BA 2L80A 2M85A 4C9ZA 3U5NA 2VP7A 3LQHA 1V87A 2K16A 1LDJB 3HCUA 2FUUA 3ZVYA 2ECJA 2QJ0A 3L11A 4TKPB 2VPEA 4N4FA 3LQJA 2KIZA 4AUQB 2VJFA 2JMDA 5TRBA 2KR4A 2RI7A 5FB0A 4WA6A 4ZUXU 3M62A 4O64A 2CSZA 2KGIA 1Z6UA 2CSYA 2LQ6A 2MT5A 3ZVZB 2H0DB 2PNXA 2CKLA 2LGGA 5B78A 2L43A 2MNYA 3RPGC 3O36A 3EB6A 2FSAA 3DPLR 4CA1A 3GL6A 2ZETC 1Z60A 4WZ2A 2YUCA 3ASLA 4FO9A 2K4DA 4YBTA 2G43A 1JM7A 2YREA 4GB0A 2OXQC 5H1VA 1HYIA 2ECGA 4PPEA 3O34A 4P5OB 3MHHA 4UP5A 3ZTGA 2D8SA 5DINA 4MSXA 2UZGA 5B79A 2K17A 3O70A 1RMDA 4AYCB 3QZVA 3RPGB 2EA6A 4IC3A 2YHOA 4LKAA 3PHDA 2LGLA 4YADA 5J3XA 5JG6A 2Y43A 5LKXA 2VJEB 5H9MA 2YYRA 1ZBDB 5G0FA 4N3WA 2DX8A 1WILA 5H1TA 2JMIA 4I7CA 4R8PK 4BHWA 5KH3A 2M1RA 2YSJA 2RSDA 1E4UA 3M99A 3ZPVE 2LGKA 2LXHC 4A49A 1WENA 3I2DA 4IC2A 1MM3A 2EODA 4WZ3B 2H0DA 1MM2A 3O37A 1HYJA 4XI1A 3GV4A 3DQVR 4YAXA 2MD7B 3N9MA 2YU4A 2G6QA 2MUMA 2LDRA 2F6NA 2Y1NA 3O7AA 2QICA 1X4IA 2KWOA 3V43A 1XWHA 3L1ZB 1WEVA 2YURA 3VK6A 4GNDA 1WEOA 2KGGA 2MA5A 5B8DA 4W4UA 2QIZA 3HCSA 5TDRA 4BBQA 4B7YC 2YQLA 1WESA 2MIQA 4FIPA 3O35A 3N9NA 2L75A 2ECVA 3N9OA 4MVTA
chains in the Genus database with same CATH superfamily
5FERA 5EYAF 5TDWA 2JMJA 4B86C 3LVRE 1CHCA 2B0OE 3O47A 2M13A 3FL2A 1U6GB 4WZ0A 2VJEA 1WEWA 2YQMA 1N87A 5TABA 1X4UA 5K3QA 4Z0RA 5LKUA 3KV6A 2KYUA 5FEYA 5AIUA 2ECIA 2MD8C 2VPBA 5B77A 2D8UA 5G05B 3SOWA 2KU3A 1FBVA 2C2LA 2JM3A 3SOUA 3SOXA 2XOCA 3EB5A 2KWNA 3PURA 4L7XA 4AP4A 2PUYA 2ECTA 2KWKA 2VPGA 1FP0A 4A4BA 5I3LA 4QF3A 2MA6A 4GNFA 2YT5A 2NAAA 3T7LA 4ZQLA 2YSMA 2IDAA 2E6RA 1WE9A 3U5OA 5TBNA 1WFKA 4GNGA 3L1XA 2P57A 4YABA 2M6MA 3M63A 5B75A 2E6SA 4GNEA 1VFYA 1JOCA 3N9LA 3NG2A 4QF2A 2F6JA 2MNZA 5DKAA 2XB1A 5C11A 2E61A 3ZPV1 4LK9A 2YHNA 5H1UA 4I7BA 4V3LC 3FANA 2JUNA 1X4JA 2MKEA 3U5PA 4V3KC 3C6WA 2DJAA 3RTRB 3KV5A 4CCGX 3MHSA 2M3HA 4A4CA 3LRQA 5SVIA 4LJNA 2VPDA 2KKYA 3KNVA 3IHPA 1VYXA 2AN6A 2L5UA 1F62A 5LCWB 1IYMA 1MBMA 2XEUA 2HYED 3FM8C 1WEQA 2KREA 4LLBA 5D1KB 4YBSA 4AYCA 4L58A 3ZYQA 2K1JA 4I7DA 4R2YA 2RR4A 2YW8A 3T6RA 2CT2A 2LAUA 5G04B 2HDPA 2LRIC 4S3OB 4R7EA 3HCTA 3FJUB 2LN0A 2LGVA 1WEMA 3DWDA 5FB1A 2JRJA 3SHBA 3ZNIA 5C13A 2CONA 1WEPA 1LDKC 3LQIA 1WIMA 2BAYA 1VD4A 2VJFB 2C2VS 1WEUA 3O33A 1T1HA 5D1LB 1WGMA 