2RSDA

Solution structure of the plant homeodomain (phd) of the e3 sumo ligase siz1 from rice
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
GSDSFQPEAKVRCICSSTMVNDSMIQCEDQRCQVWQHLNCVLIPDKPGESAEVPPVFYCELCRLSRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PHD finger of the SUMO ligase Siz/PIAS family in rice reveals specific binding for methylated histone H3 at lysine 4 and arginine 2
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Ligase
molecule keywords E3 SUMO-protein ligase SIZ1
total genus 9
structure length 68
sequence length 68
ec nomenclature ec 6.3.2.-:
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2rsdA00
2MUMA 3N9OA 2G43A 3SOXA 1JM7A 3NG2A 5I3LA 3C6WA 5B79A 5TABA 5FB1A 2L5UA 5B77A 1WESA 1FP0A 3N9QA 4L7XA 2C2VS 1WEWA 5D1LB 2YREA 1X4UA 5LKTA 2EODA 2KYUA 4AYCA 2ECNA 2L75A 5TBNA 3MHSA 2K17A 2KWOA 3ZNIA 2KWNA 2ECIA 2LXHC 2LDRA 1MM2A 1WEOA 1WEEA 5H9MA 1WEVA 2QICA 1HYJA 2HYED 2VPGA 2KIZA 3LQIA 2M3HA 5G04B 2YU4A 2ZETC 2FSAA 5FB0A 2LQ6A 2OXQC 2KGIA 4L58A 4LLBA 5B8DA 2LRIC 3L11A 3EB6A 3KNVA 4YABA 3O33A 3HCUA 2CKLB 3M62A 2H0DA 2CSZA 2Y43A 3M63A 4V3KC 4B86C 1WFKA 4YAXA 3O34A 2YQMA 1IYMA 3IHPA 3L1XA 2L80A 2ECTA 3DPLR 1Z60A 3ASLA 4LJNA 4YBTA 3SOUA 4I7BA 3O36A 4PPEA 2K16A 2KR4A 4MVTA 2BAYA 2M1RA 3ZPVE 2HDPA 4GNEA 2CKLA 1MM3A 2VJEA 5B76A 2YUCA 4UI9B 2PNXA 1WIMA 2VPEA 2IDAA 5D1MB 5EYAF 2CT2A 2VPDA 4QF2A 2JMJA 2YSJA 5LCWB 3VK6A 4V3LC 1X4IA 4FK5A 5KH7A 5AITA 3M99A 2AN6A 1LDJB 5LKUA 1HYIA 2C2LA 2G6QA 1WGMA 2MA5A 2PUYA 1VFYA 2E6SA 2VJEB 4YATA 4IC3A 5LKXA 5TDWA 4FIPA 4CA1A 3DQVR 3KV6A 2NAAA 3O37A 1JM7B 1F62A 4YADA 3L1ZB 4FO9A 3LQJA 3PURA 2VP7A 3U5NA 4A4BA 3HCSA 4UP0A 3T6RA 4NN2A 1WILA 1WEQA 5H1VA 3I2DA 5C11A 2MD7B 2L43A 4W4UA 1LDKC 1FBVA 5G0FA 1JOCA 1WEUA 2F6NA 4GNDA 3EB5A 3PUQA 4YBMA 2QJ0A 2YHNA 3O70A 4IC2A 4WZ0A 4WA6A 2JMDA 5KH9A 1K2FA 3V43A 4AP4A 4A4CA 2KU3A 2XB1A 3ZYQA 3FL2A 4PTBA 4AYCB 4YC9A 2K4DA 3U5OA 5FERA 1U6GB 2LGKA 4LK9A 3LRQA 3C5KA 3KV5A 1V87A 2VPBA 4I7CA 2Y1MA 1E4UA 2LGGA 4R7EA 2MT5A 2CSYA 4O64A 3ZVZB 2M6MA 3O7AA 4A49A 4GNFA 1Z2QA 2ECGA 2MNZA 2EGPA 2JRJA 3GL6A 5H1TA 4I7DA 4S3OB 4XI1A 3O35A 2KREA 1WE9A 2LGVA 5AIUA 3ZTGA 3N9NA 2YQLA 4WZ3B 4X3GA 2UZGA 2F6JA 2QIZA 2I50A 2YURA 2L0BA 2JMIA 2RSDA 1XWHA 2YHOA 4BBQA 4ZDTA 1T1HA 4LADB 4QF3A 4ZUXU 4FJCA 5C13A 5B78A 4MSXA 2VJFB 4S3OC 3ZVYA 1DVPA 4WZ2A 1N87A 1VYXA 2KFTA 5G05B 1G25A 2FUUA 3SHBA 2DX8A 4UP5A 4AVXA 2K1JA 4R8PK 2MA6A 