2MD8C

Nmr structure of sp140 phd finger cis conformer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'GAMGMRNLDECEVCRDGGELFCCDTCSRVFHEDCHIPPVEAERTPWNCIFCRMKES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear body protein SP140
publication title Structure of human Sp140 PHD finger: an atypical fold interacting with Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2013-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2md8C00
2M3HA 3N9QA 2G45A 4FIPA 2YSJA 2VNFA 5EYAF 5FERA 5D1KB 1T1HA 2L0BA 3O7AA 5G05B 3NG2A 4S3OC 1JM7A 2YYRA 2HDPA 2KYUA 3O70A 2H0DB 2KGIA 4BHWA 2ECIA 2FUUA 5FEYA 5D1LB 2EODA 4TKPB 3ZPV1 4WA6A 2VPGA 2L75A 2MNZA 3RPGB 2LGGA 4LJNA 2LDRA 2M6MA 2LGKA 3VK6A 4LLBA 2CSZA 2KWJA 4UP0A 2XB1A 5LKTA 5H1TA 2LRIC 5C11A 4C9ZA 2YREA 3SHBA 1RMDA 1G25A 3N9PA 1U6GB 4YABA 5H1UA 1WIMA 2VPBA 2YUCA 2YSMA 2QIZA 5B77A 1JOCA 2VJFA 2XEUA 1MM3A 2HYED 4A4CA 3KV5A 2E6SA 2JMDA 4IC2A 1LDKC 2ECJA 1Z6UA 5FB1A 1FP0A 3ASLA 2Y1NA 4LADB 2M1RA 2IDAA 1X4IA 5G0FA 1VYXA 5B8DA 3N9LA 3L1ZB 3T7LA 2H0DA 3M99A 2KREA 5LKXA 4GNFA 2L5UA 2YQLA 2ZETC 2VP7A 5D1MB 2KWNA 2RI7A 4R2YA 2VJFB 2ECWA 2RSDA 2EA6A 4YATA 2YT5A 1VD4A 2YHOA 5B75A 4ZUXU 5C13A 1WILA 3C6WA 3PHDA 2F6NA 4PTBA 2UZGA 4QF2A 3RPGC 2MT5A 4YADA 4A4BA 2MD8C 3EB6A 3I2DA 3ZTGA 3O37A 2L43A 2DX8A 1WE9A 2MIQA 2CT2A 5AIUA 2C2LA 5DKAA 4FO9A 2PUYA 2LXHC 1E4UA 2G43A 2Y43A 1VFYA 1WGMA 3KQIA 1FBVA 4YBSA 1WEVA 1Z60A 5LKZA 4GB0A 4GNGA 4ZDTA 4A49A 2LXPC 5B78A 4L7XA 2C2VS 3QZVA 2CKLA 4AUQB 3DPLR 2MD7B 1HYJA 4FK5A 2LGVA 2JMIA 3ZPVE 4UP5A 1WESA 3N9NA 4BBQA 3MHHA 2YU4A 3FL2A 1XWHA 2LQ6A 2F42A 2MA5A 2YW8A 4I7CA 2MNYA 4IC3A 2NAAA 4YBTA 4B7YC 4WZ3B 5I3LA 2YHNA 3SOWA 1N87A 3M63A 2D8SA 1F62A 2CKLB 4MSXA 1HYIA 3KNVA 3L1XA 2KGGA 4X3GA 3PUQA 2M85A 2KWKA 5FB0A 5B79A 5AITA 1V87A 2BAYA 4GNEA 1WEPA 4Q6FA 2KU3A 4UI9B 4R7EA 5H1VA 3GV4A 1BORA 2E6RA 2MA6A 3ZVZB 5KH3A 2K1JA 4WZ0A 4LK9A 2Y1MA 3L11A 4CCGX 2VJEA 3PURA 1WEMA 2FSAA 4WZ2A 2F6JA 5B76A 4CA1A 2ECNA 3LRQA 4AP4A 3O34A 3O36A 1WEQA 4I7DA 4AVXA 3SOUA 5TDRA 4ZQLA 3HCSA 1Z2QA 2ECVA 3HCUA 1WEOA 1X4UA 5KH9A 2PNXA 4MVTA 5LCWB 4XI1A 1CHCA 2QICA 2YURA 2VJEB 2VPEA 3KV6A 3LQHA 3MHSA 4LKAA 2ECTA 4NN2A 3N9OA 2FUIA 3IHPA 4B86C 2LN0A 5J3XA 2AN6A 3HCTA 2LGLA 4YAXA 4P5OB 1X4JA 1LDJB 3U5NA 2JMJA 5TABA 4FJCA 3M62A 3ZYQA 2KWOA 2CSYA 4S3OB 5TRBA 2K17A 3LQIA 1WFKA 4PPEA 3N9MA 4AYCA 1WENA 3C5KA 3U5MA 2ECGA 1IYMA 1JM7B 2KE1A 3LQJA 