2G45A 4FK5A 4A0CD 2VNFA 4PTBA 2EXUA 1WEEA 3T9KA 5B76A 3SUBA 2KE1A 2I50A 4UI9B 5D1MB 3N9QA 2ECWA 2LXPC 3C5KA 2KFTA 3N9PA 2CKLB 2XOYA 2FUIA 3PUQA 5SVYA 3M7KA 4Q6FA 3Q1DA 3U5MA 5LKZA 5LKTA 3E2DA 1G25A 4Z0OA 1Z2QA 4AVXA 5KH7A 3DDTA 3HTKC 1BORA 4YC9A 2FFWA 5AITA 4UP0A 2Y1MA 4FJCA 2EGPA 2LV9A 2KWJA 3KQIA 4ZDTA 4F52B 4NN2A 1JM7B 4YBMA 5KH9A 1K2FA 4LADB 4YATA 1DVPA 2OWAA 4S3OC 2F42A 2ECNA 4X3GA 2L0BA 2L80A 2M85A 4O62A 4C9ZA 3U5NA 2VP7A 3LQHA 1V87A 2K16A 3LJUX 1LDJB 2IQJA 3HCUA 2FUUA 3ZVYA 2ECJA 2QJ0A 3L11A 3H7HA 4H9DA 4TKPB 2FD4A 2VPEA 4N4FA 4OGEA 3LQJA 2KIZA 4AUQB 2VJFA 2JMDA 5TRBA 2KR4A 2RI7A 5FB0A 4WA6A 4ZUXU 3M62A 4O64A 2CSZA 2KGIA 1Z6UA 2CSYA 2LQ6A 3LVQE 2MT5A 3ZVZB 2H0DB 2PNXA 2CKLA 2CRWA 2LGGA 5B78A 2CSVA 2L43A 2MNYA 2CRRA 3RPGC 3O36A 2L7PA 3EB6A 1DCQA 2KKXA 2FSAA 3DPLR 4CA1A 3GL6A 2ZETC 3KDEC 1Z60A 4WZ2A 2YUCA 3ASLA 4FO9A 2K4DA 5SVIB 4YBTA 2G43A 1JM7A 2YREA 4GB0A 2OXQC 5H1VA 1HYIA 2ECGA 4PPEA 2EGMA 3O34A 3MDBC 4QQ4A 4P5OB 3MHHA 3JUEA 3FAOA 4UP5A 3ZTGA 2D8SA 5DINA 4MSXA 2UZGA 5B79A 2K17A 3O70A 1RMDA 4AYCB 3QZVA 3LDYA 4OGCA 3RPGB 2EA6A 5SVXA 4IC3A 2YHOA 4LKAA 3PHDA 3PLWA 2LGLA 4YADA 5J3XA 5JG6A 2Y43A 5LKXA 2VJEB 5H9MA 2YYRA 1ZBDB 5G0FA 4F1PA 4N3WA 2DX8A 3FEHA 1WILA 5H1TA 2JMIA 4I7CA 4R8PK 4BHWA 5KH3A 2M1RA 2YSJA 2RSDA 1E4UA 3M99A 3ZPVE 2LGKA 2LXHC 4A49A 1WENA 3I2DA 4IC2A 1MM3A 2EODA 4WZ3B 2H0DA 1MM2A 3O37A 1HYJA 4XI1A 3GV4A 3DQVR 4YAXA 2MD7B 3N9MA 2YU4A 2G6QA 2MUMA 2LDRA 2XP0A 2F6NA 2Y1NA 2XOZA 3O7AA 2DSMA 1X4IA 2QICA 2KWOA 3V43A 1XWHA 3L1ZB 1WEVA 2YURA 3VK6A 4GNDA 2YVRA 1WEOA 2KGGA 2MA5A 5B8DA 4W4UA 2QIZA 3HCSA 5TDRA 4BBQA 4B7YC 2YQLA 1WESA 2MIQA 4FIPA 3O35A 3N9NA 2L75A 2ECVA 3N9OA 4MVTA
chains in the Genus database with same CATH topology
5FERA 5EYAF 5TDWA 2JMJA 4B86C 1CHCA 3FL2A 1U6GB 4WZ0A 2VJEA 1WEWA 2YQMA 1N87A 5TABA 1X4UA 5LKUA 3KV6A 2KYUA 5FEYA 5AIUA 2ECIA 2MD8C 2VPBA 5B77A 5G05B 3SOWA 2KU3A 1FBVA 2C2LA 3SOUA 3SOXA 3EB5A 2KWNA 3PURA 4L7XA 4AP4A 2PUYA 2ECTA 2KWKA 2VPGA 1FP0A 4A4BA 5I3LA 4QF3A 2MA6A 4GNFA 2YT5A 2NAAA 3T7LA 4ZQLA 2YSMA 2IDAA 2E6RA 1WE9A 3U5OA 5TBNA 1WFKA 4GNGA 3L1XA 4YABA 2M6MA 3M63A 5B75A 2E6SA 4GNEA 1VFYA 1JOCA 3N9LA 3NG2A 4QF2A 2F6JA 2MNZA 