2MD8C

Nmr structure of sp140 phd finger cis conformer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
GAMGMRNLDECEVCRDGGELFCCDTCSRVFHEDCHIPPVEAERTPWNCIFCRMKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human Sp140 PHD finger: an atypical fold interacting with Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Nuclear body protein SP140
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2013-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2md8C00
2VPGA 4YATA 2LV9A 1IYMA 2CSZA 1LDKC 2LGKA 1Z2QA 5KH7A 5D1KB 2LRIC 2VJFA 2D8SA 2LXPC 4I7DA 3I2DA 2G45A 3ZVZB 2ECGA 2OXQC 2LXHC 3N9LA 2LN0A 4GB0A 2MD8C 2MA5A 5B8DA 3U5OA 2F6NA 4AP4A 5B77A 4NN2A 2K17A 2VJEB 1BORA 2LGVA 4UP0A 2MUMA 2VPBA 3ASLA 3KV6A 3O34A 2L75A 3T7LA 2M6MA 1X4UA 1WILA 4BBQA 4AYCA 4ZUXU 4AUQB 1Z6UA 3N9MA 5D1MB 4R8PK 1MM3A 2KE1A 2K1JA 5TABA 1WFKA 2L5UA 3DQVR 5DINA 1WESA 2Y43A 4WZ0A 1VYXA 2C2LA 3VK6A 3ZPV1 2JMDA 1JM7A 2H0DB 4YAXA 2MT5A 2YQLA 4V3KC 1FP0A 1JM7B 3ZPVE 3N9PA 2M85A 2M1RA 4W4UA 3L11A 1N87A 2XEUA 2MNYA 4QF3A 3O36A 3ZTGA 4MVTA 4YBTA 1F62A 1HYIA 2UZGA 3L1ZB 4A49A 4XI1A 5C11A 1X4JA 4S3OB 5EYAF 1U6GB 4LADB 3HCSA 1T1HA 2LGGA 4L7XA 1FBVA 5LKTA 5TRBA 2L80A 3L1XA 1WEOA 2CKLB 2VJEA 1CHCA 3LQHA 3KQIA 5D1LB 2YT5A 5H1VA 2E6SA 4I7CA 3O37A 4P5OB 2ECJA 2BAYA 4BHWA 1G25A 5LKZA 2KIZA 4L58A 5B78A 3O70A 4YC9A 2ZETC 5FB1A 2QJ0A 4ZDTA 4LKAA 2KWKA 1WEUA 4X3GA 2CKLA 4MSXA 2JMJA 5H1UA 3LQJA 4R7EA 3U5MA 3HTKC 3U5PA 2HYED 2HDPA 3EB6A 1JOCA 3O35A 1WEPA 1K2FA 1WEVA 2K16A 3SOUA 3KV5A 2FUIA 5KH9A 3U5NA 2YSJA 5DKAA 4AVXA 3EB5A 4QF2A 2VPDA 3ZNIA 2FSAA 2KWJA 3M63A 5JG6A 4FIPA 3M62A 3GV4A 2YHOA 3V43A 3N9NA 1DVPA 3C6WA 2MNZA 4FJCA 2M3HA 3SOWA 3N9QA 3GL6A 4PTBA 5AIUA 2KGGA 3RPGC 2KFTA 5B76A 2VJFB 2DX8A 2KWNA 3C5KA 5FERA 2KREA 3HCUA 4R2YA 2KR4A 5C13A 2LQ6A 5AITA 2KYUA 2NAAA 2H0DA 2YU4A 2PUYA 4LK9A 4FK5A 2K4DA 5FEYA 4GNGA 5H9MA 2CT2A 3ZYQA 3MHHA 2F42A 3PHDA 2ECVA 4YADA 4PPEA 5TDRA 1RMDA 2FUUA 3MHSA 4GNEA 2L0BA 2YURA 2YYRA 4AYCB 1WENA 2KU3A 5LKUA 4TKPB 2QIZA 2G43A 2YSMA 1WIMA 3N9OA 2EODA 4GNFA 5G05B 2VNFA 2JRJA 3PUQA 4F52B 5H1TA 2Y1MA 2G6QA 2RI7A 4IC2A 4UI9B 1WEEA 2KWOA 4LLBA 2YQMA 5LCWB 2E6RA 2QICA 2PNXA 5KH3A 2YREA 2LDRA 3O7AA 2MD7B 2C2VS 4B86C 3DPLR 2ECWA 2LGLA 1WGMA 4YBMA 1WEQA 2VPEA 2L43A 4A0CD 5TBNA 2ECTA 4S3OC 2MIQA 4C9ZA 1V87A 2Y1NA 5LKXA 4Q6FA 4WZ2A 5B75A 2I50A 1XWHA 2YUCA 4B7YC 3NG2A 3RPGB 1E4UA 1LDJB 4WA6A 2EGPA 1MM2A 