2RSDA

Solution structure of the plant homeodomain (phd) of the e3 sumo ligase siz1 from rice
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
GSDSFQPEAKVRCICSSTMVNDSMIQCEDQRCQVWQHLNCVLIPDKPGESAEVPPVFYCELCRLSRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 SUMO-protein ligase SIZ1
publication title PHD finger of the SUMO ligase Siz/PIAS family in rice reveals specific binding for methylated histone H3 at lysine 4 and arginine 2
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Ligase
total genus 9
structure length 68
sequence length 68
ec nomenclature ec 6.3.2.-:
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2rsdA00
2VP7A 2XEUA 4IC2A 3SOUA 1G25A 3ASLA 2D8SA 5AIUA 2UZGA 4B86C 5TABA 2QIZA 2RSDA 4B7YC 4FO9A 1T1HA 3N9QA 5G05B 1JM7A 4YABA 2FSAA 4L7XA 2YSJA 3FL2A 2Y1MA 4QF3A 3MHSA 4FK5A 4FJCA 4AYCB 3ZPVE 3EB5A 3O37A 4LADB 2PNXA 2MIQA 4LKAA 4YBMA 1E4UA 2CT2A 2EGPA 3O70A 3O36A 1XWHA 4AUQB 3N9NA 1V87A 2JMDA 4W4UA 2KWOA 2VPDA 1MM3A 4PPEA 4P5OB 4UP0A 3M63A 5KH7A 1JM7B 3SHBA 4WZ3B 1ZBDB 5G04B 2K17A 2KYUA 3O33A 1WFKA 2KGIA 4A4BA 4GNEA 4BBQA 3V43A 4A49A 1WE9A 3LRQA 1IYMA 3O7AA 3RPGC 4I7DA 2LQ6A 3U5MA 5B77A 5D1LB 2XB1A 5H9MA 4N4FA 4X3GA 1VYXA 3T6RA 1FP0A 2YHNA 2L43A 4GNGA 4S3OC 5LCWB 1X4JA 5JG6A 2HDPA 5FB0A 5B76A 3ZVYA 5TRBA 4R2YA 4ZQLA 4ZDTA 4Q6FA 1WEWA 5AITA 4CA1A 5FB1A 1WENA 5EYAF 1WGMA 3O34A 2YQLA 2LV9A 1Z60A 5LKTA 5B79A 2LGKA 2QJ0A 2E6RA 4WA6A 5C13A 2KWJA 5H1VA 2LRIC 2YT5A 3SOXA 3KQIA 1WEOA 4ZUXU 2JMJA 4WZ0A 4C9ZA 3ZVZB 4S3OB 2KREA 5B75A 5DKAA 2LGLA 2M85A 2YURA 4YC9A 2YHOA 5FEYA 1DVPA 1WEEA 2EA6A 5J3XA 2CSYA 2Y43A 2ZETC 3LQJA 4MSXA 1BORA 4UI9B 4CCGX 4PTBA 3C6WA 4R7EA 5B8DA 2MD7B 5DINA 3PHDA 2QICA 2RI7A 2YU4A 2LGVA 1FBVA 5D1MB 5LKZA 4QF2A 4BHWA 2H0DA 1MM2A 4V3LC 1F62A 2KIZA 2C2VS 2EODA 2KE1A 3ZPV1 3N9PA 4GNDA 3EB6A 2YUCA 2MA6A 2MD8C 2MA5A 1K2FA 4XI1A 2OXQC 2LDRA 4YATA 1Z2QA 2ECGA 2G45A 1WESA 3L1ZB 4WZ2A 5C11A 2JMIA 1X4IA 4NN2A 2LN0A 2VJEA 3IHPA 4IC3A 2ECVA 4L58A 4AYCA 3LQHA 2YQMA 2C2LA 3O35A 4LJNA 2K16A 5G0FA 1WEPA 1CHCA 2H0DB 3I2DA 3KNVA 3C5KA 3PUQA 3GV4A 2HYED 4YADA 2ECNA 1N87A 1WEQA 2IDAA 3PURA 3RPGB 1WEMA 5D1KB 4O64A 2KR4A 3DQVR 3NG2A 2VNFA 2E6SA 1Z6UA 5LKUA 3HCUA 2L5UA 2MT5A 4LLBA 3QZVA 3L11A 2ECTA 2I50A 2FUUA 3ZYQA 2VJEB 1U6GB 1VFYA 5TDRA 2L80A 4YBTA 2K4DA 4AP4A 2CKLA 2DX8A 2YW8A 2NAAA 1LDJB 2M6MA 5B78A 1WEVA 1WILA 1JOCA 2K1JA 4A4CA 3HTKC 4AVXA 2LXPC 4F52B 2VPGA 3U5NA 3T7LA 