2VPBA

Decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
YPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords PYGOPUS HOMOLOG 1
publication title Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2008-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vpbA00
3T6RA 2KU3A 4UI9B 2DX8A 3MHHA 2YSMA 3LQHA 5FERA 2RI7A 2KWNA 3N9LA 2YHNA 4WA6A 2VJFB 1E4UA 2L0BA 2UZGA 3L1XA 2L75A 4GNGA 2KGGA 3VK6A 2VPBA 2E6RA 2VJFA 2QICA 1V87A 4LK9A 2G6QA 5LKUA 5LKTA 1WILA 4WZ2A 4LADB 3RPGB 2LRIC 4F52B 2KE1A 4AUQB 5H1UA 3ZNIA 2ECIA 3KQIA 3ZTGA 2LXHC 3N9NA 4I7CA 3M62A 2NAAA 5G05B 5H9MA 3ZPV1 1WEPA 2CKLB 2KWKA 3O34A 5KH9A 2KR4A 2MA6A 2C2VS 1T1HA 1LDKC 3ZVZB 2CKLA 2YT5A 2OXQC 2ECVA 4A4CA 2JMJA 3U5MA 4PPEA 1JOCA 5G04B 2MD8C 5TDRA 3C5KA 3I2DA 3MHSA 5KH7A 1X4UA 4R7EA 4ZUXU 1MM2A 1F62A 2CSYA 2MA5A 4FJCA 2I50A 4O64A 4B7YC 3GV4A 2ECNA 3ZPVE 1VYXA 4A0CD 3SOUA 1VFYA 4AYCB 1X4IA 5FEYA 4YBSA 4AVXA 3PUQA 2Y43A 5TBNA 2YQLA 4AYCA 5TRBA 2Y1MA 2CT2A 4NN2A 2LN0A 4QF2A 2E6SA 3C6WA 3KV6A 4UP0A 3M99A 2YSJA 2L5UA 1WE9A 2YHOA 5FB0A 5H1TA 3O36A 2LGLA 4GNFA 4S3OB 1WEWA 4WZ3B 1WESA 1WENA 4YATA 2M6MA 2LGGA 2G45A 3HCUA 1K2FA 1IYMA 3SOXA 5TDWA 2FUIA 2VPDA 4I7BA 4X3GA 5LCWB 2KYUA 5FB1A 3ZYQA 3GL6A 2HYED 5DINA 2D8SA 2YW8A 3RPGC 5EYAF 3N9OA 2F6NA 4PTBA 2FUUA 4ZQLA 3ZVYA 5KH3A 4YABA 1Z60A 2BAYA 1WIMA 1WFKA 2LV9A 1XWHA 2KFTA 5I3LA 2MNYA 5DKAA 3U5NA 2ECWA 1DVPA 2MUMA 4FIPA 3LRQA 4CA1A 2AN6A 5LKZA 4XI1A 2EA6A 4A49A 1JM7B 2VPGA 4IC3A 3SOWA 4V3LC 3O33A 4LKAA 4YADA 3PURA 3L11A 2JMIA 1WGMA 3IHPA 1JM7A 4IC2A 2F6JA 2F42A 2IDAA 2EODA 2YQMA 2VP7A 5AIUA 1FBVA 4GNDA 1WEQA 4TKPB 1CHCA 4I7DA 4CCGX 2K16A 5TABA 1LDJB 3U5OA 2JRJA 1X4JA 2K4DA 1Z6UA 4AP4A 3T7LA 2VJEB 4MSXA 2FSAA 3KV5A 3O7AA 2ZETC 2LDRA 4L58A 4L7XA 3RTRB 2VJEA 3EB5A 3DQVR 3HTKC 1RMDA 2YU4A 2PNXA 2C2LA 2L43A 2YYRA 3O37A 4YC9A 4GB0A 4WZ0A 4BBQA 2QIZA 2M85A 5B77A 1WEEA 2KIZA 4UP5A 4ZDTA 2LGVA 4S3OC 2H0DB 5D1LB 1WEUA 2MT5A 2LGKA 2M1RA 4P5OB 4YAXA 3L1ZB 2MNZA 4QF3A 1FP0A 2L80A 3LQIA 2MIQA 5B79A 2H0DA 5G0FA 2LQ6A 4V3KC 4FK5A 3QZVA 2ECTA 4LJNA 3N9PA 3N9MA 1WEVA 2K17A 2VPEA 3N9QA 2G43A 1U6GB 2JMDA 3PHDA 1BORA 3HCTA 4W4UA 2RSDA 