1VD4A 2CSYA 4A4BA 4UP5A 4N4FA 2JMIA 4N3WA 4I7BA 2IDAA 5I3LA 2YW8A 4CA1A 4CCGX 2RSDA 2KGIA 4IC3A 5B79A 3O33A 3FL2A 4YABA 4V3LC 2AN6A 1VFYA 2XB1A 3LQIA 2MA6A 3LRQA 3IHPA 3RTRB 3SOXA 1WEMA 3HCTA 3KNVA 2ECNA 5J3XA 1X4IA 3PURA 4O64A 5TDWA 3SHBA 2F6JA 3M99A 4ZQLA 1ZBDB 1HYJA 2ECIA 4GNDA 1WEWA 3ZVYA 4A4CA 1WE9A 5G04B 3T6RA 4YBSA 5G0FA 2EA6A 1Z60A 4FO9A 2YHNA 3QZVA 4LJNA 4WZ3B 5FB0A 2VP7A
chains in the Genus database with same CATH superfamily
2VPGA 4YATA 2LV9A 1IYMA 2CSZA 1LDKC 2LGKA 1Z2QA 5KH7A 5D1KB 2LRIC 2VJFA 2D8SA 2LXPC 4I7DA 2E61A 2P57A 3I2DA 2G45A 3ZVZB 2ECGA 2OXQC 2IQJA 2LXHC 3DDTA 2EGMA 3N9LA 2LN0A 4GB0A 2MD8C 2MA5A 5B8DA 3U5OA 2F6NA 4AP4A 5B77A 4NN2A 2K17A 2VJEB 1BORA 3O47A 2LGVA 4UP0A 2MUMA 2VPBA 3ASLA 3KV6A 3O34A 2L75A 3T7LA 2CONA 2M6MA 2CRRA 1X4UA 1WILA 4BBQA 4AYCA 4ZUXU 4AUQB 3LVQE 1Z6UA 3N9MA 5D1MB 4R8PK 1MM3A 2KE1A 2K1JA 5TABA 1WFKA 2L5UA 3DQVR 5DINA 1WESA 2Y43A 4WZ0A 1VYXA 2C2LA 3VK6A 2JMDA 3ZPV1 1JM7A 2H0DB 4YAXA 2MT5A 2YQLA 4V3KC 1FP0A 1JM7B 1DCQA 3ZPVE 3N9PA 2M85A 2M1RA 4W4UA 3L11A 2KKYA 3Q1DA 1N87A 2CSVA 2XEUA 2MNYA 4QF3A 3O36A 3ZTGA 4MVTA 4YBTA 1F62A 1HYIA 2UZGA 3L1ZB 4A49A 4XI1A 5C11A 1X4JA 4OGEA 4S3OB 5EYAF 1U6GB 4LADB 3HCSA 1T1HA 2LGGA 4L7XA 1FBVA 5LKTA 2JUNA 5TRBA 2L80A 2RR4A 3L1XA 4QQ4A 1WEOA 3FEHA 3FAOA 2CKLB 2CRWA 2VJEA 1CHCA 3LQHA 2OWAA 3KQIA 3PLWA 5D1LB 2YT5A 5H1VA 2E6SA 4I7CA 3O37A 4P5OB 2ECJA 2BAYA 4BHWA 1G25A 2XOCA 5LKZA 2KIZA 3LVRE 4L58A 5B78A 3O70A 4YC9A 2ZETC 5FB1A 2QJ0A 4ZDTA 2MKEA 2KWKA 4LKAA 1WEUA 4X3GA 2CKLA 4MSXA 2JMJA 5H1UA 5SVIA 2LAUA 2FFWA 3LQJA 4R7EA 3U5MA 5SVYA 3HTKC 3U5PA 4Z0OA 5SVIB 2HYED 2HDPA 3EB6A 1JOCA 3M7KA 3O35A 1WEPA 1K2FA 1WEVA 2K16A 3SOUA 3KV5A 2FUIA 5KH9A 3U5NA 2YSJA 5DKAA 4AVXA 3EB5A 4QF2A 2VPDA 2XOZA 3ZNIA 2FSAA 2KWJA 3M63A 3E2DA 5JG6A 4FIPA 3M62A 3KDEC 3GV4A 2YHOA 3V43A 3N9NA 1DVPA 3C6WA 2MNZA 4FJCA 2M3HA 3SOWA 3N9QA 3GL6A 4PTBA 5AIUA 2KGGA 3RPGC 2KFTA 5B76A 2VJFB 2DX8A 2KWNA 3C5KA 2EXUA 3LJUX 4Z0RA 5FERA 2KREA 3HCUA 2XP0A 2FD4A 4R2YA 2KR4A 5C13A 2LQ6A 5AITA 2KYUA 5K3QA 2NAAA 2H0DA 2DSMA 2YU4A 2PUYA 4LK9A 4FK5A 2K4DA 5FEYA 4GNGA 5H9MA 2CT2A 3ZYQA 3MHHA 2F42A 3PHDA 2ECVA 2M13A 4YADA 4PPEA 5TDRA 5SVXA 1RMDA 2FUUA 3MHSA 4GNEA 2L0BA 4O62A 2YURA 2YYRA 4AYCB 1WENA 2KU3A 1MBMA 3LDYA 5LKUA 4TKPB 2QIZA 2G43A 2YSMA 1WIMA 2L7PA 3N9OA 2EODA 4GNFA 5G05B 2VNFA 2JRJA 3PUQA 4F52B 5H1TA 2Y1MA 2G6QA 2RI7A 2YVRA 4IC2A 4UI9B 1WEEA 