2RSDA

Solution structure of the plant homeodomain (phd) of the e3 sumo ligase siz1 from rice
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
b'GSDSFQPEAKVRCICSSTMVNDSMIQCEDQRCQVWQHLNCVLIPDKPGESAEVPPVFYCELCRLSRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 SUMO-protein ligase SIZ1
publication title PHD finger of the SUMO ligase Siz/PIAS family in rice reveals specific binding for methylated histone H3 at lysine 4 and arginine 2
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Ligase
total genus 9
structure length 68
sequence length 68
ec nomenclature ec 6.3.2.-:
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2rsdA00
2K16A 2VPEA 1CHCA 2E6RA 3N9OA 4GB0A 1HYJA 4V3LC 3O37A 2LN0A 4AYCA 5JG6A 4YBMA 4CCGX 2LGGA 5C13A 2VNFA 3U5PA 1ZBDB 2KR4A 2MT5A 3KQIA 4GNDA 1X4UA 3PURA 1Z2QA 3EB6A 2LRIC 5G0FA 4WA6A 4N4FA 2MIQA 1JOCA 4NN2A 2YU4A 3N9NA 1WESA 4L7XA 2M3HA 1WENA 5I3LA 2JRJA 1WEPA 1U6GB 1WEOA 1F62A 3GV4A 3ZPVE 5LCWB 4V3KC 5TBNA 2M1RA 2VJEB 3IHPA 2D8SA 4LK9A 2IDAA 1HYIA 3ASLA 3ZYQA 1MM3A 2C2LA 1MM2A 1X4IA 4R7EA 3LQJA 2C2VS 4L58A 4X3GA 5B75A 1WIMA 3KV5A 4FIPA 4LADB 5DINA 4AVXA 3ZNIA 1RMDA 4S3OC 3HTKC 5G04B 2ECGA 1JM7B 4FO9A 4FJCA 4YBTA 4QF3A 4PTBA 3ZTGA 3O7AA 4XI1A 5B78A 2KWOA 1XWHA 5D1KB 2F6JA 2EODA 4PPEA 1WEEA 2CSZA 2ECNA 2F42A 4I7BA 4YAXA 2ECWA 1VFYA 2VJFB 3O70A 2YURA 4GNEA 5C11A 5KH7A 3SOWA 3ZPV1 2YUCA 2Y1NA 3M99A 2VPGA 4I7DA 3C5KA 1E4UA 5KH3A 4Q6FA 5FB1A 3T6RA 5B8DA 2M85A 2ECVA 3M62A 4R8PK 2YHNA 1Z6UA 2H0DA 2NAAA 2RSDA 2PNXA 5FB0A 2LGVA 2E6SA 2G6QA 3DPLR 3HCTA 2Y43A 2PUYA 1WFKA 1WEQA 3LQIA 3U5OA 2KWKA 2L43A 2KU3A 3PHDA 4AYCB 2G43A 5KH9A 2YSMA 1VD4A 5B76A 5LKTA 2YW8A 2MA6A 2QICA 2LGKA 2CKLA 4QF2A 5TDRA 2M6MA 2K1JA 2JMJA 3FL2A 4AP4A 1X4JA 4A0CD 5TABA 5TRBA 3KV6A 4IC2A 4W4UA 5H1UA 3HCSA 2DX8A 5LKXA 5TDWA 3LRQA 4AUQB 4N3WA 2LXPC 2XB1A 2YYRA 2YT5A 3ZVYA 2YSJA 2QIZA 3U5MA 3MHHA 2MNYA 1K2FA 3KNVA 3SOUA 4MSXA 2KWJA 4FK5A 3HCUA 4GNGA 3T7LA 1N87A 2FUUA 2KE1A 4GNFA 2HYED 4LLBA 5DKAA 3O33A 3N9PA 2KYUA 2K4DA 2CT2A 5G05B 3PUQA 2KREA 5H1VA 2FUIA 2L5UA 1Z60A 3V43A 3VK6A 2LQ6A 2UZGA 3QZVA 2VP7A 2KFTA 1LDJB 3LQHA 3N9MA 3NG2A 1WEVA 2MD8C 3MHSA 3N9LA 4YATA 2G45A 4C9ZA 5B77A 4LKAA 5FEYA 2KIZA 3ZVZB 5EYAF 2QJ0A 2KWNA 1T1HA 3L11A 4A4BA 4P5OB 1WILA 2LGLA 2AN6A 2HDPA 2LDRA 2MUMA 5AITA 3RTRB 3M63A 4YABA 2ECIA 1BORA 2BAYA 2XEUA 3I2DA 2H0DB 2YHOA 5LKZA 4IC3A 5H9MA 2VPBA 2K17A 4WZ2A 2EGPA 2KGGA 4CA1A 2KGIA 