5DKAA 2XB1A 5C11A 3ZPV1 4LK9A 2YHNA 5H1UA 4I7BA 4V3LC 1X4JA 3U5PA 4V3KC 3C6WA 3RTRB 3KV5A 4CCGX 3MHSA 2M3HA 4A4CA 3LRQA 4LJNA 2VPDA 3KNVA 3IHPA 1VYXA 2AN6A 2L5UA 1F62A 5LCWB 1IYMA 2XEUA 2HYED 1WEQA 2KREA 4LLBA 5D1KB 4YBSA 4AYCA 4L58A 3ZYQA 2K1JA 4I7DA 4R2YA 3T6RA 2YW8A 2CT2A 5G04B 2HDPA 2LRIC 4S3OB 4R7EA 3HCTA 2LN0A 2LGVA 1WEMA 5FB1A 2JRJA 3SHBA 3ZNIA 5C13A 1WEPA 1LDKC 3LQIA 1WIMA 2BAYA 1VD4A 2VJFB 2C2VS 1WEUA 3O33A 1T1HA 5D1LB 1WGMA 2G45A 4FK5A 4A0CD 2VNFA 4PTBA 1WEEA 5B76A 2KE1A 2I50A 4UI9B 5D1MB 3N9QA 2ECWA 2LXPC 3C5KA 2KFTA 3N9PA 2CKLB 2FUIA 3PUQA 4Q6FA 3U5MA 5LKZA 5LKTA 1G25A 1Z2QA 4AVXA 5KH7A 3HTKC 1BORA 4YC9A 5AITA 4UP0A 2Y1MA 4FJCA 2EGPA 2LV9A 2KWJA 3KQIA 4ZDTA 4F52B 4NN2A 1JM7B 4YBMA 5KH9A 1K2FA 4LADB 4YATA 1DVPA 4S3OC 2F42A 2ECNA 4X3GA 2L0BA 2L80A 2M85A 4C9ZA 3U5NA 2VP7A 3LQHA 1V87A 2K16A 1LDJB 3HCUA 2FUUA 3ZVYA 2ECJA 2QJ0A 3L11A 4TKPB 2VPEA 4N4FA 3LQJA 2KIZA 4AUQB 2VJFA 2JMDA 5TRBA 2KR4A 2RI7A 5FB0A 4WA6A 4ZUXU 3M62A 4O64A 2CSZA 2KGIA 1Z6UA 2CSYA 2LQ6A 2MT5A 3ZVZB 2H0DB 2PNXA 2CKLA 2LGGA 5B78A 2L43A 2MNYA 3RPGC 3O36A 3EB6A 2FSAA 3DPLR 4CA1A 3GL6A 2ZETC 1Z60A 4WZ2A 2YUCA 3ASLA 4FO9A 2K4DA 4YBTA 2G43A 1JM7A 2YREA 4GB0A 2OXQC 5H1VA 1HYIA 2ECGA 4PPEA 3O34A 4P5OB 3MHHA 4UP5A 3ZTGA 2D8SA 5DINA 4MSXA 2UZGA 5B79A 2K17A 3O70A 1RMDA 4AYCB 3QZVA 3RPGB 2EA6A 4IC3A 2YHOA 4LKAA 3PHDA 2LGLA 4YADA 5J3XA 5JG6A 2Y43A 5LKXA 2VJEB 5H9MA 2YYRA 1ZBDB 5G0FA 4N3WA 2DX8A 1WILA 5H1TA 2JMIA 4I7CA 4R8PK 4BHWA 5KH3A 2M1RA 2YSJA 2RSDA 1E4UA 3M99A 3ZPVE 2LGKA 2LXHC 4A49A 1WENA 3I2DA 4IC2A 1MM3A 2EODA 4WZ3B 2H0DA 1MM2A 3O37A 1HYJA 4XI1A 3GV4A 3DQVR 4YAXA 2MD7B 3N9MA 2YU4A 2G6QA 2MUMA 2LDRA 2F6NA 2Y1NA 3O7AA 2QICA 1X4IA 2KWOA 3V43A 1XWHA 3L1ZB 1WEVA 2YURA 3VK6A 4GNDA 1WEOA 2KGGA 2MA5A 5B8DA 4W4UA 2QIZA 3HCSA 5TDRA 4BBQA 4B7YC 2YQLA 1WESA 2MIQA 4FIPA 3O35A 3N9NA 2L75A 2ECVA 3N9OA 4MVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FER A;  5EYA F;  5TDW A;  2JMJ A;  4B86 C;  1CHC A;  3FL2 A;  1U6G B;  4WZ0 A;  2VJE A;  1WEW A;  2YQM A;  1N87 A;  5TAB A;  1X4U A;  5LKU A;  3KV6 A;  2KYU A;  5FEY A;  5AIU A;  2ECI A;  2MD8 C;  2VPB A;  5B77 A;  5G05 B;  3SOW A;  2KU3 A;  1FBV A;  2C2L A;  