2MD8C

Nmr structure of sp140 phd finger cis conformer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
GAMGMRNLDECEVCRDGGELFCCDTCSRVFHEDCHIPPVEAERTPWNCIFCRMKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human Sp140 PHD finger: an atypical fold interacting with Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Nuclear body protein SP140
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2013-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2md8C00
4ZUXU 4A49A 3N9MA 1IYMA 5FB1A 2G45A 3O34A 2H0DA 2KE1A 5B78A 2M3HA 2FUIA 4R7EA 4BBQA 3KV5A 1Z2QA 2JMJA 4GNGA 5H1TA 4YBTA 5LKZA 2YQLA 1JOCA 1WE9A 5J3XA 5H9MA 5EYAF 2KFTA 1BORA 3N9NA 3O33A 2L0BA 5G05B 1Z60A 2MA6A 3ZVYA 4MSXA 2VPEA 2KYUA 3SOXA 4AP4A 4A4BA 1XWHA 3LQIA 4LADB 2VP7A 2AN6A 4YADA 2H0DB 2MUMA 3O36A 4IC2A 4WZ3B 4AYCB 5JG6A 2C2VS 3NG2A 3ZNIA 2UZGA 2ECIA 2K4DA 4S3OC 3O35A 2LGKA 5C13A 2ECGA 4L7XA 1HYIA 2ECTA 3SOWA 3MHSA 4V3LC 2FSAA 2JRJA 4S3OB 4GNDA 1Z6UA 2YSJA 2L75A 4A4CA 2MA5A 1U6GB 1FP0A 1X4UA 3GV4A 2VPBA 4YATA 2KIZA 4FK5A 3U5MA 2MIQA 1VYXA 3L11A 4AYCA 4C9ZA 2VNFA 2RI7A 5TBNA 4UP5A 4L58A 3ZVZB 3C6WA 2KWNA 3U5OA 2YYRA 2VJEB 2BAYA 3RPGB 5B77A 2HYED 3PUQA 2YHOA 2YURA 4I7BA 3LRQA 2PUYA 2M1RA 2VPDA 3L1ZB 1WILA 2D8SA 1ZBDB 5LKXA 5AITA 1V87A 3O37A 4X3GA 2LDRA 5D1LB 3ZPV1 2NAAA 1FBVA 2C2LA 5DKAA 1WGMA 2LV9A 2ZETC 4QF2A 5KH9A 4QF3A 2JMIA 1WFKA 5FB0A 1T1HA 2DX8A 3N9PA 5KH7A 3DQVR 2LGLA 2YREA 2HDPA 3HCUA 3RPGC 2LGGA 4B7YC 3ZTGA 3SOUA 1WEUA 3I2DA 2M85A 2KU3A 2CSZA 4LKAA 3FL2A 3M63A 3GL6A 2LXHC 5AIUA 3RTRB 2F42A 2KWJA 3EB6A 4PTBA 2L80A 2ECJA 3ASLA 3KNVA 2XB1A 2QIZA 2E6SA 5LCWB 5KH3A 1X4JA 4LK9A 1MM2A 2KREA 4WZ2A 2QJ0A 4ZDTA 1JM7B 3VK6A 5D1KB 1VD4A 2MD8C 5DINA 3QZVA 1X4IA 4WZ0A 2LRIC 2XEUA 4A0CD 2YQMA 2RSDA 2VJFB 3LQJA 4XI1A 1WEOA 4MVTA 4GNFA 2VJFA 1WEEA 2VPGA 4W4UA 3HCSA 4GB0A 3SHBA 5TDWA 3ZPVE 5LKTA 3V43A 1WESA 1K2FA 2YT5A 3HTKC 4NN2A 4O64A 3T7LA 1WEPA 3PHDA 4F52B 4FO9A 3N9LA 1G25A 2F6JA 1HYJA 2K17A 2YW8A 1F62A 4Q6FA 2PNXA 3KQIA 4IC3A 5G0FA 1WENA 4PPEA 2Y1NA 4ZQLA 2EA6A 3L1XA 3U5PA 2EGPA 2LN0A 4FIPA 3O70A 2K1JA 2M6MA 2VJEA 5LKUA 4B86C 4UP0A 5TRBA 1RMDA 1N87A 2Y43A 4CCGX 3ZYQA 3N9OA 1WEWA 1DVPA 4R2YA 5G04B 2MT5A 5I3LA 4FJCA 2MNZA 4GNEA 4TKPB 2LXPC 4AUQB 4CA1A 2L43A 1VFYA 2IDAA 5TDRA 2L5UA 2CSYA 2YSMA 4WA6A 2CT2A 2MD7B 2FUUA 2OXQC 5TABA 2EODA 3T6RA 5B8DA 5FEYA 4AVXA 1WEMA 5H1UA 3N9QA 5B79A 1WEQA 3IHPA 4R8PK 4YBSA 1MM3A 