1VD4A

Solution structure of the zinc finger domain of tfiie alpha
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
62
structure length
62
Chain Sequence
RIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor IIE, alpha subunit
publication title A novel zinc finger structure in the large subunit of human general transcription factor TFIIE.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2004-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1vd4A00
2MIQA 1WEUA 4LKAA 2YSJA 5LKUA 5D1KB 4S3OB 4A0CD 1G25A 2YUCA 4YBSA 3ZYQA 2Y1MA 4B7YC 2HDPA 2VJFA 5FERA 2LQ6A 4GNFA 2KWKA 2XB1A 2YSMA 2YT5A 3IHPA 3EB5A 3HCSA 4AYCA 2VJFB 5LKZA 1BORA 3DPLR 2MA5A 2EA6A 2ECNA 5B76A 4AYCB 2K17A 2ECGA 1VFYA 4W4UA 2F6NA 4PTBA 2C2LA 3ZVYA 2H0DA 5H1VA 5C11A 2KGIA 4AVXA 1HYJA 3O36A 1N87A 3HCUA 2YHOA 4L58A 4MSXA 1WEPA 3ZVZB 2H0DB 1WEMA 1WIMA 3RPGC 2LDRA 5AITA 2LGVA 4IC3A 2CSZA 4R7EA 1XWHA 1Z6UA 2LGLA 2PUYA 2AN6A 4I7BA 5FEYA 5TABA 3SOUA 2PNXA 2XEUA 2LRIC 4GNDA 4MVTA 5B77A 1WGMA 4ZQLA 2VP7A 2L75A 1WEVA 5FB1A 1WESA 2D8SA 5LCWB 1MM3A 2K4DA 2MA6A 1VD4A 2EODA 2L43A 4UP0A 3ZPVE 4NN2A 2JMJA 2VPDA 3LQJA 3V43A 3M99A 4LK9A 3T7LA 2KREA 3PUQA 3U5OA 1T1HA 1JM7B 2MD8C 3N9NA 3ZTGA 5D1LB 4R2YA 1CHCA 1LDJB 2C2VS 3KQIA 1F62A 1FP0A 4GNGA 2CSYA 2JMIA 3KV6A 5TBNA 1E4UA 2L80A 5EYAF 4R8PK 3RTRB 3RPGB 4IC2A 4ZDTA 4QF3A 3DQVR 5H1TA 3N9MA 2YU4A 3O37A 4XI1A 4V3LC 4N4FA 5KH7A 3ZNIA 2DX8A 2MNZA 2JMDA 4LLBA 2YQMA 2Y43A 2QICA 4I7CA 5B75A 5DKAA 5I3LA 2KWOA 4UP5A 4FIPA 1V87A 4AP4A 2E6RA 2L0BA 4ZUXU 2ECVA 2VNFA 2JRJA 1WENA 2KR4A 2KE1A 1X4IA 5H1UA 3O33A 3SOXA 2K16A 2IDAA 2VPEA 2LN0A 1U6GB 2KYUA 2LGGA 2MD7B 3QZVA 2UZGA 2KFTA 2YREA 5H9MA 4WZ2A 4YABA 1HYIA 4FJCA 4I7DA 4C9ZA 1WFKA 5DINA 2KGGA 2FSAA 4YC9A 5G05B 1WILA 2L5UA 5KH9A 1MM2A 4O64A 2QJ0A 2ECIA 3O7AA 1LDKC 3N9OA 5B8DA 3LQIA 3HTKC 1JM7A 3O35A 1K2FA 3FL2A 3U5PA 2Y1NA 3SHBA 2G6QA 4LJNA 5TRBA 4QF2A 2KU3A 4YATA 4F52B 5KH3A 1WEWA 2MT5A 2NAAA 2LXHC 2M6MA 5AIUA 3O70A 4Q6FA 4B86C 3VK6A 4FO9A 3GV4A 4YAXA 3M63A 2EGPA 4UI9B 5B79A 4TKPB 2ECTA 3NG2A 5J3XA 5TDWA 3LQHA 4CA1A 1RMDA 2YW8A 1DVPA 4YBMA 2VJEA 3C6WA 5LKXA 5TDRA 2YURA 2FUUA 4AUQB 1VYXA 1WEEA 4GNEA 1WEQA 4L7XA 2MUMA 1IYMA 2M1RA 2VJEB 4A4CA 2E6SA 2KWJA 3U5NA 2FUIA 2ECWA 2KWNA 4WZ3B 5D1MB 3U5MA 4FK5A 4GB0A 2G45A 3N9QA 3MHHA 5FB0A 3PURA 3C5KA 3MHSA 2YQLA 3KNVA 3ASLA 2MNYA 2YYRA 5B78A 3L1ZB 5C13A 4PPEA 1JOCA 2F6JA 1ZBDB 3N9PA 2KIZA 4BBQA 2M3HA 2LV9A 3EB6A 2VPBA 4A4BA 2QIZA 4S3OC 4A49A 2OXQC 3LRQA 3HCTA 3I2DA 3L11A 5G0FA 4YBTA 2ZETC 4N3WA 5LKTA 1X4UA 3L1XA 4WA6A 2CKLA 4X3GA 1WEOA 1X4JA 2VPGA 2HYED 2LGKA 4LADB 2CT2A 5JG6A 3KV5A 2F42A 3PHDA 1Z2QA 2CKLB 4BHWA 2RSDA 2BAYA 4YADA 2ECJA 1WE9A 2YHNA 3M62A 4P5OB 1Z60A 3N9LA 3T6RA 4CCGX 5G04B 3ZPV1 4WZ0A 2RI7A 1FBVA 3GL6A 3O34A 2K1JA 2LXPC 3SOWA 2I50A 2M85A 2G43A 4V3KC
chains in the Genus database with same CATH superfamily
2MIQA 1WEUA 4LKAA 2YSJA 2MKEA 5LKUA 5D1KB 4S3OB 4A0CD 1G25A 2YUCA 4YBSA 3ZYQA 3SUBA 2Y1MA 3LDYA 4B7YC 2HDPA 2VJFA 5FERA 5SVIA 2LQ6A 4GNFA 2KWKA 2XB1A 2YSMA 2YT5A 3IHPA 3EB5A 3HCSA 4AYCA 2VJFB 5LKZA 2EGMA 1BORA 5SVIB 3DPLR 3PLWA 2MA5A 2EA6A 2ECNA 5B76A 4AYCB 2K17A 2ECGA 1VFYA 4W4UA 2F6NA 4PTBA 2C2LA 2LAUA 3ZVYA 2D8UA 2H0DA 5H1VA 5C11A 2KGIA 4AVXA 2FFWA 1HYJA 4H9DA 3O36A 1N87A 3HCUA 2YHOA 4L58A 4Z0OA 1DCQA 4MSXA 2XOZA 1WEPA 3ZVZB 2H0DB 1WEMA 1WIMA 3RPGC 2LDRA 3KDEC 2L7PA 5AITA 2LGVA 4IC3A 3DWDA 4R7EA 2CSZA 1XWHA 1Z6UA 2LGLA 2PUYA 2CRRA 2AN6A 4I7BA 5FEYA 5TABA 3SOUA 2PNXA 2XEUA 2LRIC 4GNDA 4MVTA 3H7HA 5B77A 1WGMA 4ZQLA 2VP7A 2L75A 1WEVA 5FB1A 1WESA 2D8SA 5LCWB 1MM3A 2K4DA 2MA6A 1VD4A 2EODA 2L43A 2P57A 4UP0A 3ZPVE 4NN2A 2JMJA 2VPDA 3LQJA 3V43A 3M99A 4LK9A 3T7LA 2KREA 3PUQA 3U5OA 2YVRA 1T1HA 1JM7B 3LJUX 2MD8C 3N9NA 3ZTGA 5D1LB 4R2YA 1CHCA 3FJUB 1LDJB 2C2VS 2CRWA 3KQIA 1F62A 1FP0A 4GNGA 2CSYA 2JMIA 3KV6A 5TBNA 1E4UA 3O47A 4F1PA 2L80A 5EYAF 4R8PK 3RTRB 3RPGB 4IC2A 4ZDTA 4QF3A 3DQVR 5H1TA 3N9MA 2DJAA 2YU4A 3O37A 4XI1A 3M7KA 4V3LC 3Q1DA 4N4FA 5KH7A 3ZNIA 2DX8A 2MNZA 2JMDA 4LLBA 2YQMA 2Y43A 2QICA 4I7CA 5B75A 5DKAA 5I3LA 2KWOA 4UP5A 4FIPA 1V87A 4AP4A 5SVXA 2E6RA 1MBMA 2L0BA 4ZUXU 2ECVA 5K3QA 2VNFA 2JRJA 1WENA 2KR4A 2KE1A 1X4IA 5H1UA 3O33A 3SOXA 3LVRE 2K16A 2IDAA 2VPEA 4OGEA 2LN0A 1U6GB 2B0OE 2KYUA 3E2DA 2E61A 2LGGA 2MD7B 3QZVA 2UZGA 2KFTA 2YREA 5H9MA 4WZ2A 4YABA 1HYIA 4FJCA 4I7DA 4C9ZA 1WFKA 5DINA 2KGGA 2FSAA 4YC9A 5G05B 1WILA 2L5UA 5KH9A 1MM2A 2IQJA 2XOYA 4O64A 2QJ0A 2ECIA 5SVYA 3O7AA 1LDKC 3T9KA 3N9OA 5B8DA 3LQIA 3HTKC 1JM7A 3O35A 1K2FA 3FL2A 3U5PA 2Y1NA 3SHBA 2G6QA 4LJNA 5TRBA 4QF2A 2KU3A 2DSMA 4YATA 4F52B 5KH3A 1WEWA 2MT5A 2NAAA 2LXHC 2M6MA 5AIUA 3O70A 4Q6FA 4B86C 3VK6A 4FO9A 3GV4A 4YAXA 3M63A 2EGPA 4UI9B 5B79A 4TKPB 2ECTA 3NG2A 2CONA 4O62A 5J3XA 2XP0A 5TDWA 3LQHA 4CA1A 1RMDA 2YW8A 1DVPA 2EXUA 4YBMA 2KKYA 2VJEA 3C6WA 5LKXA 5TDRA 3JUEA 2YURA 2FUUA 