4Q6FA 2HDPA 3KNVA 2KGIA 2M3HA 2EGPA 4MVTA 5AITA 3O70A 2CSZA 5B78A 5D1MB 3SHBA 4N4FA 1N87A 2KWOA 2K1JA 3NG2A 5B75A 3O35A 4YBTA 2KWJA 4N3WA 3ASLA 1HYIA 2YUCA 2XB1A 3DPLR 1VD4A 4B86C 3FL2A 3LQJA 2XEUA 2PUYA 5B76A 3EB6A 4LLBA 3V43A 5B8DA 4R8PK 2LXPC 5J3XA 2KREA 1MM3A 4R2YA 1ZBDB 1G25A 5JG6A 3U5PA 1WEMA 1Z2QA 2MD7B 5C13A 5H1VA 2ECJA 1HYJA 3M63A 5C11A 5LKXA 4A4BA 4C9ZA 2YURA 3HCSA 1WEOA 4YBMA 2ECGA 4FO9A 4GNEA 2VNFA 5D1KB 2QJ0A 4BHWA 2YREA 2Y1NA
chains in the Genus database with same CATH superfamily
3T6RA 2KU3A 4UI9B 2DX8A 3MHHA 2YSMA 3LQHA 5FERA 2RI7A 2KWNA 3N9LA 3KDEC 2YHNA 4WA6A 2VJFB 1E4UA 4QQ4A 2L0BA 2UZGA 3L1XA 2L75A 3M7KA 4GNGA 2KGGA 3VK6A 2VPBA 2E6RA 2VJFA 2QICA 1V87A 4LK9A 2G6QA 5LKUA 5LKTA 1WILA 4WZ2A 4LADB 3RPGB 2LRIC 2XOCA 4F52B 2KE1A 3PLWA 5SVIB 4AUQB 5H1UA 3ZNIA 2ECIA 3KQIA 3ZTGA 2LXHC 2YVRA 3N9NA 4I7CA 5SVIA 3M62A 2NAAA 5G05B 5H9MA 3ZPV1 1WEPA 2CKLB 2KWKA 3O34A 5KH9A 3FJUB 4Z0OA 2KR4A 2MA6A 2C2VS 1T1HA 1LDKC 3ZVZB 2CKLA 2YT5A 2OXQC 2ECVA 4A4CA 2JMJA 3U5MA 4PPEA 5K3QA 1JOCA 5G04B 2MD8C 5TDRA 3C5KA 3I2DA 3MHSA 5KH7A 1X4UA 4R7EA 4OGCA 4ZUXU 1MM2A 5SVXA 1F62A 2CSYA 3E2DA 2D8UA 2XOZA 2MA5A 4FJCA 2I50A 2M13A 2L7PA 4O64A 3GV4A 3MDBC 4B7YC 2ECNA 3ZPVE 3T9KA 3O47A 1VYXA 4A0CD 3SOUA 1VFYA 4AYCB 3DDTA 1X4IA 2XOYA 5FEYA 2IQJA 4YBSA 4AVXA 3PUQA 2Y43A 5TBNA 2YQLA 4AYCA 5TRBA 2Y1MA 2CT2A 2CSVA 4NN2A 2LN0A 4QF2A 2E6SA 3C6WA 3KV6A 4H9DA 3M99A 4UP0A 2YSJA 2L5UA 1WE9A 2YHOA 5FB0A 5H1TA 3O36A 2LGLA 4GNFA 4S3OB 1WEWA 4WZ3B 1WESA 1WENA 2XP0A 4YATA 2FD4A 2M6MA 2LGGA 2G45A 3HCUA 1K2FA 1IYMA 3SOXA 2CONA 3JUEA 5TDWA 2FUIA 2VPDA 4I7BA 4X3GA 5LCWB 2KYUA 5FB1A 3ZYQA 2FFWA 2KKXA 3GL6A 2HYED 5DINA 2D8SA 2YW8A 1DCQA 3RPGC 5EYAF 3N9OA 2F6NA 3FANA 4PTBA 2FUUA 4ZQLA 3ZVYA 5KH3A 4YABA 1Z60A 2BAYA 1WIMA 3FEHA 1WFKA 2LV9A 2JUNA 1XWHA 2KFTA 5I3LA 2MNYA 5DKAA 4Z0RA 3U5NA 2ECWA 1DVPA 2MUMA 2DJAA 4FIPA 3LRQA 5SVYA 4CA1A 2AN6A 5LKZA 2JM3A 4XI1A 2EA6A 4A49A 1JM7B 2VPGA 4IC3A 3SOWA 4V3LC 3O33A 4LKAA 4YADA 3PURA 3L11A 2JMIA 1WGMA 3LVRE 3IHPA 4F1PA 3DWDA 4OGEA 1JM7A 4IC2A 2F6JA 2F42A 2IDAA 2EODA 2YQMA 2MKEA 2VP7A 5AIUA 1FBVA 4GNDA 1WEQA 4TKPB 1CHCA 4I7DA 4CCGX 2K16A 