2I50A 4YAXA 3M99A 2ECWA 2K16A 4I7CA 3M62A 2ECNA 2YHNA 1LDJB 2LGVA 4YABA 2QICA 1E4UA 2YUCA 3C5KA 3MHHA 2G6QA 4BHWA 3KV6A 5FERA 3U5NA 4LJNA 4YBMA 1LDKC 4I7DA 3DPLR 2CKLA 4V3KC 2CKLB 5B75A 2G43A 1JM7A 3PURA 4UI9B 3EB5A 2KWOA 5H1VA 2Y1MA 5D1MB 3LQHA 2JMDA 1WEVA 2F6NA 2KGIA 2E6RA 4YC9A 2ECVA 2KGGA 5B76A 1WIMA 4N4FA 3HCTA 2LQ6A 2KR4A 2YU4A 1CHCA 5C11A 2MNYA 4LLBA 4P5OB 2KWKA 3O7AA 4N3WA
chains in the Genus database with same CATH superfamily
4ZUXU 4A49A 3N9MA 1IYMA 5FB1A 5K3QA 2G45A 3O34A 2H0DA 2KE1A 5B78A 2M3HA 2FUIA 4R7EA 5SVYA 4BBQA 3KV5A 2KKXA 3LJUX 1Z2QA 2JMJA 4GNGA 5H1TA 4YBTA 5LKZA 2YQLA 1JOCA 1WE9A 5J3XA 5H9MA 5EYAF 2KFTA 1BORA 3N9NA 1MBMA 3O33A 2L0BA 5G05B 1Z60A 2MA6A 3ZVYA 4MSXA 2VPEA 2KYUA 3SOXA 4AP4A 4A4BA 2YVRA 3H7HA 1XWHA 3LQIA 4LADB 2VP7A 2AN6A 4YADA 4OGCA 2H0DB 2MUMA 3O36A 4IC2A 4WZ3B 3SUBA 4AYCB 5JG6A 2C2VS 3NG2A 3ZNIA 2UZGA 2ECIA 3DDTA 2K4DA 4S3OC 3O35A 2LGKA 5C13A 2ECGA 4L7XA 4F1PA 3Q1DA 1HYIA 1DCQA 3O47A 2ECTA 3SOWA 3MHSA 4V3LC 2FSAA 2JRJA 3LVQE 4S3OB 4GNDA 1Z6UA 3E2DA 2YSJA 2L75A 2XOZA 4A4CA 2MA5A 1U6GB 1FP0A 1X4UA 4H9DA 3GV4A 2VPBA 4YATA 2KIZA 4FK5A 2MIQA 3U5MA 3LVRE 1VYXA 3L11A 4AYCA 4C9ZA 2VNFA 3KDEC 2RI7A 5TBNA 4UP5A 4L58A 3ZVZB 3C6WA 2KWNA 3U5OA 2JM3A 2YYRA 2VJEB 2BAYA 3RPGB 5B77A 3FANA 2HYED 3PUQA 2YHOA 2EGMA 2YURA 4I7BA 3FAOA 3LRQA 2PUYA 2M1RA 5SVXA 3L1ZB 2VPDA 2DSMA 2B0OE 1WILA 2D8SA 1ZBDB 5LKXA 5AITA 1V87A 3O37A 4X3GA 2LDRA 5D1LB 3ZPV1 2NAAA 1FBVA 2C2LA 5DKAA 2FFWA 1WGMA 5SVIB 2LV9A 2ZETC 4QF2A 2D8UA 5KH9A 4QF3A 2JMIA 2XOCA 2P57A 1WFKA 5FB0A 1T1HA 2DX8A 3N9PA 5KH7A 3DQVR 2LGLA 2YREA 2CSVA 2HDPA 3HCUA 3RPGC 2LGGA 2XOYA 4B7YC 3ZTGA 3SOUA 1WEUA 3I2DA 2M85A 2KU3A 3FEHA 2CSZA 4LKAA 4N3WA 3FL2A 3M63A 3GL6A 3MDBC 4Z0RA 2LXHC 2E61A 5AIUA 3RTRB 2F42A 2KWJA 3PLWA 3EB6A 4PTBA 2L80A 2ECJA 3ASLA 3KNVA 2XB1A 2QIZA 2E6SA 5LCWB 5KH3A 1X4JA 4LK9A 1MM2A 2KREA 4WZ2A 2QJ0A 4ZDTA 2M13A 1JM7B 3VK6A 2FD4A 5D1KB 1VD4A 2MD8C 5DINA 3QZVA 1X4IA 4WZ0A 2LRIC 2XEUA 4A0CD 2YQMA 2RSDA 2VJFB 2CRWA 3LQJA 2CRRA 4XI1A 1WEOA 4MVTA 4GNFA 2VJFA 1WEEA 2VPGA 4W4UA 3HCSA 4GB0A 3SHBA 5TDWA 3ZPVE 5LKTA 3V43A 1WESA 1K2FA 2YT5A 3HTKC 4NN2A 4O64A 3T7LA 4QQ4A 1WEPA 2MKEA 2CONA 3PHDA 4F52B 4FO9A 3N9LA 2L7PA 1G25A 2RR4A 2F6JA 1HYJA 2K17A 2YW8A 1F62A 2IQJA 2XP0A 4Q6FA 2PNXA 2DJAA 3KQIA 2OWAA 4IC3A 5G0FA 1WENA 4PPEA 2Y1NA 4ZQLA 2EXUA 2EA6A 3L1XA 3U5PA 2EGPA 2LN0A 3JUEA 4FIPA 3O70A 2K1JA 2M6MA 