3T7LA 3HTKC 3RPGB 2MNYA 4N4FA 4LKAA 2YW8A 2M85A 4N3WA 3U5MA 2LXPC 1ZBDB 3HCTA 4TKPB 5FEYA 2KE1A 2YSMA 5TRBA 4F52B 4P5OB 3MHHA 1RMDA 3GV4A 4C9ZA 1WEPA 3N9MA 4B7YC 4Q6FA 5TDRA 2ECVA 2Y1NA 2ECWA 2F42A 2MIQA 5D1KB 2VJFA 4GNGA 3U5PA 2FUIA 2G45A 4YBSA 2YT5A 2RI7A 2LN0A 4CCGX 1Z6UA 2LGLA 3QZVA 5KH3A 5JG6A 3LQHA 5H1UA 3KQIA 5J3XA 3N9PA 1X4JA 1BORA 2XEUA 2MD8C 5DINA 1VD4A 3ZPV1 4R2YA 4A0CD 4GB0A 2LV9A 1CHCA 1WENA 3SOWA 1WEMA 3N9LA 2KGGA 3RPGC 4AUQB 2EA6A 5LKZA 2VNFA 2H0DB 3PHDA 2D8SA 2KWJA 2KWKA 4BHWA 2ECJA 4ZQLA 5B75A 3RTRB 5DKAA 2YYRA 2E6RA
chains in the Genus database with same CATH superfamily
2MUMA 3N9OA 2G43A 4F1PA 3SOXA 5SVXA 1JM7A 3NG2A 5I3LA 3C6WA 5B79A 5TABA 5FB1A 2L5UA 3H7HA 5B77A 1WESA 1FP0A 3N9QA 4L7XA 2C2VS 1WEWA 2FD4A 5D1LB 2YREA 1X4UA 5LKTA 2EODA 2KYUA 4AYCA 2ECNA 2L75A 5TBNA 3MHSA 2K17A 2KWOA 2JM3A 3ZNIA 4O62A 2KWNA 2ECIA 2LXHC 2LDRA 1MM2A 1WEOA 1WEEA 5H9MA 1WEVA 2QICA 1HYJA 2HYED 2VPGA 2YVRA 5G04B 2KIZA 3LQIA 2M3HA 2YU4A 2ZETC 2FSAA 5FB0A 2LQ6A 2OXQC 3KDEC 2KGIA 4L58A 4LLBA 2XOYA 5B8DA 2LRIC 3L11A 3EB6A 3KNVA 4H9DA 4YABA 3O33A 3HCUA 2CKLB 3M62A 2H0DA 2LAUA 2CSZA 3SUBA 2Y43A 3LJUX 3M63A 4V3KC 4B86C 3MDBC 1WFKA 4YAXA 3O34A 2YQMA 1IYMA 3IHPA 3L1XA 2L80A 2ECTA 2IQJA 3DPLR 2JUNA 1Z60A 3ASLA 4LJNA 4YBTA 3SOUA 4I7BA 3FJUB 3O36A 4PPEA 2DSMA 2K16A 2KR4A 4MVTA 2BAYA 2M1RA 3ZPVE 2EXUA 2HDPA 4GNEA 2DJAA 2CKLA 2MKEA 1MM3A 2VJEA 5B76A 2YUCA 4UI9B 2PNXA 1WIMA 3FAOA 2VPEA 2IDAA 5D1MB 5EYAF 2CT2A 2VPDA 4QF2A 2JMJA 2YSJA 4QQ4A 5LCWB 2RR4A 3VK6A 4V3LC 1X4IA 4FK5A 5KH7A 5AITA 3M99A 2AN6A 1LDJB 5LKUA 1HYIA 2C2LA 2G6QA 1WGMA 2MA5A 2PUYA 1VFYA 2E61A 2E6SA 2VJEB 4YATA 4IC3A 5LKXA 1MBMA 2OWAA 5TDWA 4FIPA 4CA1A 3DQVR 3KV6A 2NAAA 3DWDA 3O37A 1JM7B 1F62A 4YADA 3L1ZB 4FO9A 3LQJA 3PURA 2VP7A 3U5NA 3PLWA 4A4BA 3HCSA 4UP0A 3T6RA 4NN2A 1WILA 1WEQA 2CRWA 2L7PA 5H1VA 3I2DA 5C11A 2MD7B 2L43A 3T9KA 4W4UA 2KKYA 1LDKC 1FBVA 5G0FA 1JOCA 1WEUA 2F6NA 4GNDA 3EB5A 3PUQA 4YBMA 2QJ0A 2YHNA 3O70A 4IC2A 4WZ0A 4WA6A 2KKXA 2JMDA 3E2DA 5KH9A 1K2FA 3V43A 4AP4A 4A4CA 2KU3A 2XB1A 3ZYQA 3FL2A 4PTBA 2FFWA 4AYCB 2XOZA 4YC9A 2K4DA 3U5OA 5FERA 1U6GB 2LGKA 4LK9A 3LRQA 5SVIA 3C5KA 3KV5A 1V87A 2VPBA 4I7CA 5SVIB 2Y1MA 1E4UA 2LGGA 3FEHA 4OGEA 4R7EA 2MT5A 2CSYA 4O64A 3ZVZB 2M6MA 3O7AA 4A49A 3O47A 4GNFA 2CRRA 1Z2QA 2ECGA 2XOCA 2MNZA 2EGPA 2JRJA 3GL6A 5H1TA 4I7DA 4S3OB 4XI1A 3O35A 2KREA 1WE9A 2LGVA 5AIUA 3LDYA 3ZTGA 3N9NA 2YQLA 4WZ3B 4X3GA 2UZGA 