5H9MA 4N4FA 4V3LC 4YC9A 2I50A 4W4UA 3EB5A 2YQMA 2K4DA 3ZVYA 4R8PK 2K16A 2QJ0A 4N3WA 1ZBDB 4QF3A 5KH7A 4O64A 4L58A 2LV9A 1WEEA 2G6QA 3U5OA 1WEUA 2OXQC 1DVPA 2JRJA 3GL6A 1MM2A 2EGPA 2MUMA 3HTKC 4I7BA 3V43A 3SOXA 4F52B 3O35A 4AYCB 1K2FA 4V3KC 5TBNA 2L80A 5DINA 3RTRB 2KFTA 3U5PA 3T6RA 2KIZA 2KR4A 1WEWA 5TDWA 4A0CD 4GNDA 3DQVR 5JG6A 5G04B 5LKUA 2VPDA 3O33A 3ZNIA 4YBMA
chains in the Genus database with same CATH superfamily
2M3HA 2M13A 3N9QA 4OGCA 2G45A 4FIPA 4Z0RA 2YSJA 2VNFA 5EYAF 5FERA 5D1KB 2XOZA 2L7PA 1T1HA 2L0BA 3O7AA 5G05B 3NG2A 4S3OC 1JM7A 2YYRA 2KKXA 2HDPA 2KYUA 3O70A 2H0DB 3DDTA 3LJUX 2KGIA 4BHWA 2ECIA 2FUUA 5FEYA 5D1LB 2EODA 4TKPB 3ZPV1 4WA6A 2VPGA 2L75A 2MNZA 3RPGB 2LGGA 4LJNA 2LDRA 2M6MA 2DJAA 2LGKA 3VK6A 2XOCA 2CSZA 4LLBA 1MBMA 2KWJA 4UP0A 2XB1A 5LKTA 5H1TA 2LRIC 5C11A 4C9ZA 2YREA 3SHBA 1RMDA 1G25A 3N9PA 4OGEA 1U6GB 4YABA 5H1UA 1WIMA 2VPBA 2YUCA 2YSMA 2QIZA 5B77A 1JOCA 2VJFA 2XEUA 1MM3A 2HYED 4A4CA 3KV5A 2JUNA 2E6SA 2JMDA 4IC2A 1LDKC 2ECJA 3KDEC 1Z6UA 5FB1A 1FP0A 3ASLA 2XP0A 2Y1NA 4LADB 2M1RA 3H7HA 2IDAA 1X4IA 3LVRE 1VYXA 5G0FA 5B8DA 3N9LA 3L1ZB 3T7LA 3PLWA 2H0DA 3M99A 2KREA 5LKXA 4GNFA 2L5UA 2YQLA 2ZETC 2VP7A 5D1MB 3FAOA 2KWNA 2RI7A 4R2YA 2KKYA 2VJFB 2ECWA 2RSDA 2EA6A 4YATA 2YT5A 1VD4A 2YHOA 2CSVA 2D8UA 5B75A 4ZUXU 2IQJA 5C13A 1WILA 3C6WA 3PHDA 2F6NA 4PTBA 2UZGA 4QF2A 3RPGC 2MT5A 4YADA 4A4BA 2MD8C 3EB6A 3I2DA 3SUBA 3ZTGA 3O37A 2L43A 2DX8A 2YVRA 1WE9A 2MIQA 2CT2A 5AIUA 2C2LA 5DKAA 2EGMA 4FO9A 2PUYA 2LXHC 5SVYA 1E4UA 2G43A 2Y43A 1VFYA 1WGMA 3KQIA 2FD4A 1FBVA 4YBSA 1WEVA 1Z60A 5LKZA 4GB0A 4GNGA 4ZDTA 4A49A 2LXPC 5B78A 4L7XA 2C2VS 3QZVA 2CKLA 4AUQB 3DPLR 2MD7B 1HYJA 4FK5A 2LGVA 2JMIA 4H9DA 2XOYA 3ZPVE 4UP5A 1WESA 3MDBC 2CRWA 3N9NA 4BBQA 3MHHA 2YU4A 3FM8C 2EXUA 3FL2A 1XWHA 3M7KA 2LQ6A 2F42A 4Z0OA 2MA5A 2YW8A 3DWDA 4I7CA 2MNYA 4IC3A 2NAAA 4YBTA 4B7YC 4WZ3B 5I3LA 2YHNA 3SOWA 4O62A 1N87A 3M63A 2D8SA 1F62A 2CKLB 2B0OE 4MSXA 3KNVA 3L1XA 1HYIA 2KGGA 3LVQE 2FFWA 4X3GA 3T9KA 3PUQA 2M85A 2KWKA 5FB0A 5B79A 5AITA 1V87A 2BAYA 4GNEA 1WEPA 4Q6FA 2KU3A 4UI9B 4R7EA 5H1VA 3GV4A 1BORA 2E6RA 1DCQA 2MA6A 5SVIA 3ZVZB 5KH3A 2K1JA 4WZ0A 2DSMA 4LK9A 2Y1MA 2OWAA 3L11A 4CCGX 2VJEA 3PURA 1WEMA 2FSAA 3O47A 4WZ2A 2F6JA 5SVXA 5B76A 4CA1A 2ECNA 3LRQA 4AP4A 3O34A 3O36A 2E61A 4F1PA 1WEQA 4I7DA 4AVXA 3SOUA 5TDRA 4ZQLA 3HCSA 1Z2QA 2ECVA 3HCUA 1WEOA 1X4UA 5KH9A 2PNXA 3FEHA 4MVTA 5LCWB 3Q1DA 4XI1A 