2JUNA 2VJEA 5LKUA 4B86C 4UP0A 3FJUB 5TRBA 1RMDA 1N87A 2Y43A 4CCGX 3ZYQA 3N9OA 1WEWA 1DVPA 4R2YA 5G04B 2MT5A 5I3LA 4FJCA 2MNZA 3DWDA 4GNEA 4TKPB 2LXPC 4AUQB 4CA1A 2L43A 1VFYA 2IDAA 5TDRA 2L5UA 2CSYA 2YSMA 4WA6A 2CT2A 2MD7B 2FUUA 2OXQC 5TABA 2EODA 3T6RA 5B8DA 5FEYA 4AVXA 1WEMA 5H1UA 3N9QA 3FM8C 5B79A 1WEQA 3IHPA 4R8PK 4YBSA 1MM3A 2I50A 4YAXA 3M99A 2ECWA 2K16A 4I7CA 3M62A 2ECNA 2YHNA 1LDJB 2LGVA 4YABA 2QICA 1E4UA 2YUCA 3C5KA 3MHHA 2G6QA 4BHWA 3KV6A 5FERA 3U5NA 2LAUA 4LJNA 4YBMA 5SVIA 1LDKC 4I7DA 3DPLR 2CKLA 4V3KC 2KKYA 2CKLB 5B75A 2G43A 1JM7A 3PURA 4UI9B 3EB5A 2KWOA 5H1VA 2Y1MA 5D1MB 3M7KA 3LQHA 2JMDA 1WEVA 2F6NA 2KGIA 2E6RA 3T9KA 4OGEA 4YC9A 4O62A 2ECVA 3LDYA 2KGGA 5B76A 1WIMA 4N4FA 3HCTA 2LQ6A 2KR4A 2YU4A 1CHCA 5C11A 2MNYA 4LLBA 4P5OB 2KWKA 3O7AA 4Z0OA
chains in the Genus database with same CATH topology
4ZUXU 4A49A 3N9MA 1IYMA 5FB1A 2G45A 3O34A 2H0DA 2KE1A 5B78A 2M3HA 2FUIA 4R7EA 4BBQA 3KV5A 1Z2QA 2JMJA 4GNGA 5H1TA 4YBTA 5LKZA 2YQLA 1JOCA 1WE9A 5J3XA 5H9MA 5EYAF 2KFTA 1BORA 3N9NA 3O33A 2L0BA 5G05B 1Z60A 2MA6A 3ZVYA 4MSXA 2VPEA 2KYUA 3SOXA 4AP4A 4A4BA 1XWHA 3LQIA 4LADB 2VP7A 2AN6A 4YADA 2H0DB 2MUMA 3O36A 4IC2A 4WZ3B 4AYCB 5JG6A 2C2VS 3NG2A 3ZNIA 2UZGA 2ECIA 2K4DA 4S3OC 3O35A 2LGKA 5C13A 2ECGA 4L7XA 1HYIA 2ECTA 3SOWA 3MHSA 4V3LC 2FSAA 2JRJA 4S3OB 4GNDA 1Z6UA 2YSJA 2L75A 4A4CA 2MA5A 1U6GB 1FP0A 1X4UA 3GV4A 2VPBA 4YATA 2KIZA 4FK5A 3U5MA 2MIQA 1VYXA 3L11A 4AYCA 4C9ZA 2VNFA 2RI7A 5TBNA 4UP5A 4L58A 3ZVZB 3C6WA 2KWNA 3U5OA 2YYRA 2VJEB 2BAYA 3RPGB 5B77A 2HYED 3PUQA 2YHOA 2YURA 4I7BA 3LRQA 2PUYA 2M1RA 2VPDA 3L1ZB 1WILA 2D8SA 1ZBDB 5LKXA 5AITA 1V87A 3O37A 4X3GA 2LDRA 5D1LB 3ZPV1 2NAAA 1FBVA 2C2LA 5DKAA 1WGMA 2LV9A 2ZETC 4QF2A 5KH9A 4QF3A 2JMIA 1WFKA 5FB0A 1T1HA 2DX8A 3N9PA 5KH7A 3DQVR 2LGLA 2YREA 2HDPA 3HCUA 3RPGC 2LGGA 4B7YC 3ZTGA 3SOUA 1WEUA 3I2DA 2M85A 2KU3A 2CSZA 4LKAA 3FL2A 3M63A 3GL6A 2LXHC 5AIUA 3RTRB 2F42A 2KWJA 3EB6A 4PTBA 2L80A 2ECJA 3ASLA 3KNVA 2XB1A 2QIZA 2E6SA 5LCWB 5KH3A 1X4JA 4LK9A 1MM2A 2KREA 4WZ2A 2QJ0A 4ZDTA 1JM7B 3VK6A 5D1KB 1VD4A 2MD8C 5DINA 3QZVA 1X4IA 4WZ0A 2LRIC 2XEUA 4A0CD 2YQMA 2RSDA 2VJFB 3LQJA 4XI1A 1WEOA 4MVTA 4GNFA 2VJFA 1WEEA 2VPGA 4W4UA 3HCSA 4GB0A 3SHBA 5TDWA 3ZPVE 5LKTA 3V43A 1WESA 1K2FA 2YT5A 3HTKC 4NN2A 4O64A 3T7LA 1WEPA 3PHDA 4F52B 4FO9A 3N9LA 1G25A 2F6JA 1HYJA 2K17A 2YW8A 1F62A 4Q6FA 2PNXA 3KQIA 4IC3A 5G0FA 1WENA 4PPEA 2Y1NA 4ZQLA 2EA6A 3L1XA 3U5PA 