2ZETC 5D1LB 1WEWA 4YBSA 2VJEA 5D1MB 4ZDTA 2YQLA 3GL6A 3N9QA 1VYXA 1G25A 2CKLB 4F52B 5FERA 3L1XA 4MVTA 1IYMA 2I50A 4YC9A 4BBQA 3RPGC 4TKPB 4WZ0A 2CSYA 2LXHC 2OXQC 5J3XA 1JM7A 2L75A 4ZQLA 3SHBA 4WZ3B 3SOXA 2YQMA 1WEUA 2MNZA 3O35A 2MD7B 2EA6A 1WGMA 3O36A 1LDKC 2LV9A 3C6WA 2YREA 4A4CA 2L80A 1WE9A 2L0BA 4R2YA 3RPGB 2VJFA 1V87A 2MA5A 2F6NA 5AIUA 4B7YC 4O64A 4YADA 3DQVR 1FP0A 2JMDA 4LJNA 4B86C 2RI7A 2VPDA 4UP5A 2Y1MA 4I7CA 2JMIA 3O34A 4A49A 2ECJA 4BHWA 1WEMA 3U5NA 2ECTA 4ZUXU 1FBVA 5H1TA 4UP0A 2FSAA 4UI9B 3EB5A 5B79A 3L1ZB 4S3OB 1DVPA 5LKUA
chains in the Genus database with same CATH superfamily
2K16A 5K3QA 2VPEA 1CHCA 2E6RA 3N9OA 4GB0A 3H7HA 3LVRE 1HYJA 4V3LC 3O37A 2LN0A 4AYCA 5JG6A 4YBMA 4CCGX 2LGGA 5C13A 2VNFA 2EXUA 2M13A 4Z0RA 3U5PA 1ZBDB 2KR4A 2MT5A 3KQIA 4GNDA 1X4UA 3PURA 1Z2QA 3EB6A 2LRIC 5G0FA 4WA6A 4N4FA 2MIQA 1JOCA 4NN2A 2YU4A 3N9NA 1WESA 4H9DA 3SUBA 4L7XA 2M3HA 1WENA 2DSMA 5I3LA 2JRJA 1WEPA 1U6GB 1WEOA 1F62A 2EGMA 3GV4A 3Q1DA 3ZPVE 5LCWB 2XOYA 4V3KC 5TBNA 2M1RA 2VJEB 3IHPA 2D8SA 2XOZA 4LK9A 2RR4A 2IDAA 1HYIA 3ASLA 3ZYQA 1MM3A 2C2LA 1MM2A 1X4IA 2P57A 5SVYA 4R7EA 3FAOA 3LQJA 2C2VS 2E61A 4L58A 4X3GA 2L7PA 5B75A 2OWAA 1WIMA 3PLWA 3KV5A 4FIPA 4LADB 2D8UA 5DINA 4AVXA 3ZNIA 1RMDA 4S3OC 3HTKC 1DCQA 5G04B 2ECGA 1JM7B 3MDBC 4FO9A 3LDYA 4FJCA 2CRWA 4YBTA 4QF3A 4PTBA 3ZTGA 3O7AA 4XI1A 5B78A 2KWOA 1XWHA 5D1KB 2F6JA 2EODA 4PPEA 1WEEA 2CSZA 2ECNA 2F42A 2JUNA 3M7KA 4I7BA 4YAXA 2ECWA 1VFYA 3FEHA 2VJFB 3O70A 2YURA 4GNEA 5C11A 5KH7A 3SOWA 2CSVA 3ZPV1 4QQ4A 2YUCA 2Y1NA 3M99A 2VPGA 4I7DA 3C5KA 1E4UA 5KH3A 4Q6FA 5FB1A 3T6RA 5B8DA 2M85A 2ECVA 3M62A 4R8PK 2YHNA 2JM3A 1Z6UA 2H0DA 2NAAA 2RSDA 2PNXA 5FB0A 2LGVA 2E6SA 2G6QA 3DPLR 3HCTA 2Y43A 2PUYA 1WFKA 3DDTA 1WEQA 3LQIA 3U5OA 3E2DA 2KWKA 2L43A 2KU3A 3PHDA 4AYCB 2G43A 5KH9A 2YSMA 1VD4A 5B76A 5LKTA 2YW8A 3DWDA 2MA6A 2QICA 2MKEA 2LGKA 2CKLA 4QF2A 5TDRA 2M6MA 2K1JA 3LJUX 2JMJA 3FL2A 4AP4A 1X4JA 2FFWA 4A0CD 5TABA 5TRBA 3KV6A 4IC2A 4W4UA 5H1UA 3HCSA 2DX8A 5LKXA 5TDWA 3LRQA 4AUQB 4N3WA 2LXPC 2XB1A 2YYRA 2YT5A 3ZVYA 2YSJA 2QIZA 3U5MA 3MHHA 1MBMA 2MNYA 1K2FA 3KNVA 3SOUA 4MSXA 2CONA 2KWJA 4FK5A 3HCUA 4GNGA 3T7LA 1N87A 2FUUA 3FM8C 5SVIA 3LVQE 2KE1A 4GNFA 2HYED 4LLBA 5DKAA 3O33A 3N9PA 2KYUA 2K4DA 2CT2A 2DJAA 5G05B 3PUQA 2KREA 2YVRA 5H1VA 2FUIA 4Z0OA 2L5UA 1Z60A 3V43A 3VK6A 2LQ6A 2UZGA 3QZVA 2VP7A 2KFTA 1LDJB 3LQHA 3N9MA 3NG2A 3KDEC 1WEVA 2MD8C 3MHSA 3N9LA 4YATA 2XOCA 2G45A 4C9ZA 