2F6JA 2QIZA 3LVRE 2I50A 2YURA 2L0BA 2JMIA 4OGCA 2RSDA 1XWHA 2YHOA 4BBQA 2D8UA 4ZDTA 1T1HA 4LADB 4QF3A 4ZUXU 4FJCA 5C13A 5B78A 4MSXA 2VJFB 4S3OC 3ZVYA 1DVPA 4WZ2A 1N87A 1VYXA 2KFTA 5G05B 1G25A 2B0OE 2FUUA 3FANA 3JUEA 3SHBA 4Z0OA 2DX8A 4UP5A 4AVXA 2K1JA 4R8PK 2MA6A 3T7LA 3HTKC 3RPGB 2MNYA 4N4FA 4LKAA 2YW8A 2XP0A 2M85A 4N3WA 3U5MA 2LXPC 3DDTA 1ZBDB 3HCTA 4TKPB 5FEYA 2KE1A 2YSMA 5TRBA 4F52B 4P5OB 3MHHA 1RMDA 3GV4A 4Z0RA 4C9ZA 1WEPA 3N9MA 4B7YC 4Q6FA 5TDRA 2ECVA 2EGMA 2CSVA 2Y1NA 2ECWA 2F42A 2MIQA 5D1KB 2VJFA 4GNGA 3U5PA 2FUIA 2G45A 4YBSA 2YT5A 3Q1DA 2RI7A 2LN0A 4CCGX 1Z6UA 1DCQA 3LVQE 2LGLA 3QZVA 5KH3A 5JG6A 3LQHA 5H1UA 2P57A 3KQIA 5J3XA 5SVYA 2M13A 3N9PA 1X4JA 1BORA 2XEUA 3FM8C 2MD8C 5DINA 1VD4A 3ZPV1 4R2YA 4A0CD 4GB0A 2LV9A 1CHCA 1WENA 2CONA 3SOWA 1WEMA 3M7KA 3N9LA 5K3QA 2KGGA 3RPGC 4AUQB 2EA6A 5LKZA 2VNFA 2H0DB 3PHDA 2D8SA 2KWJA 2KWKA 4BHWA 2ECJA 4ZQLA 5B75A 3RTRB 5DKAA 2YYRA 2E6RA
chains in the Genus database with same CATH topology
2MUMA 3N9OA 2G43A 3SOXA 1JM7A 3NG2A 5I3LA 3C6WA 5B79A 5TABA 5FB1A 2L5UA 5B77A 1WESA 1FP0A 3N9QA 4L7XA 2C2VS 1WEWA 5D1LB 2YREA 1X4UA 5LKTA 2EODA 2KYUA 4AYCA 2ECNA 2L75A 5TBNA 3MHSA 2K17A 2KWOA 3ZNIA 2KWNA 2ECIA 2LXHC 2LDRA 1MM2A 1WEOA 1WEEA 5H9MA 1WEVA 2QICA 1HYJA 2HYED 2VPGA 2KIZA 3LQIA 2M3HA 5G04B 2YU4A 2ZETC 2FSAA 5FB0A 2LQ6A 2OXQC 2KGIA 4L58A 4LLBA 5B8DA 2LRIC 3L11A 3EB6A 3KNVA 4YABA 3O33A 3HCUA 2CKLB 3M62A 2H0DA 2CSZA 2Y43A 3M63A 4V3KC 4B86C 1WFKA 4YAXA 3O34A 2YQMA 1IYMA 3IHPA 3L1XA 2L80A 2ECTA 3DPLR 1Z60A 3ASLA 4LJNA 4YBTA 3SOUA 4I7BA 3O36A 4PPEA 2K16A 2KR4A 4MVTA 2BAYA 2M1RA 3ZPVE 2HDPA 4GNEA 2CKLA 1MM3A 2VJEA 5B76A 2YUCA 4UI9B 2PNXA 1WIMA 2VPEA 2IDAA 5D1MB 5EYAF 2CT2A 2VPDA 4QF2A 2JMJA 2YSJA 5LCWB 3VK6A 4V3LC 1X4IA 4FK5A 5KH7A 5AITA 3M99A 2AN6A 1LDJB 5LKUA 1HYIA 2C2LA 2G6QA 1WGMA 2MA5A 2PUYA 1VFYA 2E6SA 2VJEB 4YATA 4IC3A 5LKXA 5TDWA 4FIPA 4CA1A 3DQVR 3KV6A 2NAAA 3O37A 1JM7B 1F62A 4YADA 3L1ZB 4FO9A 3LQJA 3PURA 2VP7A 3U5NA 4A4BA 3HCSA 4UP0A 3T6RA 4NN2A 1WILA 1WEQA 5H1VA 3I2DA 5C11A 2MD7B 2L43A 4W4UA 1LDKC 1FBVA 5G0FA 1JOCA 1WEUA 2F6NA 4GNDA 3EB5A 3PUQA 4YBMA 2QJ0A 2YHNA 3O70A 4IC2A 4WZ0A 4WA6A 2JMDA 5KH9A 1K2FA 3V43A 4AP4A 4A4CA 2KU3A 2XB1A 3ZYQA 3FL2A 4PTBA 4AYCB 4YC9A 2K4DA 3U5OA 5FERA 1U6GB 2LGKA 4LK9A 3LRQA 3C5KA 3KV5A 1V87A 2VPBA 4I7CA 2Y1MA 1E4UA 2LGGA 4R7EA 2MT5A 2CSYA 4O64A 3ZVZB 2M6MA 3O7AA 4A49A 4GNFA 1Z2QA 2ECGA 2MNZA 2EGPA 2JRJA 3GL6A 5H1TA 4I7DA 