2EGPA 2LN0A 4FIPA 3O70A 2K1JA 2M6MA 2VJEA 5LKUA 4B86C 4UP0A 5TRBA 1RMDA 1N87A 2Y43A 4CCGX 3ZYQA 3N9OA 1WEWA 1DVPA 4R2YA 5G04B 2MT5A 5I3LA 4FJCA 2MNZA 4GNEA 4TKPB 2LXPC 4AUQB 4CA1A 2L43A 1VFYA 2IDAA 5TDRA 2L5UA 2CSYA 2YSMA 4WA6A 2CT2A 2MD7B 2FUUA 2OXQC 5TABA 2EODA 3T6RA 5B8DA 5FEYA 4AVXA 1WEMA 5H1UA 3N9QA 5B79A 1WEQA 3IHPA 4R8PK 4YBSA 1MM3A 2I50A 4YAXA 3M99A 2ECWA 2K16A 4I7CA 3M62A 2ECNA 2YHNA 1LDJB 2LGVA 4YABA 2QICA 1E4UA 2YUCA 3C5KA 3MHHA 2G6QA 4BHWA 3KV6A 5FERA 3U5NA 4LJNA 4YBMA 1LDKC 4I7DA 3DPLR 2CKLA 4V3KC 2CKLB 5B75A 2G43A 1JM7A 3PURA 4UI9B 3EB5A 2KWOA 5H1VA 2Y1MA 5D1MB 3LQHA 2JMDA 1WEVA 2F6NA 2KGIA 2E6RA 4YC9A 2ECVA 2KGGA 5B76A 1WIMA 4N4FA 3HCTA 2LQ6A 2KR4A 2YU4A 1CHCA 5C11A 2MNYA 4LLBA 4P5OB 2KWKA 3O7AA 4N3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX U;  4A49 A;  3N9M A;  1IYM A;  5FB1 A;  2G45 A;  3O34 A;  2H0D A;  2KE1 A;  5B78 A;  2M3H A;  2FUI A;  4R7E A;  4BBQ A;  3KV5 A;  1Z2Q A;  2JMJ A;  4GNG A;  5H1T A;  4YBT A;  5LKZ A;  2YQL A;  1JOC A;  1WE9 A;  5J3X A;  5H9M A;  5EYA F;  2KFT A;  1BOR A;  3N9N A;  3O33 A;  2L0B A;  5G05 B;  1Z60 A;  2MA6 A;  3ZVY A;  4MSX A;  2VPE A;  2KYU A;  3SOX A;  4AP4 A;  4A4B A;  1XWH A;  3LQI A;  4LAD B;  2VP7 A;  2AN6 A;  4YAD A;  2H0D B;  2MUM A;  3O36 A;  4IC2 A;  4WZ3 B;  4AYC B;  5JG6 A;  2C2V S;  3NG2 A;  3ZNI A;  2UZG A;  2ECI A;  2K4D A;  4S3O C;  3O35 A;  2LGK A;  5C13 A;  2ECG A;  4L7X A;  1HYI A;  2ECT A;  3SOW A;  3MHS A;  4V3L C;  2FSA A;  2JRJ A;  4S3O B;  4GND A;  1Z6U A;  2YSJ A;  2L75 A;  4A4C A;  2MA5 A;  1U6G B;  1FP0 A;  1X4U A;  3GV4 A;  2VPB A;  4YAT A;  2KIZ A;  4FK5 A;  3U5M A;  2MIQ A;  1VYX A;  3L11 A;  4AYC A;  4C9Z A;  2VNF A;  2RI7 A;  5TBN A;  4UP5 A;  4L58 A;  3ZVZ B;  3C6W A;  2KWN A;  3U5O A;  2YYR A;  2VJE B;  2BAY A;  3RPG B;  5B77 A;  2HYE D;  3PUQ A;  2YHO A;  2YUR A;  4I7B A;  3LRQ A;  2PUY A;  2M1R A;  2VPD A;  3L1Z B;  1WIL A;  2D8S A;  1ZBD B;  5LKX A;  5AIT A;  1V87 A;  3O37 A;  4X3G A;  2LDR A;  5D1L B;  3ZPV 1;  2NAA A;  1FBV A;  2C2L A;  5DKA A;  1WGM A;  2LV9 A;  2ZET C;  4QF2 A;  5KH9 A;  4QF3 A;  2JMI A;  1WFK A;  5FB0 A;  1T1H A;  2DX8 A;  3N9P A;  5KH7 A;  3DQV R;  2LGL A;  2YRE A;  2HDP A;  3HCU A;  3RPG C;  2LGG A;  4B7Y C;  3ZTG A;  3SOU A;  1WEU A;  3I2D A;  2M85 A;  2KU3 A;  2CSZ A;  4LKA A;  3FL2 A;  3M63 A;  3GL6 A;  2LXH C;  5AIU A;  3RTR B;  2F42 A;  2KWJ A;  3EB6 A;  4PTB A;  2L80 A;  2ECJ A;  3ASL A;  3KNV A;  2XB1 A;  2QIZ A;  2E6S A;  5LCW B;  5KH3 A;  1X4J A;  4LK9 A;  1MM2 A;  2KRE A;  4WZ2 A;  2QJ0 A;  4ZDT A;  1JM7 B;  3VK6 A;  5D1K B;  1VD4 A;  2MD8 C;  5DIN A;  3QZV A;  1X4I A;  4WZ0 A;  2LRI C;  2XEU A;  4A0C D;  2YQM A;  2RSD A;  2VJF B;  3LQJ A;  4XI1 A;  1WEO A;  4MVT A;  4GNF A;  2VJF A;  1WEE A;  2VPG A;  4W4U A;  3HCS A;  4GB0 A;  3SHB A;  5TDW A;  3ZPV E;  5LKT A;  3V43 A;  1WES A;  1K2F A;  2YT5 A;  3HTK C;  4NN2 A;  4O64 A;  3T7L A;  1WEP A;  3PHD A;  4F52 B;  4FO9 A;  3N9L A;  1G25 A;  2F6J A;  1HYJ A;  2K17 A;  2YW8 A;  1F62 A;  4Q6F A;  2PNX A;  3KQI A;  4IC3 A;  5G0F A;  1WEN A;  4PPE A;  2Y1N A;  4ZQL A;  2EA6 A;  3L1X A;  3U5P A;  2EGP A;  2LN0 A;  4FIP A;  3O70 A;  2K1J A;  2M6M A;  2VJE A;  5LKU A;  4B86 C;  4UP0 A;  5TRB A;  1RMD A;  1N87 A;  2Y43 A;  4CCG X;  3ZYQ A;  3N9O A;  1WEW A;  1DVP A;  4R2Y A;  5G04 B;  2MT5 A;  5I3L A;  4FJC A;  2MNZ A;  4GNE A;  4TKP B;  2LXP C;  4AUQ B;  4CA1 A;  2L43 A;  1VFY A;  2IDA A;  5TDR A;  2L5U A;  2CSY A;  2YSM A;  4WA6 A;  2CT2 A;  2MD7 B;  2FUU A;  2OXQ C;  5TAB A;  2EOD A;  3T6R A;  5B8D A;  5FEY A;  4AVX A;  1WEM A;  5H1U A;  3N9Q A;  5B79 A;  1WEQ A;  3IHP A;  4R8P K;  4YBS A;  1MM3 A;  2I50 A;  4YAX A;  3M99 A;  2ECW A;  2K16 A;  4I7C A;  3M62 A;  2ECN A;  2YHN A;  1LDJ B;  2LGV A;  4YAB A;  2QIC A;  1E4U A;  2YUC A;  3C5K A;  3MHH A;  2G6Q A;  4BHW A;  3KV6 A;  5FER A;  3U5N A;  4LJN A;  4YBM A;  1LDK C;  4I7D A;  3DPL R;  2CKL A;  4V3K C;  2CKL B;  5B75 A;  2G43 A;  1JM7 A;  3PUR A;  4UI9 B;  3EB5 A;  2KWO A;  5H1V A;  2Y1M A;  5D1M B;  3LQH A;  2JMD A;  1WEV A;  2F6N A;  2KGI A;  2E6R A;  4YC9 A;  2ECV A;  2KGG A;  5B76 A;  1WIM A;  4N4F A;  3HCT A;  2LQ6 A;  2KR4 A;  2YU4 A;  1CHC A;  5C11 A;  2MNY A;  4LLB A;  4P5O B;  2KWK A;  3O7A A;  4N3W A; 
#chains in the Genus database with same CATH topology
 4ZUX U;  4A49 A;  3N9M A;  1IYM A;  5FB1 A;  5K3Q A;  2G45 A;  3O34 A;  2H0D A;  2KE1 A;  5B78 A;  2M3H A;  2FUI A;  4R7E A;  5SVY A;  4BBQ A;  3KV5 A;  2KKX A;  3LJU X;  1Z2Q A;  2JMJ A;  4GNG A;  5H1T A;  4YBT A;  5LKZ A;  2YQL A;  1JOC A;  1WE9 A;  5J3X A;  5H9M A;  5EYA F;  2KFT A;  1BOR A;  3N9N A;  1MBM A;  3O33 A;  2L0B A;  5G05 B;  1Z60 A;  2MA6 A;  3ZVY A;  4MSX A;  2VPE A;  2KYU A;  3SOX A;  4AP4 A;  4A4B A;  2YVR A;  3H7H A;  1XWH A;  3LQI