5B77A 4LKAA 5FEYA 2KIZA 3ZVZB 5EYAF 2QJ0A 2KWNA 1T1HA 3L11A 4A4BA 4P5OB 3FJUB 1WILA 2LGLA 2AN6A 2HDPA 2LDRA 2MUMA 5AITA 3RTRB 3M63A 4OGEA 4YABA 2ECIA 1BORA 2BAYA 2XEUA 3I2DA 2H0DB 2FD4A 4OGCA 2YHOA 5LKZA 4IC3A 5H9MA 2VPBA 2K17A 4WZ2A 2LAUA 2EGPA 4F1PA 2KGGA 4CA1A 2KGIA 2ZETC 5D1LB 1WEWA 4YBSA 2VJEA 5D1MB 2IQJA 4ZDTA 2YQLA 3GL6A 4O62A 3N9QA 1VYXA 5SVXA 1G25A 2CKLB 4F52B 5FERA 3L1XA 4MVTA 1IYMA 2I50A 4YC9A 4BBQA 3RPGC 4TKPB 2CRRA 4WZ0A 2CSYA 2LXHC 2OXQC 5J3XA 1JM7A 2L75A 4ZQLA 3SHBA 4WZ3B 3SOXA 3T9KA 3O47A 2YQMA 1WEUA 2MNZA 3O35A 2MD7B 2EA6A 1WGMA 3O36A 2KKYA 1LDKC 2LV9A 3C6WA 2B0OE 2YREA 4A4CA 2L80A 1WE9A 2L0BA 4R2YA 3RPGB 2VJFA 1V87A 2MA5A 2F6NA 5AIUA 4B7YC 4O64A 3DQVR 4YADA 1FP0A 2JMDA 4LJNA 5SVIB 4B86C 2RI7A 2VPDA 4UP5A 2Y1MA 4I7CA 2KKXA 2JMIA 3O34A 3JUEA 4A49A 2ECJA 4BHWA 1WEMA 2XP0A 3U5NA 2ECTA 4ZUXU 1FBVA 5H1TA 4UP0A 2FSAA 4UI9B 3EB5A 5B79A 3L1ZB 4S3OB 3FANA 1DVPA 5LKUA
chains in the Genus database with same CATH topology
2K16A 2VPEA 1CHCA 2E6RA 3N9OA 4GB0A 1HYJA 4V3LC 3O37A 2LN0A 4AYCA 5JG6A 4YBMA 4CCGX 2LGGA 5C13A 2VNFA 3U5PA 1ZBDB 2KR4A 2MT5A 3KQIA 4GNDA 1X4UA 3PURA 1Z2QA 3EB6A 2LRIC 5G0FA 4WA6A 4N4FA 2MIQA 1JOCA 4NN2A 2YU4A 3N9NA 1WESA 4L7XA 2M3HA 1WENA 5I3LA 2JRJA 1WEPA 1U6GB 1WEOA 1F62A 3GV4A 3ZPVE 5LCWB 4V3KC 5TBNA 2M1RA 2VJEB 3IHPA 2D8SA 4LK9A 2IDAA 1HYIA 3ASLA 3ZYQA 1MM3A 2C2LA 1MM2A 1X4IA 4R7EA 3LQJA 2C2VS 4L58A 4X3GA 5B75A 1WIMA 3KV5A 4FIPA 4LADB 5DINA 4AVXA 3ZNIA 1RMDA 4S3OC 3HTKC 5G04B 2ECGA 1JM7B 4FO9A 4FJCA 4YBTA 4QF3A 4PTBA 3ZTGA 3O7AA 4XI1A 5B78A 2KWOA 1XWHA 5D1KB 2F6JA 2EODA 4PPEA 1WEEA 2CSZA 2ECNA 2F42A 4I7BA 4YAXA 2ECWA 1VFYA 2VJFB 3O70A 2YURA 4GNEA 5C11A 5KH7A 3SOWA 3ZPV1 2YUCA 2Y1NA 3M99A 2VPGA 4I7DA 3C5KA 1E4UA 5KH3A 4Q6FA 5FB1A 3T6RA 5B8DA 2M85A 2ECVA 3M62A 4R8PK 2YHNA 1Z6UA 2H0DA 2NAAA 2RSDA 2PNXA 5FB0A 2LGVA 2E6SA 2G6QA 3DPLR 3HCTA 2Y43A 2PUYA 1WFKA 1WEQA 3LQIA 3U5OA 2KWKA 2L43A 2KU3A 3PHDA 4AYCB 2G43A 5KH9A 2YSMA 1VD4A 5B76A 5LKTA 2YW8A 2MA6A 2QICA 2LGKA 2CKLA 4QF2A 5TDRA 2M6MA 2K1JA 2JMJA 3FL2A 4AP4A 1X4JA 4A0CD 5TABA 5TRBA 3KV6A 4IC2A 4W4UA 5H1UA 3HCSA 2DX8A 5LKXA 5TDWA 3LRQA 4AUQB 4N3WA 2LXPC 2XB1A 2YYRA 2YT5A 3ZVYA 2YSJA 2QIZA 3U5MA 3MHHA 2MNYA 1K2FA 3KNVA 3SOUA 4MSXA 2KWJA 4FK5A 3HCUA 4GNGA 3T7LA 1N87A 2FUUA 2KE1A 4GNFA 2HYED 4LLBA 5DKAA 3O33A 3N9PA 2KYUA 2K4DA 2CT2A 5G05B 3PUQA 2KREA 5H1VA 2FUIA 2L5UA 1Z60A 3V43A 3VK6A 2LQ6A 2UZGA 3QZVA 2VP7A 2KFTA 1LDJB 