3LQIA 3N9OA 1HYJA 4GNFA 2G6QA 5KH9A 4R8PK 3ZNIA 4YBSA 5H1TA 2Y1NA 2FUIA 1RMDA 2YREA 2KWNA 2PUYA 5TDWA 5KH3A 2VJFA 5H1UA 4N3WA 4V3KC 2MUMA 3RTRB 1VD4A 3GL6A 5I3LA 2YSMA 2MNYA 4A0CD 3U5PA 2AN6A 2CKLB 3VK6A 3KV6A 2ECWA 2F6NA 3N9LA 2M1RA 2KWKA 2ECJA 2KU3A 5LKXA 3MHHA 3M62A 4UP5A 2KGGA 4YAXA 2ECIA 2VPEA 3U5OA 4I7CA 2L0BA 3SOWA 3KV5A 3HCTA 2YYRA 4MVTA 2MNZA 2M3HA 4I7BA 1WIMA 4TKPB 2F6JA 3ZTGA 2VJFB 1X4UA 3N9MA 2CSZA 2LGGA 2VPBA 1WEUA 2KFTA 2LXHC 5TBNA 4LK9A 2F42A 3M99A 4GB0A 3L1XA 2JRJA 3DPLR 2L75A 5FERA 4FIPA 1HYIA 2G43A 3HCSA 2BAYA 1LDKC
chains in the Genus database with same CATH superfamily
4OGEA 2VP7A 2XEUA 4IC2A 3SOUA 1G25A 3ASLA 2D8SA 5AIUA 2JUNA 2UZGA 3LVRE 4B86C 5TABA 2QIZA 2RSDA 4B7YC 4FO9A 1T1HA 3N9QA 5G05B 1JM7A 4YABA 2FSAA 4L7XA 2YSJA 3FL2A 2Y1MA 4QF3A 3MHSA 4FK5A 4FJCA 4AYCB 3ZPVE 3EB5A 3O37A 4LADB 2PNXA 2MIQA 4Z0OA 3SUBA 3FM8C 4LKAA 4YBMA 1E4UA 2CT2A 2EGPA 3O70A 3O36A 3FEHA 1XWHA 4AUQB 3N9NA 2RR4A 5K3QA 1V87A 3LJUX 2JMDA 4W4UA 2KWOA 2VPDA 1MM3A 4PPEA 4P5OB 3E2DA 5SVYA 4UP0A 3M63A 5KH7A 1JM7B 3SHBA 4WZ3B 2DJAA 2CRWA 3O47A 1ZBDB 5G04B 2K17A 2KYUA 3O33A 3LDYA 1WFKA 2KGIA 1DCQA 4A4BA 4GNEA 2YVRA 4BBQA 3V43A 4A49A 1WE9A 3LRQA 1IYMA 4Z0RA 3O7AA 3RPGC 3FANA 4I7DA 2LQ6A 2CONA 3U5MA 5B77A 4O62A 5D1LB 2XB1A 5H9MA 5SVIA 4N4FA 3M7KA 4X3GA 1VYXA 3T6RA 1FP0A 2YHNA 2L43A 4GNGA 4S3OC 5LCWB 1X4JA 5JG6A 2HDPA 5FB0A 2LAUA 5B76A 3ZVYA 5TRBA 4R2YA 4ZQLA 4ZDTA 4Q6FA 1WEWA 5AITA 4CA1A 5FB1A 3DWDA 2EGMA 1WENA 3H7HA 5EYAF 1WGMA 3O34A 2YQLA 2LV9A 1Z60A 5LKTA 5B79A 2LGKA 2QJ0A 2E6RA 4WA6A 5C13A 2KWJA 5H1VA 2LRIC 2YT5A 3SOXA 3KQIA 2DSMA 1WEOA 4ZUXU 2JMJA 2CRRA 4WZ0A 4C9ZA 2XP0A 3ZVZB 4S3OB 2KREA 5B75A 2LGLA 5DKAA 4OGCA 2M85A 2YURA 4YC9A 2YHOA 1MBMA 5FEYA 1DVPA 1WEEA 2EA6A 4QQ4A 5J3XA 2CSYA 2Y43A 2ZETC 3LQJA 4MSXA 1BORA 4UI9B 4CCGX 4PTBA 3C6WA 4R7EA 5B8DA 2MD7B 5DINA 3PHDA 2QICA 2RI7A 2YU4A 2LGVA 1FBVA 5D1MB 5LKZA 2IQJA 4QF2A 4BHWA 4H9DA 2H0DA 1MM2A 4V3LC 1F62A 2KKYA 2KIZA 2C2VS 2E61A 2EODA 2KE1A 3ZPV1 2OWAA 3N9PA 4GNDA 3DDTA 3EB6A 2YUCA 2MA6A 2MD8C 3FAOA 2MA5A 1K2FA 4XI1A 2OXQC 2LDRA 4YATA 1Z2QA 2ECGA 2G45A 1WESA 3L1ZB 4WZ2A 5C11A 2JMIA 1X4IA 2XOZA 2XOCA 3PLWA 4NN2A 2MKEA 2LN0A 2VJEA 3IHPA 4IC3A 2ECVA 4L58A 4AYCA 3LQHA 2YQMA 2C2LA 5SVXA 3O35A 4LJNA 2K16A 5G0FA 1WEPA 1CHCA 2H0DB 5SVIB 3I2DA 3KNVA 3C5KA 3PUQA 3GV4A 2HYED 2ECNA 4YADA 1N87A 1WEQA 2IDAA 3PURA 3RPGB 2CSVA 1WEMA 2FFWA 5D1KB 2KKXA 4O64A 2KR4A 3DQVR 3NG2A 