A;  4LAD B;  2VP7 A;  2AN6 A;  4YAD A;  4OGC A;  2H0D B;  2MUM A;  3O36 A;  4IC2 A;  4WZ3 B;  3SUB A;  4AYC B;  5JG6 A;  2C2V S;  3NG2 A;  3ZNI A;  2UZG A;  2ECI A;  3DDT A;  2K4D A;  4S3O C;  3O35 A;  2LGK A;  5C13 A;  2ECG A;  4L7X A;  4F1P A;  3Q1D A;  1HYI A;  1DCQ A;  3O47 A;  2ECT A;  3SOW A;  3MHS A;  4V3L C;  2FSA A;  2JRJ A;  3LVQ E;  4S3O B;  4GND A;  1Z6U A;  3E2D A;  2YSJ A;  2L75 A;  2XOZ A;  4A4C A;  2MA5 A;  1U6G B;  1FP0 A;  1X4U A;  4H9D A;  3GV4 A;  2VPB A;  4YAT A;  2KIZ A;  4FK5 A;  2MIQ A;  3U5M A;  3LVR E;  1VYX A;  3L11 A;  4AYC A;  4C9Z A;  2VNF A;  3KDE C;  2RI7 A;  5TBN A;  4UP5 A;  4L58 A;  3ZVZ B;  3C6W A;  2KWN A;  3U5O A;  2JM3 A;  2YYR A;  2VJE B;  2BAY A;  3RPG B;  5B77 A;  3FAN A;  2HYE D;  3PUQ A;  2YHO A;  2EGM A;  2YUR A;  4I7B A;  3FAO A;  3LRQ A;  2PUY A;  2M1R A;  5SVX A;  3L1Z B;  2VPD A;  2DSM A;  2B0O E;  1WIL A;  2D8S A;  1ZBD B;  5LKX A;  5AIT A;  1V87 A;  3O37 A;  4X3G A;  2LDR A;  5D1L B;  3ZPV 1;  2NAA A;  1FBV A;  2C2L A;  5DKA A;  2FFW A;  1WGM A;  5SVI B;  2LV9 A;  2ZET C;  4QF2 A;  2D8U A;  5KH9 A;  4QF3 A;  2JMI A;  2XOC A;  2P57 A;  1WFK A;  5FB0 A;  1T1H A;  2DX8 A;  3N9P A;  5KH7 A;  3DQV R;  2LGL A;  2YRE A;  2CSV A;  2HDP A;  3HCU A;  3RPG C;  2LGG A;  2XOY A;  4B7Y C;  3ZTG A;  3SOU A;  1WEU A;  3I2D A;  2M85 A;  2KU3 A;  3FEH A;  2CSZ A;  4LKA A;  4N3W A;  3FL2 A;  3M63 A;  3GL6 A;  3MDB C;  4Z0R A;  2LXH C;  2E61 A;  5AIU A;  3RTR B;  2F42 A;  2KWJ A;  3PLW A;  3EB6 A;  4PTB A;  2L80 A;  2ECJ A;  3ASL A;  3KNV A;  2XB1 A;  2QIZ A;  2E6S A;  5LCW B;  5KH3 A;  1X4J A;  4LK9 A;  1MM2 A;  2KRE A;  4WZ2 A;  2QJ0 A;  4ZDT A;  2M13 A;  1JM7 B;  3VK6 A;  2FD4 A;  5D1K B;  1VD4 A;  2MD8 C;  5DIN A;  3QZV A;  1X4I A;  4WZ0 A;  2LRI C;  2XEU A;  4A0C D;  2YQM A;  2RSD A;  2VJF B;  2CRW A;  3LQJ A;  2CRR A;  4XI1 A;  1WEO A;  4MVT A;  4GNF A;  2VJF A;  1WEE A;  2VPG A;  4W4U A;  3HCS A;  4GB0 A;  3SHB A;  5TDW A;  3ZPV E;  5LKT A;  3V43 A;  1WES A;  1K2F A;  2YT5 A;  3HTK C;  4NN2 A;  4O64 A;  3T7L A;  4QQ4 A;  1WEP A;  2MKE A;  2CON A;  3PHD A;  4F52 B;  4FO9 A;  3N9L A;  2L7P A;  1G25 A;  2RR4 A;  2F6J A;  1HYJ A;  2K17 A;  2YW8 A;  1F62 A;  2IQJ A;  2XP0 A;  4Q6F A;  2PNX A;  2DJA A;  3KQI A;  2OWA A;  4IC3 A;  5G0F A;  1WEN A;  4PPE A;  2Y1N A;  4ZQL A;  2EXU A;  2EA6 A;  3L1X A;  3U5P A;  2EGP A;  2LN0 A;  3JUE A;  