2KWOA 4LLBA 2YQMA 5LCWB 4F1PA 2JM3A 2E6RA 2QICA 2PNXA 5KH3A 2YREA 2LDRA 3O7AA 2MD7B 2C2VS 4B86C 3DPLR 2ECWA 2LGLA 1WGMA 4YBMA 1WEQA 2VPEA 2L43A 4A0CD 5TBNA 3FM8C 2ECTA 4S3OC 2MIQA 3FANA 4C9ZA 4H9DA 3DWDA 1V87A 2Y1NA 5LKXA 4Q6FA 4WZ2A 5B75A 2I50A 1XWHA 2YUCA 4OGCA 4B7YC 3NG2A 3RPGB 1E4UA 1LDJB 2D8UA 4WA6A 2EGPA 1MM2A 2DJAA 1VD4A 2CSYA 4A4BA 4UP5A 3JUEA 4N4FA 2JMIA 4N3WA 4I7BA 2IDAA 5I3LA 2YW8A 4CA1A 4CCGX 2RSDA 2KGIA 3FJUB 2KKXA 4IC3A 5B79A 3O33A 3FL2A 4YABA 4V3LC 2AN6A 1VFYA 2XB1A 3H7HA 3LQIA 2MA6A 3LRQA 3IHPA 3RTRB 3MDBC 3SOXA 1WEMA 3HCTA 3KNVA 2ECNA 5J3XA 1X4IA 3PURA 4O64A 5TDWA 3T9KA 3SHBA 3SUBA 2XOYA 2F6JA 3M99A 4ZQLA 1ZBDB 1HYJA 2ECIA 4GNDA 1WEWA 3ZVYA 4A4CA 1WE9A 2B0OE 5G04B 3T6RA 4YBSA 5G0FA 2EA6A 1Z60A 4FO9A 2YHNA 3QZVA 4LJNA 4WZ3B 5FB0A 2VP7A
chains in the Genus database with same CATH topology
2VPGA 4YATA 2LV9A 1IYMA 2CSZA 1LDKC 2LGKA 1Z2QA 5KH7A 5D1KB 2LRIC 2VJFA 2D8SA 2LXPC 4I7DA 3I2DA 2G45A 3ZVZB 2ECGA 2OXQC 2LXHC 3N9LA 2LN0A 4GB0A 2MD8C 2MA5A 5B8DA 3U5OA 2F6NA 4AP4A 5B77A 4NN2A 2K17A 2VJEB 1BORA 2LGVA 4UP0A 2MUMA 2VPBA 3ASLA 3KV6A 3O34A 2L75A 3T7LA 2M6MA 1X4UA 1WILA 4BBQA 4AYCA 4ZUXU 4AUQB 1Z6UA 3N9MA 5D1MB 4R8PK 1MM3A 2KE1A 2K1JA 5TABA 1WFKA 2L5UA 3DQVR 5DINA 1WESA 2Y43A 4WZ0A 1VYXA 2C2LA 3VK6A 3ZPV1 2JMDA 1JM7A 2H0DB 4YAXA 2MT5A 2YQLA 4V3KC 1FP0A 1JM7B 3ZPVE 3N9PA 2M85A 2M1RA 4W4UA 3L11A 1N87A 2XEUA 2MNYA 4QF3A 3O36A 3ZTGA 4MVTA 4YBTA 1F62A 1HYIA 2UZGA 3L1ZB 4A49A 4XI1A 5C11A 1X4JA 4S3OB 5EYAF 1U6GB 4LADB 3HCSA 1T1HA 2LGGA 4L7XA 1FBVA 5LKTA 5TRBA 2L80A 3L1XA 1WEOA 2CKLB 2VJEA 1CHCA 3LQHA 3KQIA 5D1LB 2YT5A 5H1VA 2E6SA 4I7CA 3O37A 4P5OB 2ECJA 2BAYA 4BHWA 1G25A 5LKZA 2KIZA 4L58A 5B78A 3O70A 4YC9A 2ZETC 5FB1A 2QJ0A 4ZDTA 4LKAA 2KWKA 1WEUA 4X3GA 2CKLA 4MSXA 2JMJA 5H1UA 3LQJA 4R7EA 3U5MA 3HTKC 3U5PA 2HYED 2HDPA 3EB6A 1JOCA 3O35A 1WEPA 1K2FA 1WEVA 2K16A 3SOUA 3KV5A 2FUIA 5KH9A 3U5NA 2YSJA 5DKAA 4AVXA 3EB5A 4QF2A 2VPDA 3ZNIA 2FSAA 2KWJA 3M63A 5JG6A 4FIPA 3M62A 3GV4A 2YHOA 3V43A 3N9NA 1DVPA 3C6WA 2MNZA 4FJCA 2M3HA 3SOWA 3N9QA 3GL6A 4PTBA 5AIUA 2KGGA 3RPGC 2KFTA 5B76A 2VJFB 2DX8A 2KWNA 3C5KA 5FERA 2KREA 3HCUA 4R2YA 2KR4A 5C13A 2LQ6A 5AITA 2KYUA 2NAAA 2H0DA 2YU4A 2PUYA 4LK9A 4FK5A 2K4DA 5FEYA 4GNGA 5H9MA 2CT2A 3ZYQA 3MHHA 2F42A 3PHDA 2ECVA 4YADA 4PPEA 5TDRA 1RMDA 2FUUA 3MHSA 4GNEA 2L0BA 2YURA 2YYRA 4AYCB 1WENA 2KU3A 5LKUA 4TKPB 2QIZA 2G43A 2YSMA 1WIMA 3N9OA 2EODA 4GNFA 