3LQHA 3N9MA 3NG2A 1WEVA 2MD8C 3MHSA 3N9LA 4YATA 2G45A 4C9ZA 5B77A 4LKAA 5FEYA 2KIZA 3ZVZB 5EYAF 2QJ0A 2KWNA 1T1HA 3L11A 4A4BA 4P5OB 1WILA 2LGLA 2AN6A 2HDPA 2LDRA 2MUMA 5AITA 3RTRB 3M63A 4YABA 2ECIA 1BORA 2BAYA 2XEUA 3I2DA 2H0DB 2YHOA 5LKZA 4IC3A 5H9MA 2VPBA 2K17A 4WZ2A 2EGPA 2KGGA 4CA1A 2KGIA 2ZETC 5D1LB 1WEWA 4YBSA 2VJEA 5D1MB 4ZDTA 2YQLA 3GL6A 3N9QA 1VYXA 1G25A 2CKLB 4F52B 5FERA 3L1XA 4MVTA 1IYMA 2I50A 4YC9A 4BBQA 3RPGC 4TKPB 4WZ0A 2CSYA 2LXHC 2OXQC 5J3XA 1JM7A 2L75A 4ZQLA 3SHBA 4WZ3B 3SOXA 2YQMA 1WEUA 2MNZA 3O35A 2MD7B 2EA6A 1WGMA 3O36A 1LDKC 2LV9A 3C6WA 2YREA 4A4CA 2L80A 1WE9A 2L0BA 4R2YA 3RPGB 2VJFA 1V87A 2MA5A 2F6NA 5AIUA 4B7YC 4O64A 4YADA 3DQVR 1FP0A 2JMDA 4LJNA 4B86C 2RI7A 2VPDA 4UP5A 2Y1MA 4I7CA 2JMIA 3O34A 4A49A 2ECJA 4BHWA 1WEMA 3U5NA 2ECTA 4ZUXU 1FBVA 5H1TA 4UP0A 2FSAA 4UI9B 3EB5A 5B79A 3L1ZB 4S3OB 1DVPA 5LKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K16 A;  2VPE A;  1CHC A;  2E6R A;  3N9O A;  4GB0 A;  1HYJ A;  4V3L C;  3O37 A;  2LN0 A;  4AYC A;  5JG6 A;  4YBM A;  4CCG X;  2LGG A;  5C13 A;  2VNF A;  3U5P A;  1ZBD B;  2KR4 A;  2MT5 A;  3KQI A;  4GND A;  1X4U A;  3PUR A;  1Z2Q A;  3EB6 A;  2LRI C;  5G0F A;  4WA6 A;  4N4F A;  2MIQ A;  1JOC A;  4NN2 A;  2YU4 A;  3N9N A;  1WES A;  4L7X A;  2M3H A;  1WEN A;  5I3L A;  2JRJ A;  1WEP A;  1U6G B;  1WEO A;  1F62 A;  3GV4 A;  3ZPV E;  5LCW B;  4V3K C;  5TBN A;  2M1R A;  2VJE B;  3IHP A;  2D8S A;  4LK9 A;  2IDA A;  1HYI A;  3ASL A;  3ZYQ A;  1MM3 A;  2C2L A;  1MM2 A;  1X4I A;  4R7E A;  3LQJ A;  2C2V S;  4L58 A;  4X3G A;  5B75 A;  1WIM A;  3KV5 A;  4FIP A;  4LAD B;  5DIN A;  4AVX A;  3ZNI A;  1RMD A;  4S3O C;  3HTK C;  5G04 B;  2ECG A;  1JM7 B;  4FO9 A;  4FJC A;  4YBT A;  4QF3 A;  4PTB A;  3ZTG A;  3O7A A;  4XI1 A;  5B78 A;  2KWO A;  1XWH A;  5D1K B;  2F6J A;  2EOD A;  4PPE A;  1WEE A;  2CSZ A;  2ECN A;  2F42 A;  4I7B A;  4YAX A;  2ECW A;  1VFY A;  2VJF B;  3O70 A;  2YUR A;  4GNE A;  5C11 A;  5KH7 A;  3SOW A;  3ZPV 1;  2YUC A;  2Y1N A;  3M99 A;  2VPG A;  4I7D A;  3C5K A;  1E4U A;  5KH3 A;  4Q6F A;  5FB1 A;  3T6R A;  5B8D A;  2M85 A;  2ECV A;  3M62 A;  4R8P K;  2YHN A;  1Z6U A;  2H0D A;  2NAA A;  2RSD A;  2PNX A;  5FB0 A;  2LGV A;  2E6S A;  2G6Q A;  3DPL R;  3HCT A;  2Y43 A;  2PUY A;  1WFK A;  1WEQ A;  3LQI A;  3U5O A;  2KWK A;  2L43 A;  2KU3 A;  3PHD A;  4AYC B;  2G43 A;  5KH9 A;  2YSM A;  1VD4 A;  5B76 A;  5LKT A;  2YW8 A;  2MA6 A;  