1CHCA 5SVIB 3LDYA 2QICA 2YURA 2VJEB 2VPEA 3KV6A 3LQHA 3MHSA 4LKAA 2ECTA 3E2DA 3N9OA 4NN2A 2FUIA 3IHPA 4B86C 2LN0A 5J3XA 2AN6A 3HCTA 2LGLA 4YAXA 4P5OB 1X4JA 1LDJB 3U5NA 2JMJA 5TABA 4FJCA 3M62A 3ZYQA 3FANA 2KWOA 2LAUA 2CSYA 4S3OB 5TRBA 2K17A 3LQIA 1WFKA 4PPEA 3N9MA 4AYCA 1WENA 3C5KA 2CONA 3U5MA 2ECGA 4QQ4A 1IYMA 1JM7B 2KE1A 3LQJA 5H9MA 4N4FA 4V3LC 2I50A 3EB5A 2YQMA 2K4DA 4W4UA 4YC9A 3ZVYA 4R8PK 2K16A 2QJ0A 4N3WA 1ZBDB 4QF3A 5KH7A 4O64A 4L58A 2LV9A 1WEEA 2G6QA 3U5OA 1WEUA 2OXQC 1DVPA 5K3QA 2JRJA 3GL6A 1MM2A 3FJUB 3JUEA 2EGPA 2P57A 2MUMA 3HTKC 4I7BA 3V43A 2CRRA 3SOXA 4F52B 3O35A 4AYCB 1K2FA 4V3KC 5TBNA 2L80A 5DINA 3RTRB 2KFTA 3U5PA 3T6RA 2RR4A 2KIZA 2KR4A 1WEWA 2MKEA 5TDWA 4A0CD 4GNDA 3DQVR 5JG6A 5G04B 5LKUA 2VPDA 2JM3A 3O33A 3ZNIA 4YBMA
chains in the Genus database with same CATH topology
2M3HA 3N9QA 2G45A 4FIPA 2YSJA 2VNFA 5EYAF 5FERA 5D1KB 1T1HA 2L0BA 3O7AA 5G05B 3NG2A 4S3OC 1JM7A 2YYRA 2HDPA 2KYUA 3O70A 2H0DB 2KGIA 4BHWA 2ECIA 2FUUA 5FEYA 5D1LB 2EODA 4TKPB 3ZPV1 4WA6A 2VPGA 2L75A 2MNZA 3RPGB 2LGGA 4LJNA 2LDRA 2M6MA 2LGKA 3VK6A 4LLBA 2CSZA 2KWJA 4UP0A 2XB1A 5LKTA 5H1TA 2LRIC 5C11A 4C9ZA 2YREA 3SHBA 1RMDA 1G25A 3N9PA 1U6GB 4YABA 5H1UA 1WIMA 2VPBA 2YUCA 2YSMA 2QIZA 5B77A 1JOCA 2VJFA 2XEUA 1MM3A 2HYED 4A4CA 3KV5A 2E6SA 2JMDA 4IC2A 1LDKC 2ECJA 1Z6UA 5FB1A 1FP0A 3ASLA 2Y1NA 4LADB 2M1RA 2IDAA 1X4IA 5G0FA 1VYXA 5B8DA 3N9LA 3L1ZB 3T7LA 2H0DA 3M99A 2KREA 5LKXA 4GNFA 2L5UA 2YQLA 2ZETC 2VP7A 5D1MB 2KWNA 2RI7A 4R2YA 2VJFB 2ECWA 2RSDA 2EA6A 4YATA 2YT5A 1VD4A 2YHOA 5B75A 4ZUXU 5C13A 1WILA 3C6WA 3PHDA 2F6NA 4PTBA 2UZGA 4QF2A 3RPGC 2MT5A 4YADA 4A4BA 2MD8C 3EB6A 3I2DA 3ZTGA 3O37A 2L43A 2DX8A 1WE9A 2MIQA 2CT2A 5AIUA 2C2LA 5DKAA 4FO9A 2PUYA 2LXHC 1E4UA 2G43A 2Y43A 1VFYA 1WGMA 3KQIA 1FBVA 4YBSA 1WEVA 1Z60A 5LKZA 4GB0A 4GNGA 4ZDTA 4A49A 2LXPC 5B78A 4L7XA 2C2VS 3QZVA 2CKLA 4AUQB 3DPLR 2MD7B 1HYJA 4FK5A 2LGVA 2JMIA 3ZPVE 4UP5A 1WESA 3N9NA 4BBQA 3MHHA 2YU4A 3FL2A 1XWHA 2LQ6A 2F42A 2MA5A 2YW8A 4I7CA 2MNYA 4IC3A 2NAAA 4YBTA 4B7YC 4WZ3B 5I3LA 2YHNA 3SOWA 1N87A 3M63A 2D8SA 1F62A 2CKLB 4MSXA 1HYIA 3KNVA 3L1XA 2KGGA 4X3GA 3PUQA 2M85A 2KWKA 5FB0A 5B79A 5AITA 1V87A 2BAYA 4GNEA 1WEPA 4Q6FA 2KU3A 4UI9B 4R7EA 5H1VA 3GV4A 1BORA 2E6RA 2MA6A 3ZVZB 5KH3A 2K1JA 4WZ0A 4LK9A 2Y1MA 3L11A 4CCGX 2VJEA 3PURA 1WEMA 2FSAA 4WZ2A 2F6JA 5B76A 4CA1A 2ECNA 3LRQA 4AP4A 3O34A 3O36A 1WEQA 4I7DA 4AVXA 3SOUA 5TDRA 4ZQLA 3HCSA 