2VNFA 2E6SA 1Z6UA 5LKUA 3HCUA 2L5UA 2MT5A 4LLBA 3QZVA 3L11A 2ECTA 2I50A 2FUUA 3ZYQA 2M13A 2VJEB 1U6GB 1VFYA 5TDRA 2L80A 4YBTA 2K4DA 4AP4A 2CKLA 2DX8A 2YW8A 2P57A 2NAAA 1LDJB 2M6MA 2XOYA 5B78A 1WEVA 1WILA 1JOCA 2K1JA 4A4CA 3HTKC 4AVXA 2FD4A 2LXPC 3JUEA 4F52B 2VPGA 3U5NA 3T7LA 3LQIA 3N9OA 1HYJA 4GNFA 2G6QA 5KH9A 4R8PK 3ZNIA 4YBSA 5H1TA 2Y1NA 2FUIA 1RMDA 2YREA 2KWNA 2PUYA 5TDWA 5KH3A 2VJFA 5H1UA 4N3WA 4V3KC 2MUMA 3RTRB 1VD4A 3GL6A 5I3LA 3MDBC 2D8UA 2YSMA 2MNYA 4A0CD 3U5PA 2AN6A 2CKLB 3VK6A 3KV6A 2ECWA 2F6NA 3N9LA 2M1RA 2KWKA 2ECJA 2KU3A 5LKXA 3MHHA 3LVQE 3M62A 3KDEC 4UP5A 2KGGA 4YAXA 2ECIA 2VPEA 3U5OA 4I7CA 2L0BA 3SOWA 3T9KA 2L7PA 3KV5A 3HCTA 2YYRA 4F1PA 4MVTA 2MNZA 2M3HA 3FJUB 4I7BA 1WIMA 4TKPB 2F6JA 3ZTGA 2B0OE 2VJFB 1X4UA 3N9MA 2CSZA 2LGGA 2VPBA 1WEUA 3Q1DA 2KFTA 2LXHC 5TBNA 4LK9A 2F42A 3M99A 2EXUA 2JM3A 4GB0A 3L1XA 2JRJA 3DPLR 2L75A 5FERA 4FIPA 1HYIA 2G43A 3HCSA 2BAYA 1LDKC
chains in the Genus database with same CATH topology
2VP7A 2XEUA 4IC2A 3SOUA 1G25A 3ASLA 2D8SA 5AIUA 2UZGA 4B86C 5TABA 2QIZA 2RSDA 4B7YC 4FO9A 1T1HA 3N9QA 5G05B 1JM7A 4YABA 2FSAA 4L7XA 2YSJA 3FL2A 2Y1MA 4QF3A 3MHSA 4FK5A 4FJCA 4AYCB 3ZPVE 3EB5A 3O37A 4LADB 2PNXA 2MIQA 4LKAA 4YBMA 1E4UA 2CT2A 2EGPA 3O70A 3O36A 1XWHA 4AUQB 3N9NA 1V87A 2JMDA 4W4UA 2KWOA 2VPDA 1MM3A 4PPEA 4P5OB 4UP0A 3M63A 5KH7A 1JM7B 3SHBA 4WZ3B 1ZBDB 5G04B 2K17A 2KYUA 3O33A 1WFKA 2KGIA 4A4BA 4GNEA 4BBQA 3V43A 4A49A 1WE9A 3LRQA 1IYMA 3O7AA 3RPGC 4I7DA 2LQ6A 3U5MA 5B77A 5D1LB 2XB1A 5H9MA 4N4FA 4X3GA 1VYXA 3T6RA 1FP0A 2YHNA 2L43A 4GNGA 4S3OC 5LCWB 1X4JA 5JG6A 2HDPA 5FB0A 5B76A 3ZVYA 5TRBA 4R2YA 4ZQLA 4ZDTA 4Q6FA 1WEWA 5AITA 4CA1A 5FB1A 1WENA 5EYAF 1WGMA 3O34A 2YQLA 2LV9A 1Z60A 5LKTA 5B79A 2LGKA 2QJ0A 2E6RA 4WA6A 5C13A 2KWJA 5H1VA 2LRIC 2YT5A 3SOXA 3KQIA 1WEOA 4ZUXU 2JMJA 4WZ0A 4C9ZA 3ZVZB 4S3OB 2KREA 5B75A 5DKAA 2LGLA 2M85A 2YURA 4YC9A 2YHOA 5FEYA 1DVPA 1WEEA 2EA6A 5J3XA 2CSYA 2Y43A 2ZETC 3LQJA 4MSXA 1BORA 4UI9B 4CCGX 4PTBA 3C6WA 4R7EA 5B8DA 2MD7B 5DINA 3PHDA 2QICA 2RI7A 2YU4A 2LGVA 1FBVA 5D1MB 5LKZA 4QF2A 4BHWA 2H0DA 1MM2A 4V3LC 1F62A 2KIZA 2C2VS 2EODA 2KE1A 3ZPV1 3N9PA 4GNDA 3EB6A 2YUCA 2MA6A 2MD8C 2MA5A 1K2FA 4XI1A 2OXQC 2LDRA 4YATA 1Z2QA 2ECGA 2G45A 1WESA 3L1ZB 4WZ2A 5C11A 2JMIA 1X4IA 4NN2A 2LN0A 2VJEA 3IHPA 4IC3A 2ECVA 4L58A 4AYCA 3LQHA 2YQMA 2C2LA 3O35A 4LJNA 2K16A 5G0FA 1WEPA 1CHCA 2H0DB 3I2DA 3KNVA 3C5KA 3PUQA 3GV4A 2HYED 4YADA 2ECNA 1N87A 1WEQA 2IDAA 