3SOU A;  3SOX A;  3EB5 A;  2KWN A;  3PUR A;  4L7X A;  4AP4 A;  2PUY A;  2ECT A;  2KWK A;  2VPG A;  1FP0 A;  4A4B A;  5I3L A;  4QF3 A;  2MA6 A;  4GNF A;  2YT5 A;  2NAA A;  3T7L A;  4ZQL A;  2YSM A;  2IDA A;  2E6R A;  1WE9 A;  3U5O A;  5TBN A;  1WFK A;  4GNG A;  3L1X A;  4YAB A;  2M6M A;  3M63 A;  5B75 A;  2E6S A;  4GNE A;  1VFY A;  1JOC A;  3N9L A;  3NG2 A;  4QF2 A;  2F6J A;  2MNZ A;  5DKA A;  2XB1 A;  5C11 A;  3ZPV 1;  4LK9 A;  2YHN A;  5H1U A;  4I7B A;  4V3L C;  1X4J A;  3U5P A;  4V3K C;  3C6W A;  3RTR B;  3KV5 A;  4CCG X;  3MHS A;  2M3H A;  4A4C A;  3LRQ A;  4LJN A;  2VPD A;  3KNV A;  3IHP A;  1VYX A;  2AN6 A;  2L5U A;  1F62 A;  5LCW B;  1IYM A;  2XEU A;  2HYE D;  1WEQ A;  2KRE A;  4LLB A;  5D1K B;  4YBS A;  4AYC A;  4L58 A;  3ZYQ A;  2K1J A;  4I7D A;  4R2Y A;  3T6R A;  2YW8 A;  2CT2 A;  5G04 B;  2HDP A;  2LRI C;  4S3O B;  4R7E A;  3HCT A;  2LN0 A;  2LGV A;  1WEM A;  5FB1 A;  2JRJ A;  3SHB A;  3ZNI A;  5C13 A;  1WEP A;  1LDK C;  3LQI A;  1WIM A;  2BAY A;  1VD4 A;  2VJF B;  2C2V S;  1WEU A;  3O33 A;  1T1H A;  5D1L B;  1WGM A;  2G45 A;  4FK5 A;  4A0C D;  2VNF A;  4PTB A;  1WEE A;  5B76 A;  2KE1 A;  2I50 A;  4UI9 B;  5D1M B;  3N9Q A;  2ECW A;  2LXP C;  3C5K A;  2KFT A;  3N9P A;  2CKL B;  2FUI A;  3PUQ A;  4Q6F A;  3U5M A;  5LKZ A;  5LKT A;  1G25 A;  1Z2Q A;  4AVX A;  5KH7 A;  3HTK C;  1BOR A;  4YC9 A;  5AIT A;  4UP0 A;  2Y1M A;  4FJC A;  2EGP A;  2LV9 A;  2KWJ A;  3KQI A;  4ZDT A;  4F52 B;  4NN2 A;  1JM7 B;  4YBM A;  5KH9 A;  1K2F A;  4LAD B;  4YAT A;  1DVP A;  4S3O C;  2F42 A;  2ECN A;  4X3G A;  2L0B A;  2L80 A;  2M85 A;  4C9Z A;  3U5N A;  2VP7 A;  3LQH A;  1V87 A;  2K16 A;  1LDJ B;  3HCU A;  2FUU A;  3ZVY A;  2ECJ A;  2QJ0 A;  3L11 A;  4TKP B;  2VPE A;  4N4F A;  3LQJ A;  2KIZ A;  4AUQ B;  2VJF A;  2JMD A;  5TRB A;  2KR4 A;  2RI7 A;  5FB0 A;  4WA6 A;  4ZUX U;  3M62 A;  4O64 A;  2CSZ A;  2KGI A;  1Z6U A;  2CSY A;  2LQ6 A;  2MT5 A;  3ZVZ B;  2H0D B;  2PNX A;  2CKL A;  2LGG A;  5B78 A;  2L43 A;  2MNY A;  3RPG C;  3O36 A;  3EB6 A;  2FSA A;  3DPL R;  4CA1 A;  3GL6 A;  2ZET C;  1Z60 A;  4WZ2 A;  2YUC A;  3ASL A;  4FO9 A;  2K4D A;  4YBT A;  2G43 A;  1JM7 A;  2YRE A;  4GB0 A;  