1Z2QA 2ECVA 3HCUA 1WEOA 1X4UA 5KH9A 2PNXA 4MVTA 5LCWB 4XI1A 1CHCA 2QICA 2YURA 2VJEB 2VPEA 3KV6A 3LQHA 3MHSA 4LKAA 2ECTA 4NN2A 3N9OA 2FUIA 3IHPA 4B86C 2LN0A 5J3XA 2AN6A 3HCTA 2LGLA 4YAXA 4P5OB 1X4JA 1LDJB 3U5NA 2JMJA 5TABA 4FJCA 3M62A 3ZYQA 2KWOA 2CSYA 4S3OB 5TRBA 2K17A 3LQIA 1WFKA 4PPEA 3N9MA 4AYCA 1WENA 3C5KA 3U5MA 2ECGA 1IYMA 1JM7B 2KE1A 3LQJA 5H9MA 4N4FA 4V3LC 4YC9A 2I50A 4W4UA 3EB5A 2YQMA 2K4DA 3ZVYA 4R8PK 2K16A 2QJ0A 4N3WA 1ZBDB 4QF3A 5KH7A 4O64A 4L58A 2LV9A 1WEEA 2G6QA 3U5OA 1WEUA 2OXQC 1DVPA 2JRJA 3GL6A 1MM2A 2EGPA 2MUMA 3HTKC 4I7BA 3V43A 3SOXA 4F52B 3O35A 4AYCB 1K2FA 4V3KC 5TBNA 2L80A 5DINA 3RTRB 2KFTA 3U5PA 3T6RA 2KIZA 2KR4A 1WEWA 5TDWA 4A0CD 4GNDA 3DQVR 5JG6A 5G04B 5LKUA 2VPDA 3O33A 3ZNIA 4YBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3H A;  3N9Q A;  2G45 A;  4FIP A;  2YSJ A;  2VNF A;  5EYA F;  5FER A;  5D1K B;  1T1H A;  2L0B A;  3O7A A;  5G05 B;  3NG2 A;  4S3O C;  1JM7 A;  2YYR A;  2HDP A;  2KYU A;  3O70 A;  2H0D B;  2KGI A;  4BHW A;  2ECI A;  2FUU A;  5FEY A;  5D1L B;  2EOD A;  4TKP B;  3ZPV 1;  4WA6 A;  2VPG A;  2L75 A;  2MNZ A;  3RPG B;  2LGG A;  4LJN A;  2LDR A;  2M6M A;  2LGK A;  3VK6 A;  4LLB A;  2CSZ A;  2KWJ A;  4UP0 A;  2XB1 A;  5LKT A;  5H1T A;  2LRI C;  5C11 A;  4C9Z A;  2YRE A;  3SHB A;  1RMD A;  1G25 A;  3N9P A;  1U6G B;  4YAB A;  5H1U A;  1WIM A;  2VPB A;  2YUC A;  2YSM A;  2QIZ A;  5B77 A;  1JOC A;  2VJF A;  2XEU A;  1MM3 A;  2HYE D;  4A4C A;  3KV5 A;  2E6S A;  2JMD A;  4IC2 A;  1LDK C;  2ECJ A;  1Z6U A;  5FB1 A;  1FP0 A;  3ASL A;  2Y1N A;  4LAD B;  2M1R A;  2IDA A;  1X4I A;  5G0F A;  1VYX A;  5B8D A;  3N9L A;  3L1Z B;  3T7L A;  2H0D A;  3M99 A;  2KRE A;  5LKX A;  4GNF A;  2L5U A;  2YQL A;  2ZET C;  2VP7 A;  5D1M B;  2KWN A;  2RI7 A;  4R2Y A;  2VJF B;  2ECW A;  2RSD A;  2EA6 A;  4YAT A;  2YT5 A;  1VD4 A;  2YHO A;  5B75 A;  4ZUX U;  5C13 A;  1WIL A;  3C6W A;  3PHD A;  2F6N A;  4PTB A;  2UZG A;  4QF2 A;  3RPG C;  2MT5 A;  4YAD A;  4A4B A;  2MD8 C;  3EB6 A;  3I2D A;  3ZTG A;  3O37 A;  2L43 A;  2DX8 A;  1WE9 A;  2MIQ A;  2CT2 A;  5AIU A;  2C2L A;  5DKA A;  4FO9 A;  2PUY A;  2LXH C;  1E4U A;  2G43 A;  2Y43 A;  1VFY A;  1WGM A;  3KQI A;  1FBV A;  4YBS A;  1WEV A;  1Z60 A;  5LKZ A;  4GB0 A;  4GNG A;  4ZDT A;  4A49 A;  2LXP C;  5B78 A;  4L7X A;  2C2V S;  3QZV A;  2CKL A;  4AUQ B;  3DPL R;  2MD7 B;  1HYJ A;  4FK5 A;  2LGV A;  2JMI A;  3ZPV E;  