5G05B 2VNFA 2JRJA 3PUQA 4F52B 5H1TA 2Y1MA 2G6QA 2RI7A 4IC2A 4UI9B 1WEEA 2KWOA 4LLBA 2YQMA 5LCWB 2E6RA 2QICA 2PNXA 5KH3A 2YREA 2LDRA 3O7AA 2MD7B 2C2VS 4B86C 3DPLR 2ECWA 2LGLA 1WGMA 4YBMA 1WEQA 2VPEA 2L43A 4A0CD 5TBNA 2ECTA 4S3OC 2MIQA 4C9ZA 1V87A 2Y1NA 5LKXA 4Q6FA 4WZ2A 5B75A 2I50A 1XWHA 2YUCA 4B7YC 3NG2A 3RPGB 1E4UA 1LDJB 4WA6A 2EGPA 1MM2A 1VD4A 2CSYA 4A4BA 4UP5A 4N4FA 2JMIA 4N3WA 4I7BA 2IDAA 5I3LA 2YW8A 4CA1A 4CCGX 2RSDA 2KGIA 4IC3A 5B79A 3O33A 3FL2A 4YABA 4V3LC 2AN6A 1VFYA 2XB1A 3LQIA 2MA6A 3LRQA 3IHPA 3RTRB 3SOXA 1WEMA 3HCTA 3KNVA 2ECNA 5J3XA 1X4IA 3PURA 4O64A 5TDWA 3SHBA 2F6JA 3M99A 4ZQLA 1ZBDB 1HYJA 2ECIA 4GNDA 1WEWA 3ZVYA 4A4CA 1WE9A 5G04B 3T6RA 4YBSA 5G0FA 2EA6A 1Z60A 4FO9A 2YHNA 3QZVA 4LJNA 4WZ3B 5FB0A 2VP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPG A;  4YAT A;  2LV9 A;  1IYM A;  2CSZ A;  1LDK C;  2LGK A;  1Z2Q A;  5KH7 A;  5D1K B;  2LRI C;  2VJF A;  2D8S A;  2LXP C;  4I7D A;  3I2D A;  2G45 A;  3ZVZ B;  2ECG A;  2OXQ C;  2LXH C;  3N9L A;  2LN0 A;  4GB0 A;  2MD8 C;  2MA5 A;  5B8D A;  3U5O A;  2F6N A;  4AP4 A;  5B77 A;  4NN2 A;  2K17 A;  2VJE B;  1BOR A;  2LGV A;  4UP0 A;  2MUM A;  2VPB A;  3ASL A;  3KV6 A;  3O34 A;  2L75 A;  3T7L A;  2M6M A;  1X4U A;  1WIL A;  4BBQ A;  4AYC A;  4ZUX U;  4AUQ B;  1Z6U A;  3N9M A;  5D1M B;  4R8P K;  1MM3 A;  2KE1 A;  2K1J A;  5TAB A;  1WFK A;  2L5U A;  3DQV R;  5DIN A;  1WES A;  2Y43 A;  4WZ0 A;  1VYX A;  2C2L A;  3VK6 A;  3ZPV 1;  2JMD A;  1JM7 A;  2H0D B;  4YAX A;  2MT5 A;  2YQL A;  4V3K C;  1FP0 A;  1JM7 B;  3ZPV E;  3N9P A;  2M85 A;  2M1R A;  4W4U A;  3L11 A;  1N87 A;  2XEU A;  2MNY A;  4QF3 A;  3O36 A;  3ZTG A;  4MVT A;  4YBT A;  1F62 A;  1HYI A;  2UZG A;  3L1Z B;  4A49 A;  4XI1 A;  5C11 A;  1X4J A;  4S3O B;  5EYA F;  1U6G B;  4LAD B;  3HCS A;  1T1H A;  2LGG A;  4L7X A;  1FBV A;  5LKT A;  5TRB A;  2L80 A;  3L1X A;  1WEO A;  2CKL B;  2VJE A;  1CHC A;  3LQH A;  3KQI A;  5D1L B;  2YT5 A;  5H1V A;  2E6S A;  4I7C A;  3O37 A;  4P5O B;  2ECJ A;  2BAY A;  4BHW A;  1G25 A;  5LKZ A;  2KIZ A;  4L58 A;  5B78 A;  3O70 A;  4YC9 A;  2ZET C;  5FB1 A;  2QJ0 A;  4ZDT A;  4LKA A;  2KWK A;  1WEU A;  4X3G A;  2CKL A;  4MSX A;  2JMJ A;  5H1U A;  3LQJ A;  4R7E A;  3U5M A;  3HTK C;  3U5P A;  2HYE D;  2HDP A;  3EB6 A;  1JOC A;  3O35 A;  1WEP A;  1K2F A;  1WEV A;  2K16 A;  3SOU A;  3KV5 A;  2FUI A;  5KH9 A;  3U5N A;  2YSJ A;  5DKA A;  4AVX