4FIP A;  3O70 A;  2K1J A;  2M6M A;  2JUN A;  2VJE A;  5LKU A;  4B86 C;  4UP0 A;  3FJU B;  5TRB A;  1RMD A;  1N87 A;  2Y43 A;  4CCG X;  3ZYQ A;  3N9O A;  1WEW A;  1DVP A;  4R2Y A;  5G04 B;  2MT5 A;  5I3L A;  4FJC A;  2MNZ A;  3DWD A;  4GNE A;  4TKP B;  2LXP C;  4AUQ B;  4CA1 A;  2L43 A;  1VFY A;  2IDA A;  5TDR A;  2L5U A;  2CSY A;  2YSM A;  4WA6 A;  2CT2 A;  2MD7 B;  2FUU A;  2OXQ C;  5TAB A;  2EOD A;  3T6R A;  5B8D A;  5FEY A;  4AVX A;  1WEM A;  5H1U A;  3N9Q A;  3FM8 C;  5B79 A;  1WEQ A;  3IHP A;  4R8P K;  4YBS A;  1MM3 A;  2I50 A;  4YAX A;  3M99 A;  2ECW A;  2K16 A;  4I7C A;  3M62 A;  2ECN A;  2YHN A;  1LDJ B;  2LGV A;  4YAB A;  2QIC A;  1E4U A;  2YUC A;  3C5K A;  3MHH A;  2G6Q A;  4BHW A;  3KV6 A;  5FER A;  3U5N A;  2LAU A;  4LJN A;  4YBM A;  5SVI A;  1LDK C;  4I7D A;  3DPL R;  2CKL A;  4V3K C;  2KKY A;  2CKL B;  5B75 A;  2G43 A;  1JM7 A;  3PUR A;  4UI9 B;  3EB5 A;  2KWO A;  5H1V A;  2Y1M A;  5D1M B;  3M7K A;  3LQH A;  2JMD A;  1WEV A;  2F6N A;  2KGI A;  2E6R A;  3T9K A;  4OGE A;  4YC9 A;  4O62 A;  2ECV A;  3LDY A;  2KGG A;  5B76 A;  1WIM A;  4N4F A;  3HCT A;  2LQ6 A;  2KR4 A;  2YU4 A;  1CHC A;  5C11 A;  2MNY A;  4LLB A;  4P5O B;  2KWK A;  3O7A A;  4Z0O A; 
#chains in the Genus database with same CATH homology
 4ZUX U;  4A49 A;  3N9M A;  1IYM A;  5FB1 A;  2G45 A;  3O34 A;  2H0D A;  2KE1 A;  5B78 A;  2M3H A;  2FUI A;  4R7E A;  4BBQ A;  3KV5 A;  1Z2Q A;  2JMJ A;  4GNG A;  5H1T A;  4YBT A;  5LKZ A;  2YQL A;  1JOC A;  1WE9 A;  5J3X A;  5H9M A;  5EYA F;  2KFT A;  1BOR A;  3N9N A;  3O33 A;  2L0B A;  5G05 B;  1Z60 A;  2MA6 A;  3ZVY A;  4MSX A;  2VPE A;  2KYU A;  3SOX A;  4AP4 A;  4A4B A;  1XWH A;  3LQI A;  4LAD B;  2VP7 A;  2AN6 A;  4YAD A;  2H0D B;  2MUM A;  3O36 A;  4IC2 A;  4WZ3 B;  4AYC B;  5JG6 A;  2C2V S;  3NG2 A;  3ZNI A;  2UZG A;  2ECI A;  2K4D A;  4S3O C;  3O35 A;  2LGK A;  5C13 A;  2ECG A;  4L7X A;  1HYI A;  2ECT A;  3SOW A;  3MHS A;  4V3L C;  2FSA A;  2JRJ A;  4S3O B;  4GND A;  1Z6U A;  2YSJ A;  2L75 A;  4A4C A;  2MA5 A;  1U6G B;  1FP0 A;  1X4U A;  3GV4 A;  2VPB A;  4YAT A;  2KIZ A;  4FK5 A;  3U5M A;  2MIQ A;  1VYX A;  3L11 A;  4AYC A;  4C9Z A;  2VNF A;  2RI7 A;  5TBN A;  4UP5 A;  4L58 A;  3ZVZ B;  3C6W A;  2KWN A;  3U5O A;  2YYR A;  2VJE B;  2BAY A;  3RPG B;  5B77 A;  2HYE D;  3PUQ A;  2YHO A;  2YUR A;  4I7B A;  3LRQ A;  2PUY A;  2M1R A;  2VPD A;  3L1Z B;  1WIL A;  