2OXQ C;  5H1V A;  1HYI A;  2ECG A;  4PPE A;  3O34 A;  4P5O B;  3MHH A;  4UP5 A;  3ZTG A;  2D8S A;  5DIN A;  4MSX A;  2UZG A;  5B79 A;  2K17 A;  3O70 A;  1RMD A;  4AYC B;  3QZV A;  3RPG B;  2EA6 A;  4IC3 A;  2YHO A;  4LKA A;  3PHD A;  2LGL A;  4YAD A;  5J3X A;  5JG6 A;  2Y43 A;  5LKX A;  2VJE B;  5H9M A;  2YYR A;  1ZBD B;  5G0F A;  4N3W A;  2DX8 A;  1WIL A;  5H1T A;  2JMI A;  4I7C A;  4R8P K;  4BHW A;  5KH3 A;  2M1R A;  2YSJ A;  2RSD A;  1E4U A;  3M99 A;  3ZPV E;  2LGK A;  2LXH C;  4A49 A;  1WEN A;  3I2D A;  4IC2 A;  1MM3 A;  2EOD A;  4WZ3 B;  2H0D A;  1MM2 A;  3O37 A;  1HYJ A;  4XI1 A;  3GV4 A;  3DQV R;  4YAX A;  2MD7 B;  3N9M A;  2YU4 A;  2G6Q A;  2MUM A;  2LDR A;  2F6N A;  2Y1N A;  3O7A A;  2QIC A;  1X4I A;  2KWO A;  3V43 A;  1XWH A;  3L1Z B;  1WEV A;  2YUR A;  3VK6 A;  4GND A;  1WEO A;  2KGG A;  2MA5 A;  5B8D A;  4W4U A;  2QIZ A;  3HCS A;  5TDR A;  4BBQ A;  4B7Y C;  2YQL A;  1WES A;  2MIQ A;  4FIP A;  3O35 A;  3N9N A;  2L75 A;  2ECV A;  3N9O A;  4MVT A; 
#chains in the Genus database with same CATH topology
 5FER A;  5EYA F;  5TDW A;  2JMJ A;  4B86 C;  3LVR E;  1CHC A;  2B0O E;  3O47 A;  2M13 A;  3FL2 A;  1U6G B;  4WZ0 A;  2VJE A;  1WEW A;  2YQM A;  1N87 A;  5TAB A;  1X4U A;  5K3Q A;  4Z0R A;  5LKU A;  3KV6 A;  2KYU A;  5FEY A;  5AIU A;  2ECI A;  2MD8 C;  2VPB A;  5B77 A;  2D8U A;  5G05 B;  3SOW A;  2KU3 A;  1FBV A;  2C2L A;  2JM3 A;  3SOU A;  3SOX A;  2XOC A;  3EB5 A;  2KWN A;  3PUR A;  4L7X A;  4AP4 A;  2PUY A;  2ECT A;  2KWK A;  2VPG A;  1FP0 A;  4A4B A;  5I3L A;  4QF3 A;  2MA6 A;  4GNF A;  2YT5 A;  2NAA A;  3T7L A;  4ZQL A;  2YSM A;  2IDA A;  2E6R A;  1WE9 A;  3U5O A;  5TBN A;  1WFK A;  4GNG A;  3L1X A;  2P57 A;  4YAB A;  2M6M A;  3M63 A;  5B75 A;  2E6S A;  4GNE A;  1VFY A;  1JOC A;  3N9L A;  3NG2 A;  4QF2 A;  2F6J A;  2MNZ A;  5DKA A;  2XB1 A;  5C11 A;  2E61 A;  3ZPV 1;  4LK9 A;  2YHN A;  5H1U A;  4I7B A;  4V3L C;  3FAN A;  2JUN A;  1X4J A;  2MKE A;  3U5P A;  4V3K C;  3C6W A;  2DJA A;  3RTR B;  3KV5 A;  4CCG X;  3MHS A;  2M3H A;  4A4C A;  3LRQ A;  5SVI A;  4LJN A;  2VPD A;  2KKY A;  3KNV A;  3IHP A;  1VYX A;  2AN6 A;  2L5U A;  1F62 A;  5LCW B;  1IYM A;  1MBM