3PURA 3RPGB 1WEMA 5D1KB 4O64A 2KR4A 3DQVR 3NG2A 2VNFA 2E6SA 1Z6UA 5LKUA 3HCUA 2L5UA 2MT5A 4LLBA 3QZVA 3L11A 2ECTA 2I50A 2FUUA 3ZYQA 2VJEB 1U6GB 1VFYA 5TDRA 2L80A 4YBTA 2K4DA 4AP4A 2CKLA 2DX8A 2YW8A 2NAAA 1LDJB 2M6MA 5B78A 1WEVA 1WILA 1JOCA 2K1JA 4A4CA 3HTKC 4AVXA 2LXPC 4F52B 2VPGA 3U5NA 3T7LA 3LQIA 3N9OA 1HYJA 4GNFA 2G6QA 5KH9A 4R8PK 3ZNIA 4YBSA 5H1TA 2Y1NA 2FUIA 1RMDA 2YREA 2KWNA 2PUYA 5TDWA 5KH3A 2VJFA 5H1UA 4N3WA 4V3KC 2MUMA 3RTRB 1VD4A 3GL6A 5I3LA 2YSMA 2MNYA 4A0CD 3U5PA 2AN6A 2CKLB 3VK6A 3KV6A 2ECWA 2F6NA 3N9LA 2M1RA 2KWKA 2ECJA 2KU3A 5LKXA 3MHHA 3M62A 4UP5A 2KGGA 4YAXA 2ECIA 2VPEA 3U5OA 4I7CA 2L0BA 3SOWA 3KV5A 3HCTA 2YYRA 4MVTA 2MNZA 2M3HA 4I7BA 1WIMA 4TKPB 2F6JA 3ZTGA 2VJFB 1X4UA 3N9MA 2CSZA 2LGGA 2VPBA 1WEUA 2KFTA 2LXHC 5TBNA 4LK9A 2F42A 3M99A 4GB0A 3L1XA 2JRJA 3DPLR 2L75A 5FERA 4FIPA 1HYIA 2G43A 3HCSA 2BAYA 1LDKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VP7 A;  2XEU A;  4IC2 A;  3SOU A;  1G25 A;  3ASL A;  2D8S A;  5AIU A;  2UZG A;  4B86 C;  5TAB A;  2QIZ A;  2RSD A;  4B7Y C;  4FO9 A;  1T1H A;  3N9Q A;  5G05 B;  1JM7 A;  4YAB A;  2FSA A;  4L7X A;  2YSJ A;  3FL2 A;  2Y1M A;  4QF3 A;  3MHS A;  4FK5 A;  4FJC A;  4AYC B;  3ZPV E;  3EB5 A;  3O37 A;  4LAD B;  2PNX A;  2MIQ A;  4LKA A;  4YBM A;  1E4U A;  2CT2 A;  2EGP A;  3O70 A;  3O36 A;  1XWH A;  4AUQ B;  3N9N A;  1V87 A;  2JMD A;  4W4U A;  2KWO A;  2VPD A;  1MM3 A;  4PPE A;  4P5O B;  4UP0 A;  3M63 A;  5KH7 A;  1JM7 B;  3SHB A;  4WZ3 B;  1ZBD B;  5G04 B;  2K17 A;  2KYU A;  3O33 A;  1WFK A;  2KGI A;  4A4B A;  4GNE A;  4BBQ A;  3V43 A;  4A49 A;  1WE9 A;  3LRQ A;  1IYM A;  3O7A A;  3RPG C;  4I7D A;  2LQ6 A;  3U5M A;  5B77 A;  5D1L B;  2XB1 A;  5H9M A;  4N4F A;  4X3G A;  1VYX A;  3T6R A;  1FP0 A;  2YHN A;  2L43 A;  4GNG A;  4S3O C;  5LCW B;  1X4J A;  5JG6 A;  2HDP A;  5FB0 A;  5B76 A;  3ZVY A;  5TRB A;  4R2Y A;  4ZQL A;  4ZDT A;  4Q6F A;  1WEW A;  5AIT A;  4CA1 A;  5FB1 A;  1WEN A;  5EYA F;  1WGM A;  3O34 A;  2YQL A;  2LV9 A;  1Z60 A;  5LKT A;  5B79 A;  2LGK A;  2QJ0 A;  2E6R A;  4WA6 A;  5C13 A;  2KWJ A;  5H1V A;  2LRI C;  2YT5 A;  3SOX A;  3KQI A;  1WEO A;  4ZUX U;  2JMJ A;  4WZ0 A;  4C9Z A;  3ZVZ B;  4S3O B;  2KRE A;  5B75 A;  5DKA A;  2LGL A;  2M85 A;  2YUR A;  4YC9 A;  2YHO A;  5FEY A;  1DVP A;  1WEE A;  2EA6 A;  5J3X A;  2CSY A;  2Y43 A;  2ZET C;  3LQJ A;  4MSX A;  1BOR A;  4UI9 B;  4CCG X;  4PTB A;  3C6W A;  4R7E A;  5B8D A;  