2QIC A;  2LGK A;  2CKL A;  4QF2 A;  5TDR A;  2M6M A;  2K1J A;  2JMJ A;  3FL2 A;  4AP4 A;  1X4J A;  4A0C D;  5TAB A;  5TRB A;  3KV6 A;  4IC2 A;  4W4U A;  5H1U A;  3HCS A;  2DX8 A;  5LKX A;  5TDW A;  3LRQ A;  4AUQ B;  4N3W A;  2LXP C;  2XB1 A;  2YYR A;  2YT5 A;  3ZVY A;  2YSJ A;  2QIZ A;  3U5M A;  3MHH A;  2MNY A;  1K2F A;  3KNV A;  3SOU A;  4MSX A;  2KWJ A;  4FK5 A;  3HCU A;  4GNG A;  3T7L A;  1N87 A;  2FUU A;  2KE1 A;  4GNF A;  2HYE D;  4LLB A;  5DKA A;  3O33 A;  3N9P A;  2KYU A;  2K4D A;  2CT2 A;  5G05 B;  3PUQ A;  2KRE A;  5H1V A;  2FUI A;  2L5U A;  1Z60 A;  3V43 A;  3VK6 A;  2LQ6 A;  2UZG A;  3QZV A;  2VP7 A;  2KFT A;  1LDJ B;  3LQH A;  3N9M A;  3NG2 A;  1WEV A;  2MD8 C;  3MHS A;  3N9L A;  4YAT A;  2G45 A;  4C9Z A;  5B77 A;  4LKA A;  5FEY A;  2KIZ A;  3ZVZ B;  5EYA F;  2QJ0 A;  2KWN A;  1T1H A;  3L11 A;  4A4B A;  4P5O B;  1WIL A;  2LGL A;  2AN6 A;  2HDP A;  2LDR A;  2MUM A;  5AIT A;  3RTR B;  3M63 A;  4YAB A;  2ECI A;  1BOR A;  2BAY A;  2XEU A;  3I2D A;  2H0D B;  2YHO A;  5LKZ A;  4IC3 A;  5H9M A;  2VPB A;  2K17 A;  4WZ2 A;  2EGP A;  2KGG A;  4CA1 A;  2KGI A;  2ZET C;  5D1L B;  1WEW A;  4YBS A;  2VJE A;  5D1M B;  4ZDT A;  2YQL A;  3GL6 A;  3N9Q A;  1VYX A;  1G25 A;  2CKL B;  4F52 B;  5FER A;  3L1X A;  4MVT A;  1IYM A;  2I50 A;  4YC9 A;  4BBQ A;  3RPG C;  4TKP B;  4WZ0 A;  2CSY A;  2LXH C;  2OXQ C;  5J3X A;  1JM7 A;  2L75 A;  4ZQL A;  3SHB A;  4WZ3 B;  3SOX A;  2YQM A;  1WEU A;  2MNZ A;  3O35 A;  2MD7 B;  2EA6 A;  1WGM A;  3O36 A;  1LDK C;  2LV9 A;  3C6W A;  2YRE A;  4A4C A;  2L80 A;  1WE9 A;  2L0B A;  4R2Y A;  3RPG B;  2VJF A;  1V87 A;  2MA5 A;  2F6N A;  5AIU A;  4B7Y C;  4O64 A;  4YAD A;  3DQV R;  1FP0 A;  2JMD A;  4LJN A;  4B86 C;  2RI7 A;  2VPD A;  4UP5 A;  2Y1M A;  4I7C A;  2JMI A;  3O34 A;  4A49 A;  2ECJ A;  4BHW A;  1WEM A;  3U5N A;  2ECT A;  4ZUX U;  1FBV A;  5H1T A;  4UP0 A;  2FSA A;  4UI9 B;  3EB5 A;  5B79 A;  3L1Z B;  4S3O B;  1DVP A;  5LKU A; 
#chains in the Genus database with same CATH topology
 2K16 A;  5K3Q A;  2VPE A;  1CHC A;  2E6R A;  3N9O A;  4GB0 A;  3H7H A;  3LVR E;  1HYJ A;  4V3L C;  3O37 A;  2LN0 A;  4AYC A;  5JG6 A;  4YBM A;  4CCG X;  2LGG A;  5C13 A;  2VNF A;  2EXU A;  2M13 A;  4Z0R A;  3U5P A;  1ZBD B;  2KR4 A;  2MT5 A;  3KQI A;  4GND A;  1X4U A;  3PUR A;  1Z2Q A;  3EB6 A;  2LRI C;  5G0F A;  4WA6 A;  4N4F A;  2MIQ A;  1JOC A;  4NN2 A;  2YU4 A;  3N9N A;  1WES A;  