4AUQB 2FD4A 1VYXA 1WEEA 2M13A 4GNEA 1WEQA 4L7XA 2MUMA 1IYMA 2M1RA 2VJEB 4A4CA 2E6SA 2KWJA 4OGCA 3U5NA 2FUIA 2ECWA 2KWNA 4WZ3B 5D1MB 3U5MA 4FK5A 4GB0A 2G45A 3N9QA 3MHHA 5FB0A 3LVQE 3PURA 3C5KA 3MHSA 2YQLA 3KNVA 3ASLA 2MNYA 3MDBC 2YYRA 5B78A 3L1ZB 5C13A 4PPEA 1JOCA 2F6JA 1ZBDB 3FANA 3N9PA 2KIZA 4BBQA 2M3HA 2LV9A 3EB6A 2VPBA 4A4BA 2QIZA 4S3OC 4A49A 2OXQC 3LRQA 3HCTA 3I2DA 3L11A 5G0FA 2RR4A 4YBTA 3DDTA 2OWAA 2ZETC 4N3WA 5LKTA 1X4UA 4Z0RA 3L1XA 4WA6A 2CKLA 4X3GA 1WEOA 1X4JA 3FEHA 2VPGA 2HYED 2LGKA 4LADB 2CT2A 5JG6A 3KV5A 2F42A 3PHDA 3FM8C 1Z2QA 2CKLB 4BHWA 2RSDA 2BAYA 4YADA 3FAOA 2KKXA 2XOCA 2JM3A 2ECJA 1WE9A 2YHNA 3M62A 4P5OB 1Z60A 3N9LA 2JUNA 3T6RA 4CCGX 5G04B 3ZPV1 4WZ0A 4QQ4A 2RI7A 1FBVA 3GL6A 3O34A 2K1JA 2LXPC 2CSVA 3SOWA 2I50A 2M85A 2G43A 4V3KC
chains in the Genus database with same CATH topology
2MIQA 1WEUA 4LKAA 2YSJA 5LKUA 5D1KB 4S3OB 4A0CD 1G25A 2YUCA 4YBSA 3ZYQA 2Y1MA 4B7YC 2HDPA 2VJFA 5FERA 2LQ6A 4GNFA 2KWKA 2XB1A 2YSMA 2YT5A 3IHPA 3EB5A 3HCSA 4AYCA 2VJFB 5LKZA 1BORA 3DPLR 2MA5A 2EA6A 2ECNA 5B76A 4AYCB 2K17A 2ECGA 1VFYA 4W4UA 2F6NA 4PTBA 2C2LA 3ZVYA 2H0DA 5H1VA 5C11A 2KGIA 4AVXA 1HYJA 3O36A 1N87A 3HCUA 2YHOA 4L58A 4MSXA 1WEPA 3ZVZB 2H0DB 1WEMA 1WIMA 3RPGC 2LDRA 5AITA 2LGVA 4IC3A 2CSZA 4R7EA 1XWHA 1Z6UA 2LGLA 2PUYA 2AN6A 4I7BA 5FEYA 5TABA 3SOUA 2PNXA 2XEUA 2LRIC 4GNDA 4MVTA 5B77A 1WGMA 4ZQLA 2VP7A 2L75A 1WEVA 5FB1A 1WESA 2D8SA 5LCWB 1MM3A 2K4DA 2MA6A 1VD4A 2EODA 2L43A 4UP0A 3ZPVE 4NN2A 2JMJA 2VPDA 3LQJA 3V43A 3M99A 4LK9A 3T7LA 2KREA 3PUQA 3U5OA 1T1HA 1JM7B 2MD8C 3N9NA 3ZTGA 5D1LB 4R2YA 1CHCA 1LDJB 2C2VS 3KQIA 1F62A 1FP0A 4GNGA 2CSYA 2JMIA 3KV6A 5TBNA 1E4UA 2L80A 5EYAF 4R8PK 3RTRB 3RPGB 4IC2A 4ZDTA 4QF3A 3DQVR 5H1TA 3N9MA 2YU4A 3O37A 4XI1A 4V3LC 4N4FA 5KH7A 3ZNIA 2DX8A 2MNZA 2JMDA 4LLBA 2YQMA 2Y43A 2QICA 4I7CA 5B75A 5DKAA 5I3LA 2KWOA 4UP5A 4FIPA 1V87A 4AP4A 2E6RA 2L0BA 4ZUXU 2ECVA 2VNFA 2JRJA 1WENA 2KR4A 2KE1A 1X4IA 5H1UA 3O33A 3SOXA 2K16A 2IDAA 2VPEA 2LN0A 1U6GB 2KYUA 2LGGA 2MD7B 3QZVA 2UZGA 2KFTA 2YREA 5H9MA 4WZ2A 4YABA 1HYIA 4FJCA 4I7DA 4C9ZA 1WFKA 5DINA 2KGGA 2FSAA 4YC9A 5G05B 1WILA 2L5UA 5KH9A 1MM2A 4O64A 2QJ0A 2ECIA 3O7AA 1LDKC 3N9OA 5B8DA 3LQIA 3HTKC 1JM7A 3O35A 1K2FA 3FL2A 3U5PA 2Y1NA 3SHBA 2G6QA 4LJNA 5TRBA 4QF2A 2KU3A 4YATA 4F52B 5KH3A 1WEWA 2MT5A 2NAAA 2LXHC 2M6MA 5AIUA 3O70A 4Q6FA 4B86C 3VK6A 4FO9A 3GV4A 4YAXA 3M63A 2EGPA 4UI9B 5B79A 4TKPB 2ECTA 3NG2A 