A;  3EB5 A;  4QF2 A;  2VPD A;  3ZNI A;  2FSA A;  2KWJ A;  3M63 A;  5JG6 A;  4FIP A;  3M62 A;  3GV4 A;  2YHO A;  3V43 A;  3N9N A;  1DVP A;  3C6W A;  2MNZ A;  4FJC A;  2M3H A;  3SOW A;  3N9Q A;  3GL6 A;  4PTB A;  5AIU A;  2KGG A;  3RPG C;  2KFT A;  5B76 A;  2VJF B;  2DX8 A;  2KWN A;  3C5K A;  5FER A;  2KRE A;  3HCU A;  4R2Y A;  2KR4 A;  5C13 A;  2LQ6 A;  5AIT A;  2KYU A;  2NAA A;  2H0D A;  2YU4 A;  2PUY A;  4LK9 A;  4FK5 A;  2K4D A;  5FEY A;  4GNG A;  5H9M A;  2CT2 A;  3ZYQ A;  3MHH A;  2F42 A;  3PHD A;  2ECV A;  4YAD A;  4PPE A;  5TDR A;  1RMD A;  2FUU A;  3MHS A;  4GNE A;  2L0B A;  2YUR A;  2YYR A;  4AYC B;  1WEN A;  2KU3 A;  5LKU A;  4TKP B;  2QIZ A;  2G43 A;  2YSM A;  1WIM A;  3N9O A;  2EOD A;  4GNF A;  5G05 B;  2VNF A;  2JRJ A;  3PUQ A;  4F52 B;  5H1T A;  2Y1M A;  2G6Q A;  2RI7 A;  4IC2 A;  4UI9 B;  1WEE A;  2KWO A;  4LLB A;  2YQM A;  5LCW B;  2E6R A;  2QIC A;  2PNX A;  5KH3 A;  2YRE A;  2LDR A;  3O7A A;  2MD7 B;  2C2V S;  4B86 C;  3DPL R;  2ECW A;  2LGL A;  1WGM A;  4YBM A;  1WEQ A;  2VPE A;  2L43 A;  4A0C D;  5TBN A;  2ECT A;  4S3O C;  2MIQ A;  4C9Z A;  1V87 A;  2Y1N A;  5LKX A;  4Q6F A;  4WZ2 A;  5B75 A;  2I50 A;  1XWH A;  2YUC A;  4B7Y C;  3NG2 A;  3RPG B;  1E4U A;  1LDJ B;  4WA6 A;  2EGP A;  1MM2 A;  1VD4 A;  2CSY A;  4A4B A;  4UP5 A;  4N4F A;  2JMI A;  4N3W A;  4I7B A;  2IDA A;  5I3L A;  2YW8 A;  4CA1 A;  4CCG X;  2RSD A;  2KGI A;  4IC3 A;  5B79 A;  3O33 A;  3FL2 A;  4YAB A;  4V3L C;  2AN6 A;  1VFY A;  2XB1 A;  3LQI A;  2MA6 A;  3LRQ A;  3IHP A;  3RTR B;  3SOX A;  1WEM A;  3HCT A;  3KNV A;  2ECN A;  5J3X A;  1X4I A;  3PUR A;  4O64 A;  5TDW A;  3SHB A;  2F6J A;  3M99 A;  4ZQL A;  1ZBD B;  1HYJ A;  2ECI A;  4GND A;  1WEW A;  3ZVY A;  4A4C A;  1WE9 A;  5G04 B;  3T6R A;  4YBS A;  5G0F A;  2EA6 A;  1Z60 A;  4FO9 A;  2YHN A;  3QZV A;  4LJN A;  4WZ3 B;  5FB0 A;  2VP7 A; 
#chains in the Genus database with same CATH topology
 2VPG A;  4YAT A;  2LV9 A;  1IYM A;  2CSZ A;  1LDK C;  2LGK A;  1Z2Q A;  5KH7 A;  5D1K B;  2LRI C;  2VJF A;  2D8S A;  2LXP C;  4I7D A;  2E61 A;  2P57 A;  3I2D A;  2G45 A;  3ZVZ B;  2ECG A;  2OXQ C;  2IQJ A;  2LXH C;  3DDT A;  2EGM A;  3N9L A;  2LN0 A;  4GB0 A;  2MD8 C;  2MA5 A;  5B8D A;  3U5O A;  2F6N A;  4AP4 A;  5B77 A;  4NN2 A;  2K17 A;  2VJE B;  1BOR A;  3O47 A;  2LGV A;  4UP0 A;  2MUM A;  2VPB A;  3ASL A;  3KV6 A;  3O34 A;  2L75 A;  3T7L A;  2CON