2MD7 B;  5DIN A;  3PHD A;  2QIC A;  2RI7 A;  2YU4 A;  2LGV A;  1FBV A;  5D1M B;  5LKZ A;  4QF2 A;  4BHW A;  2H0D A;  1MM2 A;  4V3L C;  1F62 A;  2KIZ A;  2C2V S;  2EOD A;  2KE1 A;  3ZPV 1;  3N9P A;  4GND A;  3EB6 A;  2YUC A;  2MA6 A;  2MD8 C;  2MA5 A;  1K2F A;  4XI1 A;  2OXQ C;  2LDR A;  4YAT A;  1Z2Q A;  2ECG A;  2G45 A;  1WES A;  3L1Z B;  4WZ2 A;  5C11 A;  2JMI A;  1X4I A;  4NN2 A;  2LN0 A;  2VJE A;  3IHP A;  4IC3 A;  2ECV A;  4L58 A;  4AYC A;  3LQH A;  2YQM A;  2C2L A;  3O35 A;  4LJN A;  2K16 A;  5G0F A;  1WEP A;  1CHC A;  2H0D B;  3I2D A;  3KNV A;  3C5K A;  3PUQ A;  3GV4 A;  2HYE D;  4YAD A;  2ECN A;  1N87 A;  1WEQ A;  2IDA A;  3PUR A;  3RPG B;  1WEM A;  5D1K B;  4O64 A;  2KR4 A;  3DQV R;  3NG2 A;  2VNF A;  2E6S A;  1Z6U A;  5LKU A;  3HCU A;  2L5U A;  2MT5 A;  4LLB A;  3QZV A;  3L11 A;  2ECT A;  2I50 A;  2FUU A;  3ZYQ A;  2VJE B;  1U6G B;  1VFY A;  5TDR A;  2L80 A;  4YBT A;  2K4D A;  4AP4 A;  2CKL A;  2DX8 A;  2YW8 A;  2NAA A;  1LDJ B;  2M6M A;  5B78 A;  1WEV A;  1WIL A;  1JOC A;  2K1J A;  4A4C A;  3HTK C;  4AVX A;  2LXP C;  4F52 B;  2VPG A;  3U5N A;  3T7L A;  3LQI A;  3N9O A;  1HYJ A;  4GNF A;  2G6Q A;  5KH9 A;  4R8P K;  3ZNI A;  4YBS A;  5H1T A;  2Y1N A;  2FUI A;  1RMD A;  2YRE A;  2KWN A;  2PUY A;  5TDW A;  5KH3 A;  2VJF A;  5H1U A;  4N3W A;  4V3K C;  2MUM A;  3RTR B;  1VD4 A;  3GL6 A;  5I3L A;  2YSM A;  2MNY A;  4A0C D;  3U5P A;  2AN6 A;  2CKL B;  3VK6 A;  3KV6 A;  2ECW A;  2F6N A;  3N9L A;  2M1R A;  2KWK A;  2ECJ A;  2KU3 A;  5LKX A;  3MHH A;  3M62 A;  4UP5 A;  2KGG A;  4YAX A;  2ECI A;  2VPE A;  3U5O A;  4I7C A;  2L0B A;  3SOW A;  3KV5 A;  3HCT A;  2YYR A;  4MVT A;  2MNZ A;  2M3H A;  4I7B A;  1WIM A;  4TKP B;  2F6J A;  3ZTG A;  2VJF B;  1X4U A;  3N9M A;  2CSZ A;  2LGG A;  2VPB A;  1WEU A;  2KFT A;  2LXH C;  5TBN A;  4LK9 A;  2F42 A;  3M99 A;  4GB0 A;  3L1X A;  2JRJ A;  3DPL R;  2L75 A;  5FER A;  4FIP A;  1HYI A;  2G43 A;  3HCS A;  2BAY A;  1LDK C; 
#chains in the Genus database with same CATH topology
 4OGE A;  2VP7 A;  2XEU A;  4IC2 A;  3SOU A;  1G25 A;  3ASL A;  2D8S A;  5AIU A;  2JUN A;  2UZG A;  3LVR E;  4B86 C;  5TAB A;  2QIZ A;  2RSD A;  4B7Y C;  4FO9 A;  1T1H A;  3N9Q A;  5G05 B;  1JM7 A;  4YAB A;  2FSA A;  4L7X A;  2YSJ A;  3FL2 A;  2Y1M A;  4QF3 A;  3MHS A;  4FK5 A;  4FJC A;  4AYC B;  3ZPV E;  3EB5 A;  3O37 A;  4LAD B;  2PNX A;  2MIQ A;  4Z0O A;  3SUB A;  3FM8 C;  4LKA A;  