5J3XA 5TDWA 3LQHA 4CA1A 1RMDA 2YW8A 1DVPA 4YBMA 2VJEA 3C6WA 5LKXA 5TDRA 2YURA 2FUUA 4AUQB 1VYXA 1WEEA 4GNEA 1WEQA 4L7XA 2MUMA 1IYMA 2M1RA 2VJEB 4A4CA 2E6SA 2KWJA 3U5NA 2FUIA 2ECWA 2KWNA 4WZ3B 5D1MB 3U5MA 4FK5A 4GB0A 2G45A 3N9QA 3MHHA 5FB0A 3PURA 3C5KA 3MHSA 2YQLA 3KNVA 3ASLA 2MNYA 2YYRA 5B78A 3L1ZB 5C13A 4PPEA 1JOCA 2F6JA 1ZBDB 3N9PA 2KIZA 4BBQA 2M3HA 2LV9A 3EB6A 2VPBA 4A4BA 2QIZA 4S3OC 4A49A 2OXQC 3LRQA 3HCTA 3I2DA 3L11A 5G0FA 4YBTA 2ZETC 4N3WA 5LKTA 1X4UA 3L1XA 4WA6A 2CKLA 4X3GA 1WEOA 1X4JA 2VPGA 2HYED 2LGKA 4LADB 2CT2A 5JG6A 3KV5A 2F42A 3PHDA 1Z2QA 2CKLB 4BHWA 2RSDA 2BAYA 4YADA 2ECJA 1WE9A 2YHNA 3M62A 4P5OB 1Z60A 3N9LA 3T6RA 4CCGX 5G04B 3ZPV1 4WZ0A 2RI7A 1FBVA 3GL6A 3O34A 2K1JA 2LXPC 3SOWA 2I50A 2M85A 2G43A 4V3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MIQ A;  1WEU A;  4LKA A;  2YSJ A;  5LKU A;  5D1K B;  4S3O B;  4A0C D;  1G25 A;  2YUC A;  4YBS A;  3ZYQ A;  2Y1M A;  4B7Y C;  2HDP A;  2VJF A;  5FER A;  2LQ6 A;  4GNF A;  2KWK A;  2XB1 A;  2YSM A;  2YT5 A;  3IHP A;  3EB5 A;  3HCS A;  4AYC A;  2VJF B;  5LKZ A;  1BOR A;  3DPL R;  2MA5 A;  2EA6 A;  2ECN A;  5B76 A;  4AYC B;  2K17 A;  2ECG A;  1VFY A;  4W4U A;  2F6N A;  4PTB A;  2C2L A;  3ZVY A;  2H0D A;  5H1V A;  5C11 A;  2KGI A;  4AVX A;  1HYJ A;  3O36 A;  1N87 A;  3HCU A;  2YHO A;  4L58 A;  4MSX A;  1WEP A;  3ZVZ B;  2H0D B;  1WEM A;  1WIM A;  3RPG C;  2LDR A;  5AIT A;  2LGV A;  4IC3 A;  2CSZ A;  4R7E A;  1XWH A;  1Z6U A;  2LGL A;  2PUY A;  2AN6 A;  4I7B A;  5FEY A;  5TAB A;  3SOU A;  2PNX A;  2XEU A;  2LRI C;  4GND A;  4MVT A;  5B77 A;  1WGM A;  4ZQL A;  2VP7 A;  2L75 A;  1WEV A;  5FB1 A;  1WES A;  2D8S A;  5LCW B;  1MM3 A;  2K4D A;  2MA6 A;  1VD4 A;  2EOD A;  2L43 A;  4UP0 A;  3ZPV E;  4NN2 A;  2JMJ A;  2VPD A;  3LQJ A;  3V43 A;  3M99 A;  4LK9 A;  3T7L A;  2KRE A;  3PUQ A;  3U5O A;  1T1H A;  1JM7 B;  2MD8 C;  3N9N A;  3ZTG A;  5D1L B;  4R2Y A;  1CHC A;  1LDJ B;  2C2V S;  3KQI A;  1F62 A;  1FP0 A;  4GNG A;  2CSY A;  2JMI A;  3KV6 A;  5TBN A;  1E4U A;  2L80 A;  5EYA F;  4R8P K;  3RTR B;  3RPG B;  4IC2 A;  4ZDT A;  4QF3 A;  3DQV R;  5H1T A;  3N9M A;  2YU4 A;  3O37 A;  4XI1 A;  4V3L C;  4N4F A;  5KH7 A;  3ZNI A;  2DX8 A;  2MNZ A;  2JMD A;  4LLB A;  2YQM A;  2Y43 A;  2QIC A;  4I7C A;  5B75 A;  5DKA A;  5I3L A;  2KWO A;  4UP5 A;  4FIP A;  1V87 A;  4AP4 A;  2E6R A;  2L0B A;  4ZUX U;  2ECV A;  2VNF A;  2JRJ A;  1WEN