4UP5 A;  1WES A;  3N9N A;  4BBQ A;  3MHH A;  2YU4 A;  3FL2 A;  1XWH A;  2LQ6 A;  2F42 A;  2MA5 A;  2YW8 A;  4I7C A;  2MNY A;  4IC3 A;  2NAA A;  4YBT A;  4B7Y C;  4WZ3 B;  5I3L A;  2YHN A;  3SOW A;  1N87 A;  3M63 A;  2D8S A;  1F62 A;  2CKL B;  4MSX A;  1HYI A;  3KNV A;  3L1X A;  2KGG A;  4X3G A;  3PUQ A;  2M85 A;  2KWK A;  5FB0 A;  5B79 A;  5AIT A;  1V87 A;  2BAY A;  4GNE A;  1WEP A;  4Q6F A;  2KU3 A;  4UI9 B;  4R7E A;  5H1V A;  3GV4 A;  1BOR A;  2E6R A;  2MA6 A;  3ZVZ B;  5KH3 A;  2K1J A;  4WZ0 A;  4LK9 A;  2Y1M A;  3L11 A;  4CCG X;  2VJE A;  3PUR A;  1WEM A;  2FSA A;  4WZ2 A;  2F6J A;  5B76 A;  4CA1 A;  2ECN A;  3LRQ A;  4AP4 A;  3O34 A;  3O36 A;  1WEQ A;  4I7D A;  4AVX A;  3SOU A;  5TDR A;  4ZQL A;  3HCS A;  1Z2Q A;  2ECV A;  3HCU A;  1WEO A;  1X4U A;  5KH9 A;  2PNX A;  4MVT A;  5LCW B;  4XI1 A;  1CHC A;  2QIC A;  2YUR A;  2VJE B;  2VPE A;  3KV6 A;  3LQH A;  3MHS A;  4LKA A;  2ECT A;  4NN2 A;  3N9O A;  2FUI A;  3IHP A;  4B86 C;  2LN0 A;  5J3X A;  2AN6 A;  3HCT A;  2LGL A;  4YAX A;  4P5O B;  1X4J A;  1LDJ B;  3U5N A;  2JMJ A;  5TAB A;  4FJC A;  3M62 A;  3ZYQ A;  2KWO A;  2CSY A;  4S3O B;  5TRB A;  2K17 A;  3LQI A;  1WFK A;  4PPE A;  3N9M A;  4AYC A;  1WEN A;  3C5K A;  3U5M A;  2ECG A;  1IYM A;  1JM7 B;  2KE1 A;  3LQJ A;  5H9M A;  4N4F A;  4V3L C;  4YC9 A;  2I50 A;  4W4U A;  3EB5 A;  2YQM A;  2K4D A;  3ZVY A;  4R8P K;  2K16 A;  2QJ0 A;  4N3W A;  1ZBD B;  4QF3 A;  5KH7 A;  4O64 A;  4L58 A;  2LV9 A;  1WEE A;  2G6Q A;  3U5O A;  1WEU A;  2OXQ C;  1DVP A;  2JRJ A;  3GL6 A;  1MM2 A;  2EGP A;  2MUM A;  3HTK C;  4I7B A;  3V43 A;  3SOX A;  4F52 B;  3O35 A;  4AYC B;  1K2F A;  4V3K C;  5TBN A;  2L80 A;  5DIN A;  3RTR B;  2KFT A;  3U5P A;  3T6R A;  2KIZ A;  2KR4 A;  1WEW A;  5TDW A;  4A0C D;  4GND A;  3DQV R;  5JG6 A;  5G04 B;  5LKU A;  2VPD A;  3O33 A;  3ZNI A;  4YBM A; 
#chains in the Genus database with same CATH topology
 2M3H A;  2M13 A;  3N9Q A;  4OGC A;  2G45 A;  4FIP A;  4Z0R A;  2YSJ A;  2VNF A;  5EYA F;  5FER A;  5D1K B;  2XOZ A;  2L7P A;  1T1H A;  2L0B A;  3O7A A;  5G05 B;  3NG2 A;  4S3O C;  1JM7 A;  2YYR A;  2KKX A;  2HDP A;  2KYU A;  3O70 A;  2H0D B;  3DDT A;  3LJU X;  2KGI A;  4BHW A;  2ECI A;  2FUU A;  5FEY A;  5D1L B;  2EOD A;  4TKP B;  3ZPV 1;  4WA6 A;  2VPG A;  2L75 A;  2MNZ A;  3RPG B;  2LGG A;  4LJN A;  2LDR A;  2M6M A;  2DJA A;  2LGK A;  3VK6 A;  2XOC A;  2CSZ A;  4LLB A;  1MBM A;  2KWJ A;  4UP0 A;  2XB1 A;  5LKT A;  5H1T A;  2LRI C;  5C11 A;  4C9Z A;  2YRE A;  3SHB A;  1RMD A;  1G25 A;  3N9P A;  4OGE A;  1U6G B;  4YAB A;  5H1U A;  1WIM A;  2VPB A;  2YUC A;  2YSM A;  2QIZ A;  5B77 A;  1JOC A;  2VJF A;  2XEU A;  1MM3 A;  2HYE D;  4A4C A;  3KV5 A;  2JUN A;  2E6S A;  2JMD A;  4IC2 A;  1LDK C;  2ECJ A;  3KDE C;  1Z6U A;  5FB1 A;  1FP0 A;  3ASL A;  2XP0 A;  2Y1N A;  4LAD B;  2M1R A;  3H7H A;  2IDA A;  1X4I A;  3LVR E;  1VYX A;  5G0F A;  5B8D A;  3N9L A;  3L1Z B;  3T7L A;  3PLW A;  2H0D A;  3M99 A;  2KRE A;  5LKX A;  4GNF A;  2L5U A;  2YQL A;  2ZET C;  2VP7 A;  5D1M B;  3FAO A;  2KWN A;  2RI7 A;  4R2Y A;  2KKY A;  2VJF B;  2ECW A;  2RSD A;  2EA6 A;  4YAT A;  2YT5 A;  1VD4 A;  2YHO A;  2CSV A;  2D8U A;  5B75 A;  4ZUX U;  2IQJ A;  5C13 A;  1WIL A;  3C6W A;  3PHD A;  2F6N A;  4PTB A;  2UZG A;  4QF2 A;  3RPG C;  2MT5 A;  4YAD A;  4A4B A;  2MD8 C;  3EB6 A;  3I2D A;  3SUB A;  3ZTG A;  3O37 A;  2L43 A;  2DX8 A;  2YVR A;  1WE9 A;  2MIQ A;  2CT2 A;  5AIU A;  2C2L A;  5DKA A;  2EGM A;  4FO9 A;  2PUY A;  2LXH C;  5SVY A;  1E4U A;  2G43 A;  2Y43 A;  1VFY A;  1WGM A;  3KQI A;  2FD4 A;  1FBV A;  4YBS A;  1WEV A;  1Z60 A;  5LKZ A;  4GB0 A;  4GNG A;  4ZDT A;  4A49 A;  2LXP C;  5B78 A;  4L7X A;  2C2V S;  3QZV A;  2CKL A;  4AUQ B;  3DPL R;  2MD7 B;  1HYJ A;  4FK5 A;  2LGV A;  2JMI A;  4H9D A;  2XOY A;  3ZPV E;  4UP5 A;  1WES A;  3MDB C;  2CRW A;  3N9N A;  4BBQ A;  3MHH A;  2YU4 A;  3FM8 C;  2EXU A;  3FL2 A;  1XWH A;  3M7K A;  2LQ6 A;  2F42 A;  4Z0O A;  2MA5 A;  2YW8 A;  3DWD A;  4I7C A;  2MNY A;  4IC3 A;  2NAA A;  4YBT A;  4B7Y C;  4WZ3 B;  5I3L A;  2YHN A;  3SOW A;  4O62 A;  1N87 A;  3M63 A;  2D8S A;  1F62 A;  2CKL B;  2B0O E;  4MSX A;  3KNV A;  3L1X A;  1HYI A;  2KGG A;  3LVQ E;  2FFW A;  4X3G A;  3T9K A;  3PUQ A;  2M85 A;  2KWK A;  5FB0 A;  5B79 A;  5AIT A;  1V87 A;  2BAY A;  4GNE A;  1WEP A;  4Q6F A;  2KU3 A;  4UI9 B;  4R7E A;  5H1V A;  3GV4 A;  1BOR A;  2E6R A;  1DCQ A;  2MA6 A;  5SVI A;  3ZVZ B;  5KH3 A;  2K1J A;  4WZ0 A;  2DSM A;  4LK9 A;  2Y1M A;  2OWA A;  3L11 A;  4CCG X;  2VJE A;  3PUR A;  1WEM A;  2FSA A;  3O47 A;  4WZ2 A;  2F6J A;  5SVX A;  5B76 A;  4CA1 A;  2ECN A;  3LRQ A;  4AP4 A;  3O34 A;  3O36 A;  2E61 A;  4F1P A;  1WEQ A;  4I7D A;  4AVX A;  3SOU A;  5TDR A;  4ZQL A;  3HCS A;  1Z2Q A;  2ECV A;  3HCU A;  1WEO A;  1X4U A;  5KH9 