4H9D A;  3SUB A;  4L7X A;  2M3H A;  1WEN A;  2DSM A;  5I3L A;  2JRJ A;  1WEP A;  1U6G B;  1WEO A;  1F62 A;  2EGM A;  3GV4 A;  3Q1D A;  3ZPV E;  5LCW B;  2XOY A;  4V3K C;  5TBN A;  2M1R A;  2VJE B;  3IHP A;  2D8S A;  2XOZ A;  4LK9 A;  2RR4 A;  2IDA A;  1HYI A;  3ASL A;  3ZYQ A;  1MM3 A;  2C2L A;  1MM2 A;  1X4I A;  2P57 A;  5SVY A;  4R7E A;  3FAO A;  3LQJ A;  2C2V S;  2E61 A;  4L58 A;  4X3G A;  2L7P A;  5B75 A;  2OWA A;  1WIM A;  3PLW A;  3KV5 A;  4FIP A;  4LAD B;  2D8U A;  5DIN A;  4AVX A;  3ZNI A;  1RMD A;  4S3O C;  3HTK C;  1DCQ A;  5G04 B;  2ECG A;  1JM7 B;  3MDB C;  4FO9 A;  3LDY A;  4FJC A;  2CRW A;  4YBT A;  4QF3 A;  4PTB A;  3ZTG A;  3O7A A;  4XI1 A;  5B78 A;  2KWO A;  1XWH A;  5D1K B;  2F6J A;  2EOD A;  4PPE A;  1WEE A;  2CSZ A;  2ECN A;  2F42 A;  2JUN A;  3M7K A;  4I7B A;  4YAX A;  2ECW A;  1VFY A;  3FEH A;  2VJF B;  3O70 A;  2YUR A;  4GNE A;  5C11 A;  5KH7 A;  3SOW A;  2CSV A;  3ZPV 1;  4QQ4 A;  2YUC A;  2Y1N A;  3M99 A;  2VPG A;  4I7D A;  3C5K A;  1E4U A;  5KH3 A;  4Q6F A;  5FB1 A;  3T6R A;  5B8D A;  2M85 A;  2ECV A;  3M62 A;  4R8P K;  2YHN A;  2JM3 A;  1Z6U A;  2H0D A;  2NAA A;  2RSD A;  2PNX A;  5FB0 A;  2LGV A;  2E6S A;  2G6Q A;  3DPL R;  3HCT A;  2Y43 A;  2PUY A;  1WFK A;  3DDT A;  1WEQ A;  3LQI A;  3U5O A;  3E2D A;  2KWK A;  2L43 A;  2KU3 A;  3PHD A;  4AYC B;  2G43 A;  5KH9 A;  2YSM A;  1VD4 A;  5B76 A;  5LKT A;  2YW8 A;  3DWD A;  2MA6 A;  2QIC A;  2MKE A;  2LGK A;  2CKL A;  4QF2 A;  5TDR A;  2M6M A;  2K1J A;  3LJU X;  2JMJ A;  3FL2 A;  4AP4 A;  1X4J A;  2FFW A;  4A0C D;  5TAB A;  5TRB A;  3KV6 A;  4IC2 A;  4W4U A;  5H1U A;  3HCS A;  2DX8 A;  5LKX A;  5TDW A;  3LRQ A;  4AUQ B;  4N3W A;  2LXP C;  2XB1 A;  2YYR A;  2YT5 A;  3ZVY A;  2YSJ A;  2QIZ A;  3U5M A;  3MHH A;  1MBM A;  2MNY A;  1K2F A;  3KNV A;  3SOU A;  4MSX A;  2CON A;  2KWJ A;  4FK5 A;  3HCU A;  4GNG A;  3T7L A;  1N87 A;  2FUU A;  3FM8 C;  5SVI A;  3LVQ E;  2KE1 A;  4GNF A;  2HYE D;  4LLB A;  5DKA A;  3O33 A;  3N9P A;  2KYU A;  2K4D A;  2CT2 A;  2DJA A;  5G05 B;  3PUQ A;  2KRE A;  2YVR A;  5H1V A;  2FUI A;  4Z0O A;  2L5U A;  1Z60 A;  3V43 A;  3VK6 A;  2LQ6 A;  2UZG A;  3QZV A;  2VP7 A;  2KFT A;  1LDJ B;  3LQH A;  3N9M A;  3NG2 A;  3KDE C;  1WEV A;  2MD8 C;  3MHS A;  3N9L A;  4YAT A;  2XOC A;  2G45 A;  4C9Z A;  5B77 A;  4LKA A;  5FEY A;  2KIZ A;  3ZVZ B;  5EYA F;  2QJ0 A;  2KWN A;  1T1H A;  3L11 A;  4A4B A;  4P5O B;  