A;  2KR4 A;  2KE1 A;  1X4I A;  5H1U A;  3O33 A;  3SOX A;  2K16 A;  2IDA A;  2VPE A;  2LN0 A;  1U6G B;  2KYU A;  2LGG A;  2MD7 B;  3QZV A;  2UZG A;  2KFT A;  2YRE A;  5H9M A;  4WZ2 A;  4YAB A;  1HYI A;  4FJC A;  4I7D A;  4C9Z A;  1WFK A;  5DIN A;  2KGG A;  2FSA A;  4YC9 A;  5G05 B;  1WIL A;  2L5U A;  5KH9 A;  1MM2 A;  4O64 A;  2QJ0 A;  2ECI A;  3O7A A;  1LDK C;  3N9O A;  5B8D A;  3LQI A;  3HTK C;  1JM7 A;  3O35 A;  1K2F A;  3FL2 A;  3U5P A;  2Y1N A;  3SHB A;  2G6Q A;  4LJN A;  5TRB A;  4QF2 A;  2KU3 A;  4YAT A;  4F52 B;  5KH3 A;  1WEW A;  2MT5 A;  2NAA A;  2LXH C;  2M6M A;  5AIU A;  3O70 A;  4Q6F A;  4B86 C;  3VK6 A;  4FO9 A;  3GV4 A;  4YAX A;  3M63 A;  2EGP A;  4UI9 B;  5B79 A;  4TKP B;  2ECT A;  3NG2 A;  5J3X A;  5TDW A;  3LQH A;  4CA1 A;  1RMD A;  2YW8 A;  1DVP A;  4YBM A;  2VJE A;  3C6W A;  5LKX A;  5TDR A;  2YUR A;  2FUU A;  4AUQ B;  1VYX A;  1WEE A;  4GNE A;  1WEQ A;  4L7X A;  2MUM A;  1IYM A;  2M1R A;  2VJE B;  4A4C A;  2E6S A;  2KWJ A;  3U5N A;  2FUI A;  2ECW A;  2KWN A;  4WZ3 B;  5D1M B;  3U5M A;  4FK5 A;  4GB0 A;  2G45 A;  3N9Q A;  3MHH A;  5FB0 A;  3PUR A;  3C5K A;  3MHS A;  2YQL A;  3KNV A;  3ASL A;  2MNY A;  2YYR A;  5B78 A;  3L1Z B;  5C13 A;  4PPE A;  1JOC A;  2F6J A;  1ZBD B;  3N9P A;  2KIZ A;  4BBQ A;  2M3H A;  2LV9 A;  3EB6 A;  2VPB A;  4A4B A;  2QIZ A;  4S3O C;  4A49 A;  2OXQ C;  3LRQ A;  3HCT A;  3I2D A;  3L11 A;  5G0F A;  4YBT A;  2ZET C;  4N3W A;  5LKT A;  1X4U A;  3L1X A;  4WA6 A;  2CKL A;  4X3G A;  1WEO A;  1X4J A;  2VPG A;  2HYE D;  2LGK A;  4LAD B;  2CT2 A;  5JG6 A;  3KV5 A;  2F42 A;  3PHD A;  1Z2Q A;  2CKL B;  4BHW A;  2RSD A;  2BAY A;  4YAD A;  2ECJ A;  1WE9 A;  2YHN A;  3M62 A;  4P5O B;  1Z60 A;  3N9L A;  3T6R A;  4CCG X;  5G04 B;  3ZPV 1;  4WZ0 A;  2RI7 A;  1FBV A;  3GL6 A;  3O34 A;  2K1J A;  2LXP C;  3SOW A;  2I50 A;  2M85 A;  2G43 A;  4V3K C; 
#chains in the Genus database with same CATH topology
 2MIQ A;  1WEU A;  4LKA A;  2YSJ A;  2MKE A;  5LKU A;  5D1K B;  4S3O B;  4A0C D;  1G25 A;  2YUC A;  4YBS A;  3ZYQ A;  3SUB A;  2Y1M A;  3LDY A;  4B7Y C;  2HDP A;  2VJF A;  5FER A;  5SVI A;  2LQ6 A;  4GNF A;  2KWK A;  2XB1 A;  2YSM A;  2YT5 A;  3IHP A;  3EB5 A;  3HCS A;  4AYC A;  2VJF B;  5LKZ A;  2EGM A;  1BOR A;  5SVI B;  3DPL R;  3PLW A;  2MA5 A;  2EA6 A;  2ECN A;  5B76 A;  4AYC B;  2K17 A;  2ECG A;  1VFY A;  4W4U A;  2F6N A;  4PTB A;  2C2L A;  2LAU