A;  2M6M A;  2CRR A;  1X4U A;  1WIL A;  4BBQ A;  4AYC A;  4ZUX U;  4AUQ B;  3LVQ E;  1Z6U A;  3N9M A;  5D1M B;  4R8P K;  1MM3 A;  2KE1 A;  2K1J A;  5TAB A;  1WFK A;  2L5U A;  3DQV R;  5DIN A;  1WES A;  2Y43 A;  4WZ0 A;  1VYX A;  2C2L A;  3VK6 A;  2JMD A;  3ZPV 1;  1JM7 A;  2H0D B;  4YAX A;  2MT5 A;  2YQL A;  4V3K C;  1FP0 A;  1JM7 B;  1DCQ A;  3ZPV E;  3N9P A;  2M85 A;  2M1R A;  4W4U A;  3L11 A;  2KKY A;  3Q1D A;  1N87 A;  2CSV A;  2XEU A;  2MNY A;  4QF3 A;  3O36 A;  3ZTG A;  4MVT A;  4YBT A;  1F62 A;  1HYI A;  2UZG A;  3L1Z B;  4A49 A;  4XI1 A;  5C11 A;  1X4J A;  4OGE A;  4S3O B;  5EYA F;  1U6G B;  4LAD B;  3HCS A;  1T1H A;  2LGG A;  4L7X A;  1FBV A;  5LKT A;  2JUN A;  5TRB A;  2L80 A;  2RR4 A;  3L1X A;  4QQ4 A;  1WEO A;  3FEH A;  3FAO A;  2CKL B;  2CRW A;  2VJE A;  1CHC A;  3LQH A;  2OWA A;  3KQI A;  3PLW A;  5D1L B;  2YT5 A;  5H1V A;  2E6S A;  4I7C A;  3O37 A;  4P5O B;  2ECJ A;  2BAY A;  4BHW A;  1G25 A;  2XOC A;  5LKZ A;  2KIZ A;  3LVR E;  4L58 A;  5B78 A;  3O70 A;  4YC9 A;  2ZET C;  5FB1 A;  2QJ0 A;  4ZDT A;  2MKE A;  2KWK A;  4LKA A;  1WEU A;  4X3G A;  2CKL A;  4MSX A;  2JMJ A;  5H1U A;  5SVI A;  2LAU A;  2FFW A;  3LQJ A;  4R7E A;  3U5M A;  5SVY A;  3HTK C;  3U5P A;  4Z0O A;  5SVI B;  2HYE D;  2HDP A;  3EB6 A;  1JOC A;  3M7K A;  3O35 A;  1WEP A;  1K2F A;  1WEV A;  2K16 A;  3SOU A;  3KV5 A;  2FUI A;  5KH9 A;  3U5N A;  2YSJ A;  5DKA A;  4AVX A;  3EB5 A;  4QF2 A;  2VPD A;  2XOZ A;  3ZNI A;  2FSA A;  2KWJ A;  3M63 A;  3E2D A;  5JG6 A;  4FIP A;  3M62 A;  3KDE C;  3GV4 A;  2YHO A;  3V43 A;  3N9N A;  1DVP A;  3C6W A;  2MNZ A;  4FJC A;  2M3H A;  3SOW A;  3N9Q A;  3GL6 A;  4PTB A;  5AIU A;  2KGG A;  3RPG C;  2KFT A;  5B76 A;  2VJF B;  2DX8 A;  2KWN A;  3C5K A;  2EXU A;  3LJU X;  4Z0R A;  5FER A;  2KRE A;  3HCU A;  2XP0 A;  2FD4 A;  4R2Y A;  2KR4 A;  5C13 A;  2LQ6 A;  5AIT A;  2KYU A;  5K3Q A;  2NAA A;  2H0D A;  2DSM A;  2YU4 A;  2PUY A;  4LK9 A;  4FK5 A;  2K4D A;  5FEY A;  4GNG A;  5H9M A;  2CT2 A;  3ZYQ A;  3MHH A;  2F42 A;  3PHD A;  2ECV A;  2M13 A;  4YAD A;  4PPE A;  5TDR A;  5SVX A;  1RMD A;  2FUU A;  3MHS A;  4GNE A;  2L0B A;  4O62 A;  2YUR A;  2YYR A;  4AYC B;  1WEN A;  2KU3 A;  1MBM A;  3LDY A;  5LKU A;  4TKP B;  2QIZ A;  2G43 A;  2YSM A;  1WIM A;  2L7P A;  3N9O A;  2EOD A;  4GNF A;  5G05 B;  2VNF A;  2JRJ A;  3PUQ A;  4F52 B;  5H1T A;  2Y1M A;  2G6Q A;  2RI7 A;  