4S3OB 4XI1A 3O35A 2KREA 1WE9A 2LGVA 5AIUA 3ZTGA 3N9NA 2YQLA 4WZ3B 4X3GA 2UZGA 2F6JA 2QIZA 2I50A 2YURA 2L0BA 2JMIA 2RSDA 1XWHA 2YHOA 4BBQA 4ZDTA 1T1HA 4LADB 4QF3A 4ZUXU 4FJCA 5C13A 5B78A 4MSXA 2VJFB 4S3OC 3ZVYA 1DVPA 4WZ2A 1N87A 1VYXA 2KFTA 5G05B 1G25A 2FUUA 3SHBA 2DX8A 4UP5A 4AVXA 2K1JA 4R8PK 2MA6A 3T7LA 3HTKC 3RPGB 2MNYA 4N4FA 4LKAA 2YW8A 2M85A 4N3WA 3U5MA 2LXPC 1ZBDB 3HCTA 4TKPB 5FEYA 2KE1A 2YSMA 5TRBA 4F52B 4P5OB 3MHHA 1RMDA 3GV4A 4C9ZA 1WEPA 3N9MA 4B7YC 4Q6FA 5TDRA 2ECVA 2Y1NA 2ECWA 2F42A 2MIQA 5D1KB 2VJFA 4GNGA 3U5PA 2FUIA 2G45A 4YBSA 2YT5A 2RI7A 2LN0A 4CCGX 1Z6UA 2LGLA 3QZVA 5KH3A 5JG6A 3LQHA 5H1UA 3KQIA 5J3XA 3N9PA 1X4JA 1BORA 2XEUA 2MD8C 5DINA 1VD4A 3ZPV1 4R2YA 4A0CD 4GB0A 2LV9A 1CHCA 1WENA 3SOWA 1WEMA 3N9LA 2KGGA 3RPGC 4AUQB 2EA6A 5LKZA 2VNFA 2H0DB 3PHDA 2D8SA 2KWJA 2KWKA 4BHWA 2ECJA 4ZQLA 5B75A 3RTRB 5DKAA 2YYRA 2E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MUM A;  3N9O A;  2G43 A;  3SOX A;  1JM7 A;  3NG2 A;  5I3L A;  3C6W A;  5B79 A;  5TAB A;  5FB1 A;  2L5U A;  5B77 A;  1WES A;  1FP0 A;  3N9Q A;  4L7X A;  2C2V S;  1WEW A;  5D1L B;  2YRE A;  1X4U A;  5LKT A;  2EOD A;  2KYU A;  4AYC A;  2ECN A;  2L75 A;  5TBN A;  3MHS A;  2K17 A;  2KWO A;  3ZNI A;  2KWN A;  2ECI A;  2LXH C;  2LDR A;  1MM2 A;  1WEO A;  1WEE A;  5H9M A;  1WEV A;  2QIC A;  1HYJ A;  2HYE D;  2VPG A;  2KIZ A;  3LQI A;  2M3H A;  5G04 B;  2YU4 A;  2ZET C;  2FSA A;  5FB0 A;  2LQ6 A;  2OXQ C;  2KGI A;  4L58 A;  4LLB A;  5B8D A;  2LRI C;  3L11 A;  3EB6 A;  3KNV A;  4YAB A;  3O33 A;  3HCU A;  2CKL B;  3M62 A;  2H0D A;  2CSZ A;  2Y43 A;  3M63 A;  4V3K C;  4B86 C;  1WFK A;  4YAX A;  3O34 A;  2YQM A;  1IYM A;  3IHP A;  3L1X A;  2L80 A;  2ECT A;  3DPL R;  1Z60 A;  3ASL A;  4LJN A;  4YBT A;  3SOU A;  4I7B A;  3O36 A;  4PPE A;  2K16 A;  2KR4 A;  4MVT A;  2BAY A;  2M1R A;  3ZPV E;  2HDP A;  4GNE A;  2CKL A;  1MM3 A;  2VJE A;  5B76 A;  2YUC A;  4UI9 B;  2PNX A;  1WIM A;  2VPE A;  2IDA A;  5D1M B;  5EYA F;  2CT2 A;  2VPD A;  4QF2 A;  2JMJ A;  2YSJ A;  5LCW B;  3VK6 A;  4V3L C;  1X4I A;  4FK5 A;  5KH7 A;  5AIT A;  3M99 A;  2AN6 A;  1LDJ B;  5LKU A;  1HYI A;  2C2L A;  2G6Q A;  1WGM A;  2MA5 A;  2PUY A;  1VFY A;  2E6S A;  2VJE B;  4YAT A;  4IC3 A;  5LKX A;  5TDW A;  4FIP A;  4CA1 A;  3DQV R;  3KV6 A;  2NAA A;  3O37 A;  1JM7 B;  1F62 A;  4YAD A;  3L1Z B;  4FO9 A;  3LQJ A;  3PUR A;  2VP7 A;  3U5N A;  4A4B A;  3HCS A;  4UP0 A;  3T6R A;  