A;  3ZVY A;  2D8U A;  2H0D A;  5H1V A;  5C11 A;  2KGI A;  4AVX A;  2FFW A;  1HYJ A;  4H9D A;  3O36 A;  1N87 A;  3HCU A;  2YHO A;  4L58 A;  4Z0O A;  1DCQ A;  4MSX A;  2XOZ A;  1WEP A;  3ZVZ B;  2H0D B;  1WEM A;  1WIM A;  3RPG C;  2LDR A;  3KDE C;  2L7P A;  5AIT A;  2LGV A;  4IC3 A;  3DWD A;  4R7E A;  2CSZ A;  1XWH A;  1Z6U A;  2LGL A;  2PUY A;  2CRR A;  2AN6 A;  4I7B A;  5FEY A;  5TAB A;  3SOU A;  2PNX A;  2XEU A;  2LRI C;  4GND A;  4MVT A;  3H7H A;  5B77 A;  1WGM A;  4ZQL A;  2VP7 A;  2L75 A;  1WEV A;  5FB1 A;  1WES A;  2D8S A;  5LCW B;  1MM3 A;  2K4D A;  2MA6 A;  1VD4 A;  2EOD A;  2L43 A;  2P57 A;  4UP0 A;  3ZPV E;  4NN2 A;  2JMJ A;  2VPD A;  3LQJ A;  3V43 A;  3M99 A;  4LK9 A;  3T7L A;  2KRE A;  3PUQ A;  3U5O A;  2YVR A;  1T1H A;  1JM7 B;  3LJU X;  2MD8 C;  3N9N A;  3ZTG A;  5D1L B;  4R2Y A;  1CHC A;  3FJU B;  1LDJ B;  2C2V S;  2CRW A;  3KQI A;  1F62 A;  1FP0 A;  4GNG A;  2CSY A;  2JMI A;  3KV6 A;  5TBN A;  1E4U A;  3O47 A;  4F1P A;  2L80 A;  5EYA F;  4R8P K;  3RTR B;  3RPG B;  4IC2 A;  4ZDT A;  4QF3 A;  3DQV R;  5H1T A;  3N9M A;  2DJA A;  2YU4 A;  3O37 A;  4XI1 A;  3M7K A;  4V3L C;  3Q1D A;  4N4F A;  5KH7 A;  3ZNI A;  2DX8 A;  2MNZ A;  2JMD A;  4LLB A;  2YQM A;  2Y43 A;  2QIC A;  4I7C A;  5B75 A;  5DKA A;  5I3L A;  2KWO A;  4UP5 A;  4FIP A;  1V87 A;  4AP4 A;  5SVX A;  2E6R A;  1MBM A;  2L0B A;  4ZUX U;  2ECV A;  5K3Q A;  2VNF A;  2JRJ A;  1WEN A;  2KR4 A;  2KE1 A;  1X4I A;  5H1U A;  3O33 A;  3SOX A;  3LVR E;  2K16 A;  2IDA A;  2VPE A;  4OGE A;  2LN0 A;  1U6G B;  2B0O E;  2KYU A;  3E2D A;  2E61 A;  2LGG A;  2MD7 B;  3QZV A;  2UZG A;  2KFT A;  2YRE A;  5H9M A;  4WZ2 A;  4YAB A;  1HYI A;  4FJC A;  4I7D A;  4C9Z A;  1WFK A;  5DIN A;  2KGG A;  2FSA A;  4YC9 A;  5G05 B;  1WIL A;  2L5U A;  5KH9 A;  1MM2 A;  2IQJ A;  2XOY A;  4O64 A;  2QJ0 A;  2ECI A;  5SVY A;  3O7A A;  1LDK C;  3T9K A;  3N9O A;  5B8D A;  3LQI A;  3HTK C;  1JM7 A;  3O35 A;  1K2F A;  3FL2 A;  3U5P A;  2Y1N A;  3SHB A;  2G6Q A;  4LJN A;  5TRB A;  4QF2 A;  2KU3 A;  2DSM A;  4YAT A;  4F52 B;  5KH3 A;  1WEW A;  2MT5 A;  2NAA A;  2LXH C;  2M6M A;  5AIU A;  3O70 A;  4Q6F A;  4B86 C;  3VK6 A;  4FO9 A;  3GV4 A;  4YAX A;  3M63 A;  2EGP A;  4UI9 B;  5B79 A;  4TKP B;  2ECT A;  3NG2 A;  2CON A;  4O62 A;  5J3X A;  2XP0 A;  5TDW A;  3LQH A;  4CA1 A;  1RMD A;  2YW8 A;  1DVP A;  2EXU A;  4YBM A;  2KKY A;  2VJE A;  3C6W A;  