A;  2XEU A;  2HYE D;  3FM8 C;  1WEQ A;  2KRE A;  4LLB A;  5D1K B;  4YBS A;  4AYC A;  4L58 A;  3ZYQ A;  2K1J A;  4I7D A;  4R2Y A;  2RR4 A;  2YW8 A;  3T6R A;  2CT2 A;  2LAU A;  5G04 B;  2HDP A;  2LRI C;  4S3O B;  4R7E A;  3HCT A;  3FJU B;  2LN0 A;  2LGV A;  1WEM A;  3DWD A;  5FB1 A;  2JRJ A;  3SHB A;  3ZNI A;  5C13 A;  2CON A;  1WEP A;  1LDK C;  3LQI A;  1WIM A;  2BAY A;  1VD4 A;  2VJF B;  2C2V S;  1WEU A;  3O33 A;  1T1H A;  5D1L B;  1WGM A;  2G45 A;  4FK5 A;  4A0C D;  2VNF A;  4PTB A;  2EXU A;  1WEE A;  3T9K A;  5B76 A;  3SUB A;  2KE1 A;  2I50 A;  4UI9 B;  5D1M B;  3N9Q A;  2ECW A;  2LXP C;  3C5K A;  2KFT A;  3N9P A;  2CKL B;  2XOY A;  2FUI A;  3PUQ A;  5SVY A;  3M7K A;  4Q6F A;  3Q1D A;  3U5M A;  5LKZ A;  5LKT A;  3E2D A;  1G25 A;  4Z0O A;  1Z2Q A;  4AVX A;  5KH7 A;  3DDT A;  3HTK C;  1BOR A;  4YC9 A;  2FFW A;  5AIT A;  4UP0 A;  2Y1M A;  4FJC A;  2EGP A;  2LV9 A;  2KWJ A;  3KQI A;  4ZDT A;  4F52 B;  4NN2 A;  1JM7 B;  4YBM A;  5KH9 A;  1K2F A;  4LAD B;  4YAT A;  1DVP A;  2OWA A;  4S3O C;  2F42 A;  2ECN A;  4X3G A;  2L0B A;  2L80 A;  2M85 A;  4O62 A;  4C9Z A;  3U5N A;  2VP7 A;  3LQH A;  1V87 A;  2K16 A;  3LJU X;  1LDJ B;  2IQJ A;  3HCU A;  2FUU A;  3ZVY A;  2ECJ A;  2QJ0 A;  3L11 A;  3H7H A;  4H9D A;  4TKP B;  2FD4 A;  2VPE A;  4N4F A;  4OGE A;  3LQJ A;  2KIZ A;  4AUQ B;  2VJF A;  2JMD A;  5TRB A;  2KR4 A;  2RI7 A;  5FB0 A;  4WA6 A;  4ZUX U;  3M62 A;  4O64 A;  2CSZ A;  2KGI A;  1Z6U A;  2CSY A;  2LQ6 A;  3LVQ E;  2MT5 A;  3ZVZ B;  2H0D B;  2PNX A;  2CKL A;  2CRW A;  2LGG A;  5B78 A;  2CSV A;  2L43 A;  2MNY A;  2CRR A;  3RPG C;  3O36 A;  2L7P A;  3EB6 A;  1DCQ A;  2KKX A;  2FSA A;  3DPL R;  4CA1 A;  3GL6 A;  2ZET C;  3KDE C;  1Z60 A;  4WZ2 A;  2YUC A;  3ASL A;  4FO9 A;  2K4D A;  5SVI B;  4YBT A;  2G43 A;  1JM7 A;  2YRE A;  4GB0 A;  2OXQ C;  5H1V A;  1HYI A;  2ECG A;  4PPE A;  2EGM A;  3O34 A;  3MDB C;  4QQ4 A;  4P5O B;  3MHH A;  3JUE A;  3FAO A;  4UP5 A;  3ZTG A;  2D8S A;  5DIN A;  4MSX A;  2UZG A;  5B79 A;  2K17 A;  3O70 A;  1RMD A;  4AYC B;  3QZV A;  3LDY A;  4OGC A;  3RPG B;  2EA6 A;  5SVX A;  4IC3 A;  2YHO A;  4LKA A;  3PHD A;  3PLW A;  2LGL A;  4YAD A;  5J3X A;  