2D8S A;  1ZBD B;  5LKX A;  5AIT A;  1V87 A;  3O37 A;  4X3G A;  2LDR A;  5D1L B;  3ZPV 1;  2NAA A;  1FBV A;  2C2L A;  5DKA A;  1WGM A;  2LV9 A;  2ZET C;  4QF2 A;  5KH9 A;  4QF3 A;  2JMI A;  1WFK A;  5FB0 A;  1T1H A;  2DX8 A;  3N9P A;  5KH7 A;  3DQV R;  2LGL A;  2YRE A;  2HDP A;  3HCU A;  3RPG C;  2LGG A;  4B7Y C;  3ZTG A;  3SOU A;  1WEU A;  3I2D A;  2M85 A;  2KU3 A;  2CSZ A;  4LKA A;  3FL2 A;  3M63 A;  3GL6 A;  2LXH C;  5AIU A;  3RTR B;  2F42 A;  2KWJ A;  3EB6 A;  4PTB A;  2L80 A;  2ECJ A;  3ASL A;  3KNV A;  2XB1 A;  2QIZ A;  2E6S A;  5LCW B;  5KH3 A;  1X4J A;  4LK9 A;  1MM2 A;  2KRE A;  4WZ2 A;  2QJ0 A;  4ZDT A;  1JM7 B;  3VK6 A;  5D1K B;  1VD4 A;  2MD8 C;  5DIN A;  3QZV A;  1X4I A;  4WZ0 A;  2LRI C;  2XEU A;  4A0C D;  2YQM A;  2RSD A;  2VJF B;  3LQJ A;  4XI1 A;  1WEO A;  4MVT A;  4GNF A;  2VJF A;  1WEE A;  2VPG A;  4W4U A;  3HCS A;  4GB0 A;  3SHB A;  5TDW A;  3ZPV E;  5LKT A;  3V43 A;  1WES A;  1K2F A;  2YT5 A;  3HTK C;  4NN2 A;  4O64 A;  3T7L A;  1WEP A;  3PHD A;  4F52 B;  4FO9 A;  3N9L A;  1G25 A;  2F6J A;  1HYJ A;  2K17 A;  2YW8 A;  1F62 A;  4Q6F A;  2PNX A;  3KQI A;  4IC3 A;  5G0F A;  1WEN A;  4PPE A;  2Y1N A;  4ZQL A;  2EA6 A;  3L1X A;  3U5P A;  2EGP A;  2LN0 A;  4FIP A;  3O70 A;  2K1J A;  2M6M A;  2VJE A;  5LKU A;  4B86 C;  4UP0 A;  5TRB A;  1RMD A;  1N87 A;  2Y43 A;  4CCG X;  3ZYQ A;  3N9O A;  1WEW A;  1DVP A;  4R2Y A;  5G04 B;  2MT5 A;  5I3L A;  4FJC A;  2MNZ A;  4GNE A;  4TKP B;  2LXP C;  4AUQ B;  4CA1 A;  2L43 A;  1VFY A;  2IDA A;  5TDR A;  2L5U A;  2CSY A;  2YSM A;  4WA6 A;  2CT2 A;  2MD7 B;  2FUU A;  2OXQ C;  5TAB A;  2EOD A;  3T6R A;  5B8D A;  5FEY A;  4AVX A;  1WEM A;  5H1U A;  3N9Q A;  5B79 A;  1WEQ A;  3IHP A;  4R8P K;  4YBS A;  1MM3 A;  2I50 A;  4YAX A;  3M99 A;  2ECW A;  2K16 A;  4I7C A;  3M62 A;  2ECN A;  2YHN A;  1LDJ B;  2LGV A;  4YAB A;  2QIC A;  1E4U A;  2YUC A;  3C5K A;  3MHH A;  2G6Q A;  4BHW A;  3KV6 A;  5FER A;  3U5N A;  4LJN A;  4YBM A;  1LDK C;  4I7D A;  3DPL R;  2CKL A;  4V3K C;  2CKL B;  5B75 A;  2G43 A;  1JM7 A;  3PUR A;  4UI9 B;  3EB5 A;  2KWO A;  5H1V A;  2Y1M A;  5D1M B;  3LQH A;  2JMD A;  1WEV A;  2F6N A;  2KGI A;  2E6R A;  4YC9 A;  2ECV A;  2KGG A;  5B76 A;  1WIM A;  4N4F A;  3HCT A;  2LQ6 A;  2KR4 A;  2YU4 A;  1CHC A;  5C11 A;  2MNY A;  4LLB A;  4P5O B;  2KWK A;  3O7A A;  4N3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...