5LKX A;  5TDR A;  3JUE A;  2YUR A;  2FUU A;  4AUQ B;  2FD4 A;  1VYX A;  1WEE A;  2M13 A;  4GNE A;  1WEQ A;  4L7X A;  2MUM A;  1IYM A;  2M1R A;  2VJE B;  4A4C A;  2E6S A;  2KWJ A;  4OGC A;  3U5N A;  2FUI A;  2ECW A;  2KWN A;  4WZ3 B;  5D1M B;  3U5M A;  4FK5 A;  4GB0 A;  2G45 A;  3N9Q A;  3MHH A;  5FB0 A;  3LVQ E;  3PUR A;  3C5K A;  3MHS A;  2YQL A;  3KNV A;  3ASL A;  2MNY A;  3MDB C;  2YYR A;  5B78 A;  3L1Z B;  5C13 A;  4PPE A;  1JOC A;  2F6J A;  1ZBD B;  3FAN A;  3N9P A;  2KIZ A;  4BBQ A;  2M3H A;  2LV9 A;  3EB6 A;  2VPB A;  4A4B A;  2QIZ A;  4S3O C;  4A49 A;  2OXQ C;  3LRQ A;  3HCT A;  3I2D A;  3L11 A;  5G0F A;  2RR4 A;  4YBT A;  3DDT A;  2OWA A;  2ZET C;  4N3W A;  5LKT A;  1X4U A;  4Z0R A;  3L1X A;  4WA6 A;  2CKL A;  4X3G A;  1WEO A;  1X4J A;  3FEH A;  2VPG A;  2HYE D;  2LGK A;  4LAD B;  2CT2 A;  5JG6 A;  3KV5 A;  2F42 A;  3PHD A;  3FM8 C;  1Z2Q A;  2CKL B;  4BHW A;  2RSD A;  2BAY A;  4YAD A;  3FAO A;  2KKX A;  2XOC A;  2JM3 A;  2ECJ A;  1WE9 A;  2YHN A;  3M62 A;  4P5O B;  1Z60 A;  3N9L A;  2JUN A;  3T6R A;  4CCG X;  5G04 B;  3ZPV 1;  4WZ0 A;  4QQ4 A;  2RI7 A;  1FBV A;  3GL6 A;  3O34 A;  2K1J A;  2LXP C;  2CSV A;  3SOW A;  2I50 A;  2M85 A;  2G43 A;  4V3K C; 
#chains in the Genus database with same CATH homology
 2MIQ A;  1WEU A;  4LKA A;  2YSJ A;  5LKU A;  5D1K B;  4S3O B;  4A0C D;  1G25 A;  2YUC A;  4YBS A;  3ZYQ A;  2Y1M A;  4B7Y C;  2HDP A;  2VJF A;  5FER A;  2LQ6 A;  4GNF A;  2KWK A;  2XB1 A;  2YSM A;  2YT5 A;  3IHP A;  3EB5 A;  3HCS A;  4AYC A;  2VJF B;  5LKZ A;  1BOR A;  3DPL R;  2MA5 A;  2EA6 A;  2ECN A;  5B76 A;  4AYC B;  2K17 A;  2ECG A;  1VFY A;  4W4U A;  2F6N A;  4PTB A;  2C2L A;  3ZVY A;  2H0D A;  5H1V A;  5C11 A;  2KGI A;  4AVX A;  1HYJ A;  3O36 A;  1N87 A;  3HCU A;  2YHO A;  4L58 A;  4MSX A;  1WEP A;  3ZVZ B;  2H0D B;  1WEM A;  1WIM A;  3RPG C;  2LDR A;  5AIT A;  2LGV A;  4IC3 A;  2CSZ A;  4R7E A;  1XWH A;  1Z6U A;  2LGL A;  2PUY A;  2AN6 A;  4I7B A;  5FEY A;  5TAB A;  3SOU A;  2PNX A;  2XEU A;  2LRI C;  4GND A;  4MVT A;  5B77 A;  1WGM A;  4ZQL A;  2VP7 A;  2L75 A;  1WEV A;  5FB1 A;  1WES A;  2D8S A;  5LCW B;  1MM3 A;  2K4D A;  2MA6 A;  1VD4 A;  2EOD A;  2L43 A;  4UP0 A;  3ZPV E;  4NN2 A;  2JMJ A;  2VPD A;  3LQJ A;  3V43 A;  3M99 A;  4LK9 A;  3T7L A;  2KRE A;  3PUQ A;  3U5O A;  1T1H A;  1JM7 B;  2MD8 C;  3N9N A;  3ZTG A;  5D1L B;  4R2Y A;  1CHC A;  1LDJ B;  