4NN2 A;  1WIL A;  1WEQ A;  5H1V A;  3I2D A;  5C11 A;  2MD7 B;  2L43 A;  4W4U A;  1LDK C;  1FBV A;  5G0F A;  1JOC A;  1WEU A;  2F6N A;  4GND A;  3EB5 A;  3PUQ A;  4YBM A;  2QJ0 A;  2YHN A;  3O70 A;  4IC2 A;  4WZ0 A;  4WA6 A;  2JMD A;  5KH9 A;  1K2F A;  3V43 A;  4AP4 A;  4A4C A;  2KU3 A;  2XB1 A;  3ZYQ A;  3FL2 A;  4PTB A;  4AYC B;  4YC9 A;  2K4D A;  3U5O A;  5FER A;  1U6G B;  2LGK A;  4LK9 A;  3LRQ A;  3C5K A;  3KV5 A;  1V87 A;  2VPB A;  4I7C A;  2Y1M A;  1E4U A;  2LGG A;  4R7E A;  2MT5 A;  2CSY A;  4O64 A;  3ZVZ B;  2M6M A;  3O7A A;  4A49 A;  4GNF A;  1Z2Q A;  2ECG A;  2MNZ A;  2EGP A;  2JRJ A;  3GL6 A;  5H1T A;  4I7D A;  4S3O B;  4XI1 A;  3O35 A;  2KRE A;  1WE9 A;  2LGV A;  5AIU A;  3ZTG A;  3N9N A;  2YQL A;  4WZ3 B;  4X3G A;  2UZG A;  2F6J A;  2QIZ A;  2I50 A;  2YUR A;  2L0B A;  2JMI A;  2RSD A;  1XWH A;  2YHO A;  4BBQ A;  4ZDT A;  1T1H A;  4LAD B;  4QF3 A;  4ZUX U;  4FJC A;  5C13 A;  5B78 A;  4MSX A;  2VJF B;  4S3O C;  3ZVY A;  1DVP A;  4WZ2 A;  1N87 A;  1VYX A;  2KFT A;  5G05 B;  1G25 A;  2FUU A;  3SHB A;  2DX8 A;  4UP5 A;  4AVX A;  2K1J A;  4R8P K;  2MA6 A;  3T7L A;  3HTK C;  3RPG B;  2MNY A;  4N4F A;  4LKA A;  2YW8 A;  2M85 A;  4N3W A;  3U5M A;  2LXP C;  1ZBD B;  3HCT A;  4TKP B;  5FEY A;  2KE1 A;  2YSM A;  5TRB A;  4F52 B;  4P5O B;  3MHH A;  1RMD A;  3GV4 A;  4C9Z A;  1WEP A;  3N9M A;  4B7Y C;  4Q6F A;  5TDR A;  2ECV A;  2Y1N A;  2ECW A;  2F42 A;  2MIQ A;  5D1K B;  2VJF A;  4GNG A;  3U5P A;  2FUI A;  2G45 A;  4YBS A;  2YT5 A;  2RI7 A;  2LN0 A;  4CCG X;  1Z6U A;  2LGL A;  3QZV A;  5KH3 A;  5JG6 A;  3LQH A;  5H1U A;  3KQI A;  5J3X A;  3N9P A;  1X4J A;  1BOR A;  2XEU A;  2MD8 C;  5DIN A;  1VD4 A;  3ZPV 1;  4R2Y A;  4A0C D;  4GB0 A;  2LV9 A;  1CHC A;  1WEN A;  3SOW A;  1WEM A;  3N9L A;  2KGG A;  3RPG C;  4AUQ B;  2EA6 A;  5LKZ A;  2VNF A;  2H0D B;  3PHD A;  2D8S A;  2KWJ A;  2KWK A;  4BHW A;  2ECJ A;  4ZQL A;  5B75 A;  3RTR B;  5DKA A;  2YYR A;  2E6R A; 
#chains in the Genus database with same CATH topology
 2MUM A;  3N9O A;  2G43 A;  4F1P A;  3SOX A;  5SVX A;  1JM7 A;  3NG2 A;  5I3L A;  3C6W A;  5B79 A;  5TAB A;  5FB1 A;  2L5U A;  3H7H A;  5B77 A;  1WES A;  1FP0 A;  3N9Q A;  4L7X A;  2C2V S;  1WEW A;  2FD4 A;  5D1L B;  2YRE A;  1X4U A;  5LKT A;  2EOD A;  2KYU A;  4AYC A;  2ECN A;  2L75 A;  5TBN A;  3MHS A;  2K17 A;  2KWO A;  2JM3 A;  3ZNI A;  4O62 A;  2KWN A;  2ECI A;  2LXH C;  2LDR A;  