5JG6 A;  2Y43 A;  5LKX A;  2VJE B;  5H9M A;  2YYR A;  1ZBD B;  5G0F A;  4F1P A;  4N3W A;  2DX8 A;  3FEH A;  1WIL A;  5H1T A;  2JMI A;  4I7C A;  4R8P K;  4BHW A;  5KH3 A;  2M1R A;  2YSJ A;  2RSD A;  1E4U A;  3M99 A;  3ZPV E;  2LGK A;  2LXH C;  4A49 A;  1WEN A;  3I2D A;  4IC2 A;  1MM3 A;  2EOD A;  4WZ3 B;  2H0D A;  1MM2 A;  3O37 A;  1HYJ A;  4XI1 A;  3GV4 A;  3DQV R;  4YAX A;  2MD7 B;  3N9M A;  2YU4 A;  2G6Q A;  2MUM A;  2LDR A;  2XP0 A;  2F6N A;  2Y1N A;  2XOZ A;  3O7A A;  2DSM A;  1X4I A;  2QIC A;  2KWO A;  3V43 A;  1XWH A;  3L1Z B;  1WEV A;  2YUR A;  3VK6 A;  4GND A;  2YVR A;  1WEO A;  2KGG A;  2MA5 A;  5B8D A;  4W4U A;  2QIZ A;  3HCS A;  5TDR A;  4BBQ A;  4B7Y C;  2YQL A;  1WES A;  2MIQ A;  4FIP A;  3O35 A;  3N9N A;  2L75 A;  2ECV A;  3N9O A;  4MVT A; 
#chains in the Genus database with same CATH homology
 5FER A;  5EYA F;  5TDW A;  2JMJ A;  4B86 C;  1CHC A;  3FL2 A;  1U6G B;  4WZ0 A;  2VJE A;  1WEW A;  2YQM A;  1N87 A;  5TAB A;  1X4U A;  5LKU A;  3KV6 A;  2KYU A;  5FEY A;  5AIU A;  2ECI A;  2MD8 C;  2VPB A;  5B77 A;  5G05 B;  3SOW A;  2KU3 A;  1FBV A;  2C2L A;  3SOU A;  3SOX A;  3EB5 A;  2KWN A;  3PUR A;  4L7X A;  4AP4 A;  2PUY A;  2ECT A;  2KWK A;  2VPG A;  1FP0 A;  4A4B A;  5I3L A;  4QF3 A;  2MA6 A;  4GNF A;  2YT5 A;  2NAA A;  3T7L A;  4ZQL A;  2YSM A;  2IDA A;  2E6R A;  1WE9 A;  3U5O A;  5TBN A;  1WFK A;  4GNG A;  3L1X A;  4YAB A;  2M6M A;  3M63 A;  5B75 A;  2E6S A;  4GNE A;  1VFY A;  1JOC A;  3N9L A;  3NG2 A;  4QF2 A;  2F6J A;  2MNZ A;  5DKA A;  2XB1 A;  5C11 A;  3ZPV 1;  4LK9 A;  2YHN A;  5H1U A;  4I7B A;  4V3L C;  1X4J A;  3U5P A;  4V3K C;  3C6W A;  3RTR B;  3KV5 A;  4CCG X;  3MHS A;  2M3H A;  4A4C A;  3LRQ A;  4LJN A;  2VPD A;  3KNV A;  3IHP A;  1VYX A;  2AN6 A;  2L5U A;  1F62 A;  5LCW B;  1IYM A;  2XEU A;  2HYE D;  1WEQ A;  2KRE A;  4LLB A;  5D1K B;  4YBS A;  4AYC A;  4L58 A;  3ZYQ A;  2K1J A;  4I7D A;  4R2Y A;  3T6R A;  2YW8 A;  2CT2 A;  5G04 B;  2HDP A;  2LRI C;  4S3O B;  4R7E A;  3HCT A;  2LN0 A;  2LGV A;  1WEM A;  5FB1 A;  2JRJ A;  3SHB A;  3ZNI A;  5C13 A;  1WEP A;  1LDK C;  3LQI A;  1WIM A;  2BAY A;  1VD4 A;  2VJF B;  2C2V S;  1WEU A;  3O33 A;  1T1H A;  