3FJU B;  1WIL A;  2LGL A;  2AN6 A;  2HDP A;  2LDR A;  2MUM A;  5AIT A;  3RTR B;  3M63 A;  4OGE A;  4YAB A;  2ECI A;  1BOR A;  2BAY A;  2XEU A;  3I2D A;  2H0D B;  2FD4 A;  4OGC A;  2YHO A;  5LKZ A;  4IC3 A;  5H9M A;  2VPB A;  2K17 A;  4WZ2 A;  2LAU A;  2EGP A;  4F1P A;  2KGG A;  4CA1 A;  2KGI A;  2ZET C;  5D1L B;  1WEW A;  4YBS A;  2VJE A;  5D1M B;  2IQJ A;  4ZDT A;  2YQL A;  3GL6 A;  4O62 A;  3N9Q A;  1VYX A;  5SVX A;  1G25 A;  2CKL B;  4F52 B;  5FER A;  3L1X A;  4MVT A;  1IYM A;  2I50 A;  4YC9 A;  4BBQ A;  3RPG C;  4TKP B;  2CRR A;  4WZ0 A;  2CSY A;  2LXH C;  2OXQ C;  5J3X A;  1JM7 A;  2L75 A;  4ZQL A;  3SHB A;  4WZ3 B;  3SOX A;  3T9K A;  3O47 A;  2YQM A;  1WEU A;  2MNZ A;  3O35 A;  2MD7 B;  2EA6 A;  1WGM A;  3O36 A;  2KKY A;  1LDK C;  2LV9 A;  3C6W A;  2B0O E;  2YRE A;  4A4C A;  2L80 A;  1WE9 A;  2L0B A;  4R2Y A;  3RPG B;  2VJF A;  1V87 A;  2MA5 A;  2F6N A;  5AIU A;  4B7Y C;  4O64 A;  3DQV R;  4YAD A;  1FP0 A;  2JMD A;  4LJN A;  5SVI B;  4B86 C;  2RI7 A;  2VPD A;  4UP5 A;  2Y1M A;  4I7C A;  2KKX A;  2JMI A;  3O34 A;  3JUE A;  4A49 A;  2ECJ A;  4BHW A;  1WEM A;  2XP0 A;  3U5N A;  2ECT A;  4ZUX U;  1FBV A;  5H1T A;  4UP0 A;  2FSA A;  4UI9 B;  3EB5 A;  5B79 A;  3L1Z B;  4S3O B;  3FAN A;  1DVP A;  5LKU A; 
#chains in the Genus database with same CATH homology
 2K16 A;  2VPE A;  1CHC A;  2E6R A;  3N9O A;  4GB0 A;  1HYJ A;  4V3L C;  3O37 A;  2LN0 A;  4AYC A;  5JG6 A;  4YBM A;  4CCG X;  2LGG A;  5C13 A;  2VNF A;  3U5P A;  1ZBD B;  2KR4 A;  2MT5 A;  3KQI A;  4GND A;  1X4U A;  3PUR A;  1Z2Q A;  3EB6 A;  2LRI C;  5G0F A;  4WA6 A;  4N4F A;  2MIQ A;  1JOC A;  4NN2 A;  2YU4 A;  3N9N A;  1WES A;  4L7X A;  2M3H A;  1WEN A;  5I3L A;  2JRJ A;  1WEP A;  1U6G B;  1WEO A;  1F62 A;  3GV4 A;  3ZPV E;  5LCW B;  4V3K C;  5TBN A;  2M1R A;  2VJE B;  3IHP A;  2D8S A;  4LK9 A;  2IDA A;  1HYI A;  3ASL A;  3ZYQ A;  1MM3 A;  2C2L A;  1MM2 A;  1X4I A;  4R7E A;  3LQJ A;  2C2V S;  4L58 A;  4X3G A;  5B75 A;  1WIM A;  3KV5 A;  4FIP A;  4LAD B;  5DIN A;  4AVX A;  3ZNI A;  1RMD A;  4S3O C;  3HTK C;  5G04 B;  2ECG A;  1JM7 B;  4FO9 A;  4FJC A;  4YBT A;  4QF3 A;  4PTB A;  3ZTG A;  3O7A A;  4XI1 A;  5B78 A;  2KWO A;  1XWH A;  5D1K B;  2F6J A;  2EOD A;  4PPE A;  1WEE A;  2CSZ A;  2ECN A;  2F42 A;  4I7B A;  4YAX A;  2ECW A;  1VFY A;  2VJF B;  3O70 A;  2YUR A;  4GNE A;  5C11 A;  5KH7 A;  3SOW A;  3ZPV 1;  2YUC A;  2Y1N A;  3M99 A;  2VPG