2YVR A;  4IC2 A;  4UI9 B;  1WEE A;  2KWO A;  4LLB A;  2YQM A;  5LCW B;  4F1P A;  2JM3 A;  2E6R A;  2QIC A;  2PNX A;  5KH3 A;  2YRE A;  2LDR A;  3O7A A;  2MD7 B;  2C2V S;  4B86 C;  3DPL R;  2ECW A;  2LGL A;  1WGM A;  4YBM A;  1WEQ A;  2VPE A;  2L43 A;  4A0C D;  5TBN A;  3FM8 C;  2ECT A;  4S3O C;  2MIQ A;  3FAN A;  4C9Z A;  4H9D A;  3DWD A;  1V87 A;  2Y1N A;  5LKX A;  4Q6F A;  4WZ2 A;  5B75 A;  2I50 A;  1XWH A;  2YUC A;  4OGC A;  4B7Y C;  3NG2 A;  3RPG B;  1E4U A;  1LDJ B;  2D8U A;  4WA6 A;  2EGP A;  1MM2 A;  2DJA A;  1VD4 A;  2CSY A;  4A4B A;  4UP5 A;  3JUE A;  4N4F A;  2JMI A;  4N3W A;  4I7B A;  2IDA A;  5I3L A;  2YW8 A;  4CA1 A;  4CCG X;  2RSD A;  2KGI A;  3FJU B;  2KKX A;  4IC3 A;  5B79 A;  3O33 A;  3FL2 A;  4YAB A;  4V3L C;  2AN6 A;  1VFY A;  2XB1 A;  3H7H A;  3LQI A;  2MA6 A;  3LRQ A;  3IHP A;  3RTR B;  3MDB C;  3SOX A;  1WEM A;  3HCT A;  3KNV A;  2ECN A;  5J3X A;  1X4I A;  3PUR A;  4O64 A;  5TDW A;  3T9K A;  3SHB A;  3SUB A;  2XOY A;  2F6J A;  3M99 A;  4ZQL A;  1ZBD B;  1HYJ A;  2ECI A;  4GND A;  1WEW A;  3ZVY A;  4A4C A;  1WE9 A;  2B0O E;  5G04 B;  3T6R A;  4YBS A;  5G0F A;  2EA6 A;  1Z60 A;  4FO9 A;  2YHN A;  3QZV A;  4LJN A;  4WZ3 B;  5FB0 A;  2VP7 A; 
#chains in the Genus database with same CATH homology
 2VPG A;  4YAT A;  2LV9 A;  1IYM A;  2CSZ A;  1LDK C;  2LGK A;  1Z2Q A;  5KH7 A;  5D1K B;  2LRI C;  2VJF A;  2D8S A;  2LXP C;  4I7D A;  3I2D A;  2G45 A;  3ZVZ B;  2ECG A;  2OXQ C;  2LXH C;  3N9L A;  2LN0 A;  4GB0 A;  2MD8 C;  2MA5 A;  5B8D A;  3U5O A;  2F6N A;  4AP4 A;  5B77 A;  4NN2 A;  2K17 A;  2VJE B;  1BOR A;  2LGV A;  4UP0 A;  2MUM A;  2VPB A;  3ASL A;  3KV6 A;  3O34 A;  2L75 A;  3T7L A;  2M6M A;  1X4U A;  1WIL A;  4BBQ A;  4AYC A;  4ZUX U;  4AUQ B;  1Z6U A;  3N9M A;  5D1M B;  4R8P K;  1MM3 A;  2KE1 A;  2K1J A;  5TAB A;  1WFK A;  2L5U A;  3DQV R;  5DIN A;  1WES A;  2Y43 A;  4WZ0 A;  1VYX A;  2C2L A;  3VK6 A;  3ZPV 1;  2JMD A;  1JM7 A;  2H0D B;  4YAX A;  2MT5 A;  2YQL A;  4V3K C;  1FP0 A;  1JM7 B;  3ZPV E;  3N9P A;  2M85 A;  2M1R A;  4W4U A;  3L11 A;  1N87 A;  2XEU A;  2MNY A;  4QF3 A;  3O36 A;  3ZTG A;  4MVT A;  4YBT A;  1F62 A;  1HYI A;  2UZG A;  3L1Z B;  4A49 A;  4XI1 A;  5C11 A;  1X4J A;  4S3O B;  5EYA F;  1U6G B;  4LAD B;  3HCS A;  1T1H A;  2LGG A;  4L7X A;  1FBV A;  5LKT A;  5TRB A;  2L80 A;  3L1X A;  1WEO A;  2CKL B;  2VJE A;  1CHC A;  3LQH A;  3KQI