1MM2 A;  1WEO A;  1WEE A;  5H9M A;  1WEV A;  2QIC A;  1HYJ A;  2HYE D;  2VPG A;  2YVR A;  5G04 B;  2KIZ A;  3LQI A;  2M3H A;  2YU4 A;  2ZET C;  2FSA A;  5FB0 A;  2LQ6 A;  2OXQ C;  3KDE C;  2KGI A;  4L58 A;  4LLB A;  2XOY A;  5B8D A;  2LRI C;  3L11 A;  3EB6 A;  3KNV A;  4H9D A;  4YAB A;  3O33 A;  3HCU A;  2CKL B;  3M62 A;  2H0D A;  2LAU A;  2CSZ A;  3SUB A;  2Y43 A;  3LJU X;  3M63 A;  4V3K C;  4B86 C;  3MDB C;  1WFK A;  4YAX A;  3O34 A;  2YQM A;  1IYM A;  3IHP A;  3L1X A;  2L80 A;  2ECT A;  2IQJ A;  3DPL R;  2JUN A;  1Z60 A;  3ASL A;  4LJN A;  4YBT A;  3SOU A;  4I7B A;  3FJU B;  3O36 A;  4PPE A;  2DSM A;  2K16 A;  2KR4 A;  4MVT A;  2BAY A;  2M1R A;  3ZPV E;  2EXU A;  2HDP A;  4GNE A;  2DJA A;  2CKL A;  2MKE A;  1MM3 A;  2VJE A;  5B76 A;  2YUC A;  4UI9 B;  2PNX A;  1WIM A;  3FAO A;  2VPE A;  2IDA A;  5D1M B;  5EYA F;  2CT2 A;  2VPD A;  4QF2 A;  2JMJ A;  2YSJ A;  4QQ4 A;  5LCW B;  2RR4 A;  3VK6 A;  4V3L C;  1X4I A;  4FK5 A;  5KH7 A;  5AIT A;  3M99 A;  2AN6 A;  1LDJ B;  5LKU A;  1HYI A;  2C2L A;  2G6Q A;  1WGM A;  2MA5 A;  2PUY A;  1VFY A;  2E61 A;  2E6S A;  2VJE B;  4YAT A;  4IC3 A;  5LKX A;  1MBM A;  2OWA A;  5TDW A;  4FIP A;  4CA1 A;  3DQV R;  3KV6 A;  2NAA A;  3DWD A;  3O37 A;  1JM7 B;  1F62 A;  4YAD A;  3L1Z B;  4FO9 A;  3LQJ A;  3PUR A;  2VP7 A;  3U5N A;  3PLW A;  4A4B A;  3HCS A;  4UP0 A;  3T6R A;  4NN2 A;  1WIL A;  1WEQ A;  2CRW A;  2L7P A;  5H1V A;  3I2D A;  5C11 A;  2MD7 B;  2L43 A;  3T9K A;  4W4U A;  2KKY A;  1LDK C;  1FBV A;  5G0F A;  1JOC A;  1WEU A;  2F6N A;  4GND A;  3EB5 A;  3PUQ A;  4YBM A;  2QJ0 A;  2YHN A;  3O70 A;  4IC2 A;  4WZ0 A;  4WA6 A;  2KKX A;  2JMD A;  3E2D A;  5KH9 A;  1K2F A;  3V43 A;  4AP4 A;  4A4C A;  2KU3 A;  2XB1 A;  3ZYQ A;  3FL2 A;  4PTB A;  2FFW A;  4AYC B;  2XOZ A;  4YC9 A;  2K4D A;  3U5O A;  5FER A;  1U6G B;  2LGK A;  4LK9 A;  3LRQ A;  5SVI A;  3C5K A;  3KV5 A;  1V87 A;  2VPB A;  4I7C A;  5SVI B;  2Y1M A;  1E4U A;  2LGG A;  3FEH A;  4OGE A;  4R7E A;  2MT5 A;  2CSY A;  4O64 A;  3ZVZ B;  2M6M A;  3O7A A;  4A49 A;  3O47 A;  4GNF A;  2CRR A;  1Z2Q A;  2ECG A;  2XOC A;  2MNZ A;  2EGP A;  2JRJ A;  3GL6 A;  5H1T A;  4I7D A;  4S3O B;  4XI1 A;  3O35 A;  2KRE A;  1WE9 A;  2LGV A;  5AIU A;  3LDY A;  3ZTG A;  3N9N A;  2YQL A;  4WZ3 B;  4X3G A;  2UZG A;  2F6J A;  2QIZ A;  3LVR E;  2I50 A;  2YUR A;  2L0B A;  2JMI A;  4OGC A;  2RSD A;  1XWH A;  2YHO A;  4BBQ A;  2D8U A;  