5D1L B;  1WGM A;  2G45 A;  4FK5 A;  4A0C D;  2VNF A;  4PTB A;  1WEE A;  5B76 A;  2KE1 A;  2I50 A;  4UI9 B;  5D1M B;  3N9Q A;  2ECW A;  2LXP C;  3C5K A;  2KFT A;  3N9P A;  2CKL B;  2FUI A;  3PUQ A;  4Q6F A;  3U5M A;  5LKZ A;  5LKT A;  1G25 A;  1Z2Q A;  4AVX A;  5KH7 A;  3HTK C;  1BOR A;  4YC9 A;  5AIT A;  4UP0 A;  2Y1M A;  4FJC A;  2EGP A;  2LV9 A;  2KWJ A;  3KQI A;  4ZDT A;  4F52 B;  4NN2 A;  1JM7 B;  4YBM A;  5KH9 A;  1K2F A;  4LAD B;  4YAT A;  1DVP A;  4S3O C;  2F42 A;  2ECN A;  4X3G A;  2L0B A;  2L80 A;  2M85 A;  4C9Z A;  3U5N A;  2VP7 A;  3LQH A;  1V87 A;  2K16 A;  1LDJ B;  3HCU A;  2FUU A;  3ZVY A;  2ECJ A;  2QJ0 A;  3L11 A;  4TKP B;  2VPE A;  4N4F A;  3LQJ A;  2KIZ A;  4AUQ B;  2VJF A;  2JMD A;  5TRB A;  2KR4 A;  2RI7 A;  5FB0 A;  4WA6 A;  4ZUX U;  3M62 A;  4O64 A;  2CSZ A;  2KGI A;  1Z6U A;  2CSY A;  2LQ6 A;  2MT5 A;  3ZVZ B;  2H0D B;  2PNX A;  2CKL A;  2LGG A;  5B78 A;  2L43 A;  2MNY A;  3RPG C;  3O36 A;  3EB6 A;  2FSA A;  3DPL R;  4CA1 A;  3GL6 A;  2ZET C;  1Z60 A;  4WZ2 A;  2YUC A;  3ASL A;  4FO9 A;  2K4D A;  4YBT A;  2G43 A;  1JM7 A;  2YRE A;  4GB0 A;  2OXQ C;  5H1V A;  1HYI A;  2ECG A;  4PPE A;  3O34 A;  4P5O B;  3MHH A;  4UP5 A;  3ZTG A;  2D8S A;  5DIN A;  4MSX A;  2UZG A;  5B79 A;  2K17 A;  3O70 A;  1RMD A;  4AYC B;  3QZV A;  3RPG B;  2EA6 A;  4IC3 A;  2YHO A;  4LKA A;  3PHD A;  2LGL A;  4YAD A;  5J3X A;  5JG6 A;  2Y43 A;  5LKX A;  2VJE B;  5H9M A;  2YYR A;  1ZBD B;  5G0F A;  4N3W A;  2DX8 A;  1WIL A;  5H1T A;  2JMI A;  4I7C A;  4R8P K;  4BHW A;  5KH3 A;  2M1R A;  2YSJ A;  2RSD A;  1E4U A;  3M99 A;  3ZPV E;  2LGK A;  2LXH C;  4A49 A;  1WEN A;  3I2D A;  4IC2 A;  1MM3 A;  2EOD A;  4WZ3 B;  2H0D A;  1MM2 A;  3O37 A;  1HYJ A;  4XI1 A;  3GV4 A;  3DQV R;  4YAX A;  2MD7 B;  3N9M A;  2YU4 A;  2G6Q A;  2MUM A;  2LDR A;  2F6N A;  2Y1N A;  3O7A A;  2QIC A;  1X4I A;  2KWO A;  3V43 A;  1XWH A;  3L1Z B;  1WEV A;  2YUR A;  3VK6 A;  4GND A;  1WEO A;  2KGG A;  2MA5 A;  5B8D A;  4W4U A;  2QIZ A;  3HCS A;  5TDR A;  4BBQ A;  4B7Y C;  2YQL A;  1WES A;  2MIQ A;  4FIP A;  3O35 A;  3N9N A;  2L75 A;  2ECV A;  3N9O A;  4MVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...