A;  2PNX A;  3FEH A;  4MVT A;  5LCW B;  3Q1D A;  4XI1 A;  1CHC A;  5SVI B;  3LDY A;  2QIC A;  2YUR A;  2VJE B;  2VPE A;  3KV6 A;  3LQH A;  3MHS A;  4LKA A;  2ECT A;  3E2D A;  3N9O A;  4NN2 A;  2FUI A;  3IHP A;  4B86 C;  2LN0 A;  5J3X A;  2AN6 A;  3HCT A;  2LGL A;  4YAX A;  4P5O B;  1X4J A;  1LDJ B;  3U5N A;  2JMJ A;  5TAB A;  4FJC A;  3M62 A;  3ZYQ A;  3FAN A;  2KWO A;  2LAU A;  2CSY A;  4S3O B;  5TRB A;  2K17 A;  3LQI A;  1WFK A;  4PPE A;  3N9M A;  4AYC A;  1WEN A;  3C5K A;  2CON A;  3U5M A;  2ECG A;  4QQ4 A;  1IYM A;  1JM7 B;  2KE1 A;  3LQJ A;  5H9M A;  4N4F A;  4V3L C;  2I50 A;  3EB5 A;  2YQM A;  2K4D A;  4W4U A;  4YC9 A;  3ZVY A;  4R8P K;  2K16 A;  2QJ0 A;  4N3W A;  1ZBD B;  4QF3 A;  5KH7 A;  4O64 A;  4L58 A;  2LV9 A;  1WEE A;  2G6Q A;  3U5O A;  1WEU A;  2OXQ C;  1DVP A;  5K3Q A;  2JRJ A;  3GL6 A;  1MM2 A;  3FJU B;  3JUE A;  2EGP A;  2P57 A;  2MUM A;  3HTK C;  4I7B A;  3V43 A;  2CRR A;  3SOX A;  4F52 B;  3O35 A;  4AYC B;  1K2F A;  4V3K C;  5TBN A;  2L80 A;  5DIN A;  3RTR B;  2KFT A;  3U5P A;  3T6R A;  2RR4 A;  2KIZ A;  2KR4 A;  1WEW A;  2MKE A;  5TDW A;  4A0C D;  4GND A;  3DQV R;  5JG6 A;  5G04 B;  5LKU A;  2VPD A;  2JM3 A;  3O33 A;  3ZNI A;  4YBM A; 
#chains in the Genus database with same CATH homology
 2M3H A;  3N9Q A;  2G45 A;  4FIP A;  2YSJ A;  2VNF A;  5EYA F;  5FER A;  5D1K B;  1T1H A;  2L0B A;  3O7A A;  5G05 B;  3NG2 A;  4S3O C;  1JM7 A;  2YYR A;  2HDP A;  2KYU A;  3O70 A;  2H0D B;  2KGI A;  4BHW A;  2ECI A;  2FUU A;  5FEY A;  5D1L B;  2EOD A;  4TKP B;  3ZPV 1;  4WA6 A;  2VPG A;  2L75 A;  2MNZ A;  3RPG B;  2LGG A;  4LJN A;  2LDR A;  2M6M A;  2LGK A;  3VK6 A;  4LLB A;  2CSZ A;  2KWJ A;  4UP0 A;  2XB1 A;  5LKT A;  5H1T A;  2LRI C;  5C11 A;  4C9Z A;  2YRE A;  3SHB A;  1RMD A;  1G25 A;  3N9P A;  1U6G B;  4YAB A;  5H1U A;  1WIM A;  2VPB A;  2YUC A;  2YSM A;  2QIZ A;  5B77 A;  1JOC A;  2VJF A;  2XEU A;  1MM3 A;  2HYE D;  4A4C A;  3KV5 A;  2E6S A;  2JMD A;  4IC2 A;  1LDK C;  2ECJ A;  1Z6U A;  5FB1 A;  1FP0 A;  3ASL A;  2Y1N A;  4LAD B;  2M1R A;  2IDA A;  1X4I A;  5G0F A;  1VYX A;  5B8D A;  3N9L A;  3L1Z B;  3T7L A;  2H0D A;  3M99 A;  2KRE A;  5LKX A;  4GNF A;  2L5U A;  2YQL A;  2ZET C;  2VP7 A;  5D1M B;  2KWN A;  2RI7 A;  4R2Y A;  2VJF B;  2ECW A;  2RSD A;  2EA6 A;  4YAT A;  2YT5 A;  1VD4 A;  2YHO A;  5B75 A;  4ZUX U;  5C13 A;  1WIL A;  3C6W A;  3PHD A;  2F6N A;  