4ZDT A;  1T1H A;  4LAD B;  4QF3 A;  4ZUX U;  4FJC A;  5C13 A;  5B78 A;  4MSX A;  2VJF B;  4S3O C;  3ZVY A;  1DVP A;  4WZ2 A;  1N87 A;  1VYX A;  2KFT A;  5G05 B;  1G25 A;  2B0O E;  2FUU A;  3FAN A;  3JUE A;  3SHB A;  4Z0O A;  2DX8 A;  4UP5 A;  4AVX A;  2K1J A;  4R8P K;  2MA6 A;  3T7L A;  3HTK C;  3RPG B;  2MNY A;  4N4F A;  4LKA A;  2YW8 A;  2XP0 A;  2M85 A;  4N3W A;  3U5M A;  2LXP C;  3DDT A;  1ZBD B;  3HCT A;  4TKP B;  5FEY A;  2KE1 A;  2YSM A;  5TRB A;  4F52 B;  4P5O B;  3MHH A;  1RMD A;  3GV4 A;  4Z0R A;  4C9Z A;  1WEP A;  3N9M A;  4B7Y C;  4Q6F A;  5TDR A;  2ECV A;  2EGM A;  2CSV A;  2Y1N A;  2ECW A;  2F42 A;  2MIQ A;  5D1K B;  2VJF A;  4GNG A;  3U5P A;  2FUI A;  2G45 A;  4YBS A;  2YT5 A;  3Q1D A;  2RI7 A;  2LN0 A;  4CCG X;  1Z6U A;  1DCQ A;  3LVQ E;  2LGL A;  3QZV A;  5KH3 A;  5JG6 A;  3LQH A;  5H1U A;  2P57 A;  3KQI A;  5J3X A;  5SVY A;  2M13 A;  3N9P A;  1X4J A;  1BOR A;  2XEU A;  3FM8 C;  2MD8 C;  5DIN A;  1VD4 A;  3ZPV 1;  4R2Y A;  4A0C D;  4GB0 A;  2LV9 A;  1CHC A;  1WEN A;  2CON A;  3SOW A;  1WEM A;  3M7K A;  3N9L A;  5K3Q A;  2KGG A;  3RPG C;  4AUQ B;  2EA6 A;  5LKZ A;  2VNF A;  2H0D B;  3PHD A;  2D8S A;  2KWJ A;  2KWK A;  4BHW A;  2ECJ A;  4ZQL A;  5B75 A;  3RTR B;  5DKA A;  2YYR A;  2E6R A; 
#chains in the Genus database with same CATH homology
 2MUM A;  3N9O A;  2G43 A;  3SOX A;  1JM7 A;  3NG2 A;  5I3L A;  3C6W A;  5B79 A;  5TAB A;  5FB1 A;  2L5U A;  5B77 A;  1WES A;  1FP0 A;  3N9Q A;  4L7X A;  2C2V S;  1WEW A;  5D1L B;  2YRE A;  1X4U A;  5LKT A;  2EOD A;  2KYU A;  4AYC A;  2ECN A;  2L75 A;  5TBN A;  3MHS A;  2K17 A;  2KWO A;  3ZNI A;  2KWN A;  2ECI A;  2LXH C;  2LDR A;  1MM2 A;  1WEO A;  1WEE A;  5H9M A;  1WEV A;  2QIC A;  1HYJ A;  2HYE D;  2VPG A;  2KIZ A;  3LQI A;  2M3H A;  5G04 B;  2YU4 A;  2ZET C;  2FSA A;  5FB0 A;  2LQ6 A;  2OXQ C;  2KGI A;  4L58 A;  4LLB A;  5B8D A;  2LRI C;  3L11 A;  3EB6 A;  3KNV A;  4YAB A;  3O33 A;  3HCU A;  2CKL B;  3M62 A;  2H0D A;  2CSZ A;  2Y43 A;  3M63 A;  4V3K C;  4B86 C;  1WFK A;  4YAX A;  3O34 A;  2YQM A;  1IYM A;  3IHP A;  3L1X A;  2L80 A;  2ECT A;  3DPL R;  1Z60 A;  3ASL A;  4LJN A;  4YBT A;  3SOU A;  4I7B A;  3O36 A;  4PPE A;  2K16 A;  2KR4 A;  4MVT A;  2BAY A;  2M1R A;  3ZPV E;  2HDP A;  4GNE A;  2CKL A;  1MM3 A;  2VJE A;  5B76 A;  2YUC A;  4UI9 B;  2PNX A;  1WIM A;  2VPE A;  2IDA A;  5D1M B;  5EYA F;  2CT2 A;  2VPD A;  4QF2 A;  2JMJ A;  