4YBM A;  1E4U A;  2CT2 A;  2EGP A;  3O70 A;  3O36 A;  3FEH A;  1XWH A;  4AUQ B;  3N9N A;  2RR4 A;  5K3Q A;  1V87 A;  3LJU X;  2JMD A;  4W4U A;  2KWO A;  2VPD A;  1MM3 A;  4PPE A;  4P5O B;  3E2D A;  5SVY A;  4UP0 A;  3M63 A;  5KH7 A;  1JM7 B;  3SHB A;  4WZ3 B;  2DJA A;  2CRW A;  3O47 A;  1ZBD B;  5G04 B;  2K17 A;  2KYU A;  3O33 A;  3LDY A;  1WFK A;  2KGI A;  1DCQ A;  4A4B A;  4GNE A;  2YVR A;  4BBQ A;  3V43 A;  4A49 A;  1WE9 A;  3LRQ A;  1IYM A;  4Z0R A;  3O7A A;  3RPG C;  3FAN A;  4I7D A;  2LQ6 A;  2CON A;  3U5M A;  5B77 A;  4O62 A;  5D1L B;  2XB1 A;  5H9M A;  5SVI A;  4N4F A;  3M7K A;  4X3G A;  1VYX A;  3T6R A;  1FP0 A;  2YHN A;  2L43 A;  4GNG A;  4S3O C;  5LCW B;  1X4J A;  5JG6 A;  2HDP A;  5FB0 A;  2LAU A;  5B76 A;  3ZVY A;  5TRB A;  4R2Y A;  4ZQL A;  4ZDT A;  4Q6F A;  1WEW A;  5AIT A;  4CA1 A;  5FB1 A;  3DWD A;  2EGM A;  1WEN A;  3H7H A;  5EYA F;  1WGM A;  3O34 A;  2YQL A;  2LV9 A;  1Z60 A;  5LKT A;  5B79 A;  2LGK A;  2QJ0 A;  2E6R A;  4WA6 A;  5C13 A;  2KWJ A;  5H1V A;  2LRI C;  2YT5 A;  3SOX A;  3KQI A;  2DSM A;  1WEO A;  4ZUX U;  2JMJ A;  2CRR A;  4WZ0 A;  4C9Z A;  2XP0 A;  3ZVZ B;  4S3O B;  2KRE A;  5B75 A;  2LGL A;  5DKA A;  4OGC A;  2M85 A;  2YUR A;  4YC9 A;  2YHO A;  1MBM A;  5FEY A;  1DVP A;  1WEE A;  2EA6 A;  4QQ4 A;  5J3X A;  2CSY A;  2Y43 A;  2ZET C;  3LQJ A;  4MSX A;  1BOR A;  4UI9 B;  4CCG X;  4PTB A;  3C6W A;  4R7E A;  5B8D A;  2MD7 B;  5DIN A;  3PHD A;  2QIC A;  2RI7 A;  2YU4 A;  2LGV A;  1FBV A;  5D1M B;  5LKZ A;  2IQJ A;  4QF2 A;  4BHW A;  4H9D A;  2H0D A;  1MM2 A;  4V3L C;  1F62 A;  2KKY A;  2KIZ A;  2C2V S;  2E61 A;  2EOD A;  2KE1 A;  3ZPV 1;  2OWA A;  3N9P A;  4GND A;  3DDT A;  3EB6 A;  2YUC A;  2MA6 A;  2MD8 C;  3FAO A;  2MA5 A;  1K2F A;  4XI1 A;  2OXQ C;  2LDR A;  4YAT A;  1Z2Q A;  2ECG A;  2G45 A;  1WES A;  3L1Z B;  4WZ2 A;  5C11 A;  2JMI A;  1X4I A;  2XOZ A;  2XOC A;  3PLW A;  4NN2 A;  2MKE A;  2LN0 A;  2VJE A;  3IHP A;  4IC3 A;  2ECV A;  4L58 A;  4AYC A;  3LQH A;  2YQM A;  2C2L A;  5SVX A;  3O35 A;  4LJN A;  2K16 A;  5G0F A;  1WEP A;  1CHC A;  2H0D B;  5SVI B;  3I2D A;  3KNV A;  3C5K A;  3PUQ A;  3GV4 A;  2HYE D;  2ECN A;  4YAD A;  1N87 A;  1WEQ A;  2IDA A;  3PUR A;  3RPG B;  2CSV A;  1WEM A;  2FFW A;  5D1K B;  2KKX A;  4O64 A;  2KR4 A;  3DQV R;  3NG2 A;  2VNF A;  2E6S A;  1Z6U A;  5LKU A;  3HCU A;  2L5U A;  2MT5 A;  4LLB A;  3QZV A;  3L11 A;  2ECT A;  2I50 A;  2FUU