2C2V S;  3KQI A;  1F62 A;  1FP0 A;  4GNG A;  2CSY A;  2JMI A;  3KV6 A;  5TBN A;  1E4U A;  2L80 A;  5EYA F;  4R8P K;  3RTR B;  3RPG B;  4IC2 A;  4ZDT A;  4QF3 A;  3DQV R;  5H1T A;  3N9M A;  2YU4 A;  3O37 A;  4XI1 A;  4V3L C;  4N4F A;  5KH7 A;  3ZNI A;  2DX8 A;  2MNZ A;  2JMD A;  4LLB A;  2YQM A;  2Y43 A;  2QIC A;  4I7C A;  5B75 A;  5DKA A;  5I3L A;  2KWO A;  4UP5 A;  4FIP A;  1V87 A;  4AP4 A;  2E6R A;  2L0B A;  4ZUX U;  2ECV A;  2VNF A;  2JRJ A;  1WEN A;  2KR4 A;  2KE1 A;  1X4I A;  5H1U A;  3O33 A;  3SOX A;  2K16 A;  2IDA A;  2VPE A;  2LN0 A;  1U6G B;  2KYU A;  2LGG A;  2MD7 B;  3QZV A;  2UZG A;  2KFT A;  2YRE A;  5H9M A;  4WZ2 A;  4YAB A;  1HYI A;  4FJC A;  4I7D A;  4C9Z A;  1WFK A;  5DIN A;  2KGG A;  2FSA A;  4YC9 A;  5G05 B;  1WIL A;  2L5U A;  5KH9 A;  1MM2 A;  4O64 A;  2QJ0 A;  2ECI A;  3O7A A;  1LDK C;  3N9O A;  5B8D A;  3LQI A;  3HTK C;  1JM7 A;  3O35 A;  1K2F A;  3FL2 A;  3U5P A;  2Y1N A;  3SHB A;  2G6Q A;  4LJN A;  5TRB A;  4QF2 A;  2KU3 A;  4YAT A;  4F52 B;  5KH3 A;  1WEW A;  2MT5 A;  2NAA A;  2LXH C;  2M6M A;  5AIU A;  3O70 A;  4Q6F A;  4B86 C;  3VK6 A;  4FO9 A;  3GV4 A;  4YAX A;  3M63 A;  2EGP A;  4UI9 B;  5B79 A;  4TKP B;  2ECT A;  3NG2 A;  5J3X A;  5TDW A;  3LQH A;  4CA1 A;  1RMD A;  2YW8 A;  1DVP A;  4YBM A;  2VJE A;  3C6W A;  5LKX A;  5TDR A;  2YUR A;  2FUU A;  4AUQ B;  1VYX A;  1WEE A;  4GNE A;  1WEQ A;  4L7X A;  2MUM A;  1IYM A;  2M1R A;  2VJE B;  4A4C A;  2E6S A;  2KWJ A;  3U5N A;  2FUI A;  2ECW A;  2KWN A;  4WZ3 B;  5D1M B;  3U5M A;  4FK5 A;  4GB0 A;  2G45 A;  3N9Q A;  3MHH A;  5FB0 A;  3PUR A;  3C5K A;  3MHS A;  2YQL A;  3KNV A;  3ASL A;  2MNY A;  2YYR A;  5B78 A;  3L1Z B;  5C13 A;  4PPE A;  1JOC A;  2F6J A;  1ZBD B;  3N9P A;  2KIZ A;  4BBQ A;  2M3H A;  2LV9 A;  3EB6 A;  2VPB A;  4A4B A;  2QIZ A;  4S3O C;  4A49 A;  2OXQ C;  3LRQ A;  3HCT A;  3I2D A;  3L11 A;  5G0F A;  4YBT A;  2ZET C;  4N3W A;  5LKT A;  1X4U A;  3L1X A;  4WA6 A;  2CKL A;  4X3G A;  1WEO A;  1X4J A;  2VPG A;  2HYE D;  2LGK A;  4LAD B;  2CT2 A;  5JG6 A;  3KV5 A;  2F42 A;  3PHD A;  1Z2Q A;  2CKL B;  4BHW A;  2RSD A;  2BAY A;  4YAD A;  2ECJ A;  1WE9 A;  2YHN A;  3M62 A;  4P5O B;  1Z60 A;  3N9L A;  3T6R A;  4CCG X;  5G04 B;  3ZPV 1;  4WZ0 A;  2RI7 A;  1FBV A;  3GL6 A;  3O34 A;  2K1J A;  2LXP C;  3SOW A;  2I50 A;  2M85 A;  2G43 A;  4V3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...