2YSJ A;  5LCW B;  3VK6 A;  4V3L C;  1X4I A;  4FK5 A;  5KH7 A;  5AIT A;  3M99 A;  2AN6 A;  1LDJ B;  5LKU A;  1HYI A;  2C2L A;  2G6Q A;  1WGM A;  2MA5 A;  2PUY A;  1VFY A;  2E6S A;  2VJE B;  4YAT A;  4IC3 A;  5LKX A;  5TDW A;  4FIP A;  4CA1 A;  3DQV R;  3KV6 A;  2NAA A;  3O37 A;  1JM7 B;  1F62 A;  4YAD A;  3L1Z B;  4FO9 A;  3LQJ A;  3PUR A;  2VP7 A;  3U5N A;  4A4B A;  3HCS A;  4UP0 A;  3T6R A;  4NN2 A;  1WIL A;  1WEQ A;  5H1V A;  3I2D A;  5C11 A;  2MD7 B;  2L43 A;  4W4U A;  1LDK C;  1FBV A;  5G0F A;  1JOC A;  1WEU A;  2F6N A;  4GND A;  3EB5 A;  3PUQ A;  4YBM A;  2QJ0 A;  2YHN A;  3O70 A;  4IC2 A;  4WZ0 A;  4WA6 A;  2JMD A;  5KH9 A;  1K2F A;  3V43 A;  4AP4 A;  4A4C A;  2KU3 A;  2XB1 A;  3ZYQ A;  3FL2 A;  4PTB A;  4AYC B;  4YC9 A;  2K4D A;  3U5O A;  5FER A;  1U6G B;  2LGK A;  4LK9 A;  3LRQ A;  3C5K A;  3KV5 A;  1V87 A;  2VPB A;  4I7C A;  2Y1M A;  1E4U A;  2LGG A;  4R7E A;  2MT5 A;  2CSY A;  4O64 A;  3ZVZ B;  2M6M A;  3O7A A;  4A49 A;  4GNF A;  1Z2Q A;  2ECG A;  2MNZ A;  2EGP A;  2JRJ A;  3GL6 A;  5H1T A;  4I7D A;  4S3O B;  4XI1 A;  3O35 A;  2KRE A;  1WE9 A;  2LGV A;  5AIU A;  3ZTG A;  3N9N A;  2YQL A;  4WZ3 B;  4X3G A;  2UZG A;  2F6J A;  2QIZ A;  2I50 A;  2YUR A;  2L0B A;  2JMI A;  2RSD A;  1XWH A;  2YHO A;  4BBQ A;  4ZDT A;  1T1H A;  4LAD B;  4QF3 A;  4ZUX U;  4FJC A;  5C13 A;  5B78 A;  4MSX A;  2VJF B;  4S3O C;  3ZVY A;  1DVP A;  4WZ2 A;  1N87 A;  1VYX A;  2KFT A;  5G05 B;  1G25 A;  2FUU A;  3SHB A;  2DX8 A;  4UP5 A;  4AVX A;  2K1J A;  4R8P K;  2MA6 A;  3T7L A;  3HTK C;  3RPG B;  2MNY A;  4N4F A;  4LKA A;  2YW8 A;  2M85 A;  4N3W A;  3U5M A;  2LXP C;  1ZBD B;  3HCT A;  4TKP B;  5FEY A;  2KE1 A;  2YSM A;  5TRB A;  4F52 B;  4P5O B;  3MHH A;  1RMD A;  3GV4 A;  4C9Z A;  1WEP A;  3N9M A;  4B7Y C;  4Q6F A;  5TDR A;  2ECV A;  2Y1N A;  2ECW A;  2F42 A;  2MIQ A;  5D1K B;  2VJF A;  4GNG A;  3U5P A;  2FUI A;  2G45 A;  4YBS A;  2YT5 A;  2RI7 A;  2LN0 A;  4CCG X;  1Z6U A;  2LGL A;  3QZV A;  5KH3 A;  5JG6 A;  3LQH A;  5H1U A;  3KQI A;  5J3X A;  3N9P A;  1X4J A;  1BOR A;  2XEU A;  2MD8 C;  5DIN A;  1VD4 A;  3ZPV 1;  4R2Y A;  4A0C D;  4GB0 A;  2LV9 A;  1CHC A;  1WEN A;  3SOW A;  1WEM A;  3N9L A;  2KGG A;  3RPG C;  4AUQ B;  2EA6 A;  5LKZ A;  2VNF A;  2H0D B;  3PHD A;  2D8S A;  2KWJ A;  2KWK A;  4BHW A;  2ECJ A;  4ZQL A;  5B75 A;  3RTR B;  5DKA A;  2YYR A;  2E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...