4PTB A;  2UZG A;  4QF2 A;  3RPG C;  2MT5 A;  4YAD A;  4A4B A;  2MD8 C;  3EB6 A;  3I2D A;  3ZTG A;  3O37 A;  2L43 A;  2DX8 A;  1WE9 A;  2MIQ A;  2CT2 A;  5AIU A;  2C2L A;  5DKA A;  4FO9 A;  2PUY A;  2LXH C;  1E4U A;  2G43 A;  2Y43 A;  1VFY A;  1WGM A;  3KQI A;  1FBV A;  4YBS A;  1WEV A;  1Z60 A;  5LKZ A;  4GB0 A;  4GNG A;  4ZDT A;  4A49 A;  2LXP C;  5B78 A;  4L7X A;  2C2V S;  3QZV A;  2CKL A;  4AUQ B;  3DPL R;  2MD7 B;  1HYJ A;  4FK5 A;  2LGV A;  2JMI A;  3ZPV E;  4UP5 A;  1WES A;  3N9N A;  4BBQ A;  3MHH A;  2YU4 A;  3FL2 A;  1XWH A;  2LQ6 A;  2F42 A;  2MA5 A;  2YW8 A;  4I7C A;  2MNY A;  4IC3 A;  2NAA A;  4YBT A;  4B7Y C;  4WZ3 B;  5I3L A;  2YHN A;  3SOW A;  1N87 A;  3M63 A;  2D8S A;  1F62 A;  2CKL B;  4MSX A;  1HYI A;  3KNV A;  3L1X A;  2KGG A;  4X3G A;  3PUQ A;  2M85 A;  2KWK A;  5FB0 A;  5B79 A;  5AIT A;  1V87 A;  2BAY A;  4GNE A;  1WEP A;  4Q6F A;  2KU3 A;  4UI9 B;  4R7E A;  5H1V A;  3GV4 A;  1BOR A;  2E6R A;  2MA6 A;  3ZVZ B;  5KH3 A;  2K1J A;  4WZ0 A;  4LK9 A;  2Y1M A;  3L11 A;  4CCG X;  2VJE A;  3PUR A;  1WEM A;  2FSA A;  4WZ2 A;  2F6J A;  5B76 A;  4CA1 A;  2ECN A;  3LRQ A;  4AP4 A;  3O34 A;  3O36 A;  1WEQ A;  4I7D A;  4AVX A;  3SOU A;  5TDR A;  4ZQL A;  3HCS A;  1Z2Q A;  2ECV A;  3HCU A;  1WEO A;  1X4U A;  5KH9 A;  2PNX A;  4MVT A;  5LCW B;  4XI1 A;  1CHC A;  2QIC A;  2YUR A;  2VJE B;  2VPE A;  3KV6 A;  3LQH A;  3MHS A;  4LKA A;  2ECT A;  4NN2 A;  3N9O A;  2FUI A;  3IHP A;  4B86 C;  2LN0 A;  5J3X A;  2AN6 A;  3HCT A;  2LGL A;  4YAX A;  4P5O B;  1X4J A;  1LDJ B;  3U5N A;  2JMJ A;  5TAB A;  4FJC A;  3M62 A;  3ZYQ A;  2KWO A;  2CSY A;  4S3O B;  5TRB A;  2K17 A;  3LQI A;  1WFK A;  4PPE A;  3N9M A;  4AYC A;  1WEN A;  3C5K A;  3U5M A;  2ECG A;  1IYM A;  1JM7 B;  2KE1 A;  3LQJ A;  5H9M A;  4N4F A;  4V3L C;  4YC9 A;  2I50 A;  4W4U A;  3EB5 A;  2YQM A;  2K4D A;  3ZVY A;  4R8P K;  2K16 A;  2QJ0 A;  4N3W A;  1ZBD B;  4QF3 A;  5KH7 A;  4O64 A;  4L58 A;  2LV9 A;  1WEE A;  2G6Q A;  3U5O A;  1WEU A;  2OXQ C;  1DVP A;  2JRJ A;  3GL6 A;  1MM2 A;  2EGP A;  2MUM A;  3HTK C;  4I7B A;  3V43 A;  3SOX A;  4F52 B;  3O35 A;  4AYC B;  1K2F A;  4V3K C;  5TBN A;  2L80 A;  5DIN A;  3RTR B;  2KFT A;  3U5P A;  3T6R A;  2KIZ A;  2KR4 A;  1WEW A;  5TDW A;  4A0C D;  4GND A;  3DQV R;  5JG6 A;  5G04 B;  5LKU A;  2VPD A;  3O33 A;  3ZNI A;  4YBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...