A;  4I7D A;  3C5K A;  1E4U A;  5KH3 A;  4Q6F A;  5FB1 A;  3T6R A;  5B8D A;  2M85 A;  2ECV A;  3M62 A;  4R8P K;  2YHN A;  1Z6U A;  2H0D A;  2NAA A;  2RSD A;  2PNX A;  5FB0 A;  2LGV A;  2E6S A;  2G6Q A;  3DPL R;  3HCT A;  2Y43 A;  2PUY A;  1WFK A;  1WEQ A;  3LQI A;  3U5O A;  2KWK A;  2L43 A;  2KU3 A;  3PHD A;  4AYC B;  2G43 A;  5KH9 A;  2YSM A;  1VD4 A;  5B76 A;  5LKT A;  2YW8 A;  2MA6 A;  2QIC A;  2LGK A;  2CKL A;  4QF2 A;  5TDR A;  2M6M A;  2K1J A;  2JMJ A;  3FL2 A;  4AP4 A;  1X4J A;  4A0C D;  5TAB A;  5TRB A;  3KV6 A;  4IC2 A;  4W4U A;  5H1U A;  3HCS A;  2DX8 A;  5LKX A;  5TDW A;  3LRQ A;  4AUQ B;  4N3W A;  2LXP C;  2XB1 A;  2YYR A;  2YT5 A;  3ZVY A;  2YSJ A;  2QIZ A;  3U5M A;  3MHH A;  2MNY A;  1K2F A;  3KNV A;  3SOU A;  4MSX A;  2KWJ A;  4FK5 A;  3HCU A;  4GNG A;  3T7L A;  1N87 A;  2FUU A;  2KE1 A;  4GNF A;  2HYE D;  4LLB A;  5DKA A;  3O33 A;  3N9P A;  2KYU A;  2K4D A;  2CT2 A;  5G05 B;  3PUQ A;  2KRE A;  5H1V A;  2FUI A;  2L5U A;  1Z60 A;  3V43 A;  3VK6 A;  2LQ6 A;  2UZG A;  3QZV A;  2VP7 A;  2KFT A;  1LDJ B;  3LQH A;  3N9M A;  3NG2 A;  1WEV A;  2MD8 C;  3MHS A;  3N9L A;  4YAT A;  2G45 A;  4C9Z A;  5B77 A;  4LKA A;  5FEY A;  2KIZ A;  3ZVZ B;  5EYA F;  2QJ0 A;  2KWN A;  1T1H A;  3L11 A;  4A4B A;  4P5O B;  1WIL A;  2LGL A;  2AN6 A;  2HDP A;  2LDR A;  2MUM A;  5AIT A;  3RTR B;  3M63 A;  4YAB A;  2ECI A;  1BOR A;  2BAY A;  2XEU A;  3I2D A;  2H0D B;  2YHO A;  5LKZ A;  4IC3 A;  5H9M A;  2VPB A;  2K17 A;  4WZ2 A;  2EGP A;  2KGG A;  4CA1 A;  2KGI A;  2ZET C;  5D1L B;  1WEW A;  4YBS A;  2VJE A;  5D1M B;  4ZDT A;  2YQL A;  3GL6 A;  3N9Q A;  1VYX A;  1G25 A;  2CKL B;  4F52 B;  5FER A;  3L1X A;  4MVT A;  1IYM A;  2I50 A;  4YC9 A;  4BBQ A;  3RPG C;  4TKP B;  4WZ0 A;  2CSY A;  2LXH C;  2OXQ C;  5J3X A;  1JM7 A;  2L75 A;  4ZQL A;  3SHB A;  4WZ3 B;  3SOX A;  2YQM A;  1WEU A;  2MNZ A;  3O35 A;  2MD7 B;  2EA6 A;  1WGM A;  3O36 A;  1LDK C;  2LV9 A;  3C6W A;  2YRE A;  4A4C A;  2L80 A;  1WE9 A;  2L0B A;  4R2Y A;  3RPG B;  2VJF A;  1V87 A;  2MA5 A;  2F6N A;  5AIU A;  4B7Y C;  4O64 A;  4YAD A;  3DQV R;  1FP0 A;  2JMD A;  4LJN A;  4B86 C;  2RI7 A;  2VPD A;  4UP5 A;  2Y1M A;  4I7C A;  2JMI A;  3O34 A;  4A49 A;  2ECJ A;  4BHW A;  1WEM A;  3U5N A;  2ECT A;  4ZUX U;  1FBV A;  5H1T A;  4UP0 A;  2FSA A;  4UI9 B;  3EB5 A;  5B79 A;  3L1Z B;  4S3O B;  1DVP A;  5LKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...