A;  3ZYQ A;  2M13 A;  2VJE B;  1U6G B;  1VFY A;  5TDR A;  2L80 A;  4YBT A;  2K4D A;  4AP4 A;  2CKL A;  2DX8 A;  2YW8 A;  2P57 A;  2NAA A;  1LDJ B;  2M6M A;  2XOY A;  5B78 A;  1WEV A;  1WIL A;  1JOC A;  2K1J A;  4A4C A;  3HTK C;  4AVX A;  2FD4 A;  2LXP C;  3JUE A;  4F52 B;  2VPG A;  3U5N A;  3T7L A;  3LQI A;  3N9O A;  1HYJ A;  4GNF A;  2G6Q A;  5KH9 A;  4R8P K;  3ZNI A;  4YBS A;  5H1T A;  2Y1N A;  2FUI A;  1RMD A;  2YRE A;  2KWN A;  2PUY A;  5TDW A;  5KH3 A;  2VJF A;  5H1U A;  4N3W A;  4V3K C;  2MUM A;  3RTR B;  1VD4 A;  3GL6 A;  5I3L A;  3MDB C;  2D8U A;  2YSM A;  2MNY A;  4A0C D;  3U5P A;  2AN6 A;  2CKL B;  3VK6 A;  3KV6 A;  2ECW A;  2F6N A;  3N9L A;  2M1R A;  2KWK A;  2ECJ A;  2KU3 A;  5LKX A;  3MHH A;  3LVQ E;  3M62 A;  3KDE C;  4UP5 A;  2KGG A;  4YAX A;  2ECI A;  2VPE A;  3U5O A;  4I7C A;  2L0B A;  3SOW A;  3T9K A;  2L7P A;  3KV5 A;  3HCT A;  2YYR A;  4F1P A;  4MVT A;  2MNZ A;  2M3H A;  3FJU B;  4I7B A;  1WIM A;  4TKP B;  2F6J A;  3ZTG A;  2B0O E;  2VJF B;  1X4U A;  3N9M A;  2CSZ A;  2LGG A;  2VPB A;  1WEU A;  3Q1D A;  2KFT A;  2LXH C;  5TBN A;  4LK9 A;  2F42 A;  3M99 A;  2EXU A;  2JM3 A;  4GB0 A;  3L1X A;  2JRJ A;  3DPL R;  2L75 A;  5FER A;  4FIP A;  1HYI A;  2G43 A;  3HCS A;  2BAY A;  1LDK C; 
#chains in the Genus database with same CATH homology
 2VP7 A;  2XEU A;  4IC2 A;  3SOU A;  1G25 A;  3ASL A;  2D8S A;  5AIU A;  2UZG A;  4B86 C;  5TAB A;  2QIZ A;  2RSD A;  4B7Y C;  4FO9 A;  1T1H A;  3N9Q A;  5G05 B;  1JM7 A;  4YAB A;  2FSA A;  4L7X A;  2YSJ A;  3FL2 A;  2Y1M A;  4QF3 A;  3MHS A;  4FK5 A;  4FJC A;  4AYC B;  3ZPV E;  3EB5 A;  3O37 A;  4LAD B;  2PNX A;  2MIQ A;  4LKA A;  4YBM A;  1E4U A;  2CT2 A;  2EGP A;  3O70 A;  3O36 A;  1XWH A;  4AUQ B;  3N9N A;  1V87 A;  2JMD A;  4W4U A;  2KWO A;  2VPD A;  1MM3 A;  4PPE A;  4P5O B;  4UP0 A;  3M63 A;  5KH7 A;  1JM7 B;  3SHB A;  4WZ3 B;  1ZBD B;  5G04 B;  2K17 A;  2KYU A;  3O33 A;  1WFK A;  2KGI A;  4A4B A;  4GNE A;  4BBQ A;  3V43 A;  4A49 A;  1WE9 A;  3LRQ A;  1IYM A;  3O7A A;  3RPG C;  4I7D A;  2LQ6 A;  3U5M A;  5B77 A;  5D1L B;  2XB1 A;  5H9M A;  4N4F A;  4X3G A;  1VYX A;  3T6R A;  1FP0 A;  2YHN A;  2L43 A;  4GNG A;  4S3O C;  5LCW B;  1X4J A;  5JG6 A;  2HDP A;  5FB0 A;  5B76 A;  3ZVY A;  5TRB A;  4R2Y A;  4ZQL A;  4ZDT A;  4Q6F A;  1WEW A;  5AIT A;  4CA1 A;  5FB1 A;  1WEN A;  5EYA F;  1WGM A;  3O34 A;  2YQL A;  2LV9 A;  1Z60 A;  5LKT A;  5B79 A;  2LGK A;  2QJ0 A;  2E6R A;  4WA6 A;  5C13 A;  2KWJ A;  5H1V A;  2LRI C;  2YT5 A;  3SOX A;  3KQI A;  1WEO A;  4ZUX U;  2JMJ A;  4WZ0 A;  4C9Z A;  3ZVZ B;  4S3O B;  2KRE A;  5B75 A;  5DKA A;  2LGL A;  2M85 A;  2YUR A;  4YC9 A;  2YHO A;  5FEY A;  1DVP A;  1WEE A;  2EA6 A;  5J3X A;  2CSY A;  2Y43 A;  2ZET C;  3LQJ A;  4MSX A;  1BOR A;  4UI9 B;  4CCG X;  4PTB A;  3C6W A;  4R7E A;  5B8D A;  2MD7 B;  5DIN A;  3PHD A;  2QIC A;  2RI7 A;  2YU4 A;  2LGV A;  1FBV A;  5D1M B;  5LKZ A;  4QF2 A;  4BHW A;  2H0D A;  1MM2 A;  4V3L C;  1F62 A;  2KIZ A;  2C2V S;  2EOD A;  2KE1 A;  3ZPV 1;  3N9P A;  4GND A;  3EB6 A;  2YUC A;  2MA6 A;  2MD8 C;  2MA5 A;  1K2F A;  4XI1 A;  2OXQ C;  2LDR A;  4YAT A;  1Z2Q A;  2ECG A;  2G45 A;  1WES A;  3L1Z B;  4WZ2 A;  5C11 A;  2JMI A;  1X4I A;  4NN2 A;  2LN0 A;  2VJE A;  3IHP A;  4IC3 A;  2ECV A;  4L58 A;  4AYC A;  3LQH A;  2YQM A;  2C2L A;  3O35 A;  4LJN A;  2K16 A;  5G0F A;  1WEP A;  1CHC A;  2H0D B;  3I2D A;  3KNV A;  3C5K A;  3PUQ A;  3GV4 A;  2HYE D;  4YAD A;  2ECN A;  1N87 A;  1WEQ A;  2IDA A;  3PUR A;  3RPG B;  1WEM A;  5D1K B;  4O64 A;  2KR4 A;  3DQV R;  3NG2 A;  2VNF A;  2E6S A;  1Z6U A;  5LKU A;  3HCU A;  2L5U A;  2MT5 A;  4LLB A;  3QZV A;  3L11 A;  2ECT A;  2I50 A;  2FUU A;  3ZYQ A;  2VJE B;  1U6G B;  1VFY A;  5TDR A;  2L80 A;  4YBT A;  2K4D A;  4AP4 A;  2CKL A;  2DX8 A;  2YW8 A;  2NAA A;  1LDJ B;  2M6M A;  5B78 A;  1WEV A;  1WIL A;  1JOC A;  2K1J A;  4A4C A;  3HTK C;  4AVX A;  2LXP C;  4F52 B;  2VPG A;  3U5N A;  3T7L A;  3LQI A;  3N9O A;  1HYJ A;  4GNF A;  2G6Q A;  5KH9 A;  4R8P K;  3ZNI A;  4YBS A;  5H1T A;  2Y1N A;  2FUI A;  1RMD A;  2YRE A;  2KWN A;  2PUY A;  5TDW A;  5KH3 A;  2VJF A;  5H1U A;  4N3W A;  4V3K C;  2MUM A;  3RTR B;  1VD4 A;  3GL6 A;  5I3L A;  2YSM A;  2MNY A;  4A0C D;  3U5P A;  2AN6 A;  2CKL B;  3VK6 A;  3KV6 A;  2ECW A;  2F6N A;  3N9L A;  2M1R A;  2KWK A;  2ECJ A;  2KU3 A;  5LKX A;  3MHH A;  3M62 A;  4UP5 A;  2KGG A;  4YAX A;  2ECI A;  2VPE A;  3U5O A;  4I7C A;  2L0B A;  3SOW A;  3KV5 A;  3HCT A;  2YYR A;  4MVT A;  2MNZ A;  2M3H A;  4I7B A;  1WIM A;  4TKP B;  2F6J A;  3ZTG A;  2VJF B;  1X4U A;  3N9M A;  2CSZ A;  2LGG A;  2VPB A;  1WEU A;  2KFT A;  2LXH C;  5TBN A;  4LK9 A;  2F42 A;  3M99 A;  4GB0 A;  3L1X A;  2JRJ A;  3DPL R;  2L75 A;  5FER A;  4FIP A;  1HYI A;  2G43 A;  3HCS A;  2BAY A;  1LDK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...