A;  5D1L B;  2YT5 A;  5H1V A;  2E6S A;  4I7C A;  3O37 A;  4P5O B;  2ECJ A;  2BAY A;  4BHW A;  1G25 A;  5LKZ A;  2KIZ A;  4L58 A;  5B78 A;  3O70 A;  4YC9 A;  2ZET C;  5FB1 A;  2QJ0 A;  4ZDT A;  4LKA A;  2KWK A;  1WEU A;  4X3G A;  2CKL A;  4MSX A;  2JMJ A;  5H1U A;  3LQJ A;  4R7E A;  3U5M A;  3HTK C;  3U5P A;  2HYE D;  2HDP A;  3EB6 A;  1JOC A;  3O35 A;  1WEP A;  1K2F A;  1WEV A;  2K16 A;  3SOU A;  3KV5 A;  2FUI A;  5KH9 A;  3U5N A;  2YSJ A;  5DKA A;  4AVX A;  3EB5 A;  4QF2 A;  2VPD A;  3ZNI A;  2FSA A;  2KWJ A;  3M63 A;  5JG6 A;  4FIP A;  3M62 A;  3GV4 A;  2YHO A;  3V43 A;  3N9N A;  1DVP A;  3C6W A;  2MNZ A;  4FJC A;  2M3H A;  3SOW A;  3N9Q A;  3GL6 A;  4PTB A;  5AIU A;  2KGG A;  3RPG C;  2KFT A;  5B76 A;  2VJF B;  2DX8 A;  2KWN A;  3C5K A;  5FER A;  2KRE A;  3HCU A;  4R2Y A;  2KR4 A;  5C13 A;  2LQ6 A;  5AIT A;  2KYU A;  2NAA A;  2H0D A;  2YU4 A;  2PUY A;  4LK9 A;  4FK5 A;  2K4D A;  5FEY A;  4GNG A;  5H9M A;  2CT2 A;  3ZYQ A;  3MHH A;  2F42 A;  3PHD A;  2ECV A;  4YAD A;  4PPE A;  5TDR A;  1RMD A;  2FUU A;  3MHS A;  4GNE A;  2L0B A;  2YUR A;  2YYR A;  4AYC B;  1WEN A;  2KU3 A;  5LKU A;  4TKP B;  2QIZ A;  2G43 A;  2YSM A;  1WIM A;  3N9O A;  2EOD A;  4GNF A;  5G05 B;  2VNF A;  2JRJ A;  3PUQ A;  4F52 B;  5H1T A;  2Y1M A;  2G6Q A;  2RI7 A;  4IC2 A;  4UI9 B;  1WEE A;  2KWO A;  4LLB A;  2YQM A;  5LCW B;  2E6R A;  2QIC A;  2PNX A;  5KH3 A;  2YRE A;  2LDR A;  3O7A A;  2MD7 B;  2C2V S;  4B86 C;  3DPL R;  2ECW A;  2LGL A;  1WGM A;  4YBM A;  1WEQ A;  2VPE A;  2L43 A;  4A0C D;  5TBN A;  2ECT A;  4S3O C;  2MIQ A;  4C9Z A;  1V87 A;  2Y1N A;  5LKX A;  4Q6F A;  4WZ2 A;  5B75 A;  2I50 A;  1XWH A;  2YUC A;  4B7Y C;  3NG2 A;  3RPG B;  1E4U A;  1LDJ B;  4WA6 A;  2EGP A;  1MM2 A;  1VD4 A;  2CSY A;  4A4B A;  4UP5 A;  4N4F A;  2JMI A;  4N3W A;  4I7B A;  2IDA A;  5I3L A;  2YW8 A;  4CA1 A;  4CCG X;  2RSD A;  2KGI A;  4IC3 A;  5B79 A;  3O33 A;  3FL2 A;  4YAB A;  4V3L C;  2AN6 A;  1VFY A;  2XB1 A;  3LQI A;  2MA6 A;  3LRQ A;  3IHP A;  3RTR B;  3SOX A;  1WEM A;  3HCT A;  3KNV A;  2ECN A;  5J3X A;  1X4I A;  3PUR A;  4O64 A;  5TDW A;  3SHB A;  2F6J A;  3M99 A;  4ZQL A;  1ZBD B;  1HYJ A;  2ECI A;  4GND A;  1WEW A;  3ZVY A;  4A4C A;  1WE9 A;  5G04 B;  3T6R A;  4YBS A;  5G0F A;  2EA6 A;  1Z60 A;  4FO9 A;  2YHN A;  3QZV A;  4LJN A;  4WZ3 B;  5FB0 A;  2VP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...