5TABA 1LDJB 3FAOA 3U5OA 2JRJA 1X4JA 2K4DA 1Z6UA 4O62A 4AP4A 3T7LA 2VJEB 4MSXA 2FSAA 3KV5A 3O7AA 2KKYA 2ZETC 2LDRA 4L58A 4L7XA 2LAUA 3RTRB 2VJEA 3EB5A 3DQVR 3HTKC 1RMDA 2YU4A 2PNXA 2C2LA 2L43A 2YYRA 3FM8C 3O37A 4YC9A 4GB0A 4WZ0A 4BBQA 2QIZA 2M85A 5B77A 1WEEA 2KIZA 4UP5A 4ZDTA 2LGVA 4S3OC 2H0DB 5D1LB 1WEUA 2MT5A 2LGKA 2M1RA 4P5OB 2RR4A 4YAXA 3L1ZB 2MNZA 4QF3A 1FP0A 2L80A 3LQIA 2MIQA 5B79A 2H0DA 5G0FA 2LQ6A 4V3KC 2E61A 4FK5A 3QZVA 2B0OE 2ECTA 4LJNA 3N9PA 3N9MA 1WEVA 2K17A 2VPEA 3N9QA 2G43A 1U6GB 2JMDA 3PHDA 1BORA 1MBMA 3HCTA 2CRWA 4W4UA 2RSDA 4Q6FA 2EXUA 2HDPA 3KNVA 2KGIA 2M3HA 2EGPA 4MVTA 5AITA 3Q1DA 3O70A 2CSZA 5B78A 5D1MB 3SHBA 4N4FA 1N87A 3LVQE 2KWOA 2K1JA 3NG2A 5B75A 3O35A 4YBTA 2KWJA 4N3WA 3ASLA 1HYIA 2YUCA 2XB1A 3DPLR 1VD4A 4B86C 3FL2A 3LQJA 2XEUA 2PUYA 5B76A 3EB6A 4LLBA 3V43A 5B8DA 4R8PK 2LXPC 5J3XA 2KREA 1MM3A 4R2YA 1ZBDB 1G25A 5JG6A 3U5PA 2CRRA 1WEMA 2EGMA 3LJUX 1Z2QA 2MD7B 5C13A 2P57A 5H1VA 2ECJA 3H7HA 1HYJA 3M63A 5C11A 5LKXA 4A4BA 4C9ZA 2YURA 3HCSA 3SUBA 1WEOA 4YBMA 2ECGA 4FO9A 4GNEA 2VNFA 5D1KB 2QJ0A 4BHWA 3LDYA 2YREA 2OWAA 2Y1NA 2DSMA
chains in the Genus database with same CATH topology
3T6RA 2KU3A 4UI9B 2DX8A 3MHHA 2YSMA 3LQHA 5FERA 2RI7A 2KWNA 3N9LA 2YHNA 4WA6A 2VJFB 1E4UA 2L0BA 2UZGA 3L1XA 2L75A 4GNGA 2KGGA 3VK6A 2VPBA 2E6RA 2VJFA 2QICA 1V87A 4LK9A 2G6QA 5LKUA 5LKTA 1WILA 4WZ2A 4LADB 3RPGB 2LRIC 4F52B 2KE1A 4AUQB 5H1UA 3ZNIA 2ECIA 3KQIA 3ZTGA 2LXHC 3N9NA 4I7CA 3M62A 2NAAA 5G05B 5H9MA 3ZPV1 1WEPA 2CKLB 2KWKA 3O34A 5KH9A 2KR4A 2MA6A 2C2VS 1T1HA 1LDKC 3ZVZB 2CKLA 2YT5A 2OXQC 2ECVA 4A4CA 2JMJA 3U5MA 4PPEA 1JOCA 5G04B 2MD8C 5TDRA 3C5KA 3I2DA 3MHSA 5KH7A 1X4UA 4R7EA 4ZUXU 1MM2A 1F62A 2CSYA 2MA5A 4FJCA 2I50A 4O64A 4B7YC 3GV4A 2ECNA 3ZPVE 1VYXA 4A0CD 3SOUA 1VFYA 4AYCB 1X4IA 5FEYA 4YBSA 4AVXA 3PUQA 2Y43A 5TBNA 2YQLA 4AYCA 5TRBA 2Y1MA 2CT2A 4NN2A 2LN0A 4QF2A 2E6SA 3C6WA 3KV6A 4UP0A 3M99A 2YSJA 2L5UA 1WE9A 2YHOA 5FB0A 5H1TA 3O36A 2LGLA 4GNFA 4S3OB 1WEWA 4WZ3B 1WESA 1WENA 4YATA 2M6MA 2LGGA 2G45A 3HCUA 1K2FA 1IYMA 3SOXA 5TDWA 2FUIA 2VPDA 4I7BA 4X3GA 5LCWB 2KYUA 5FB1A 3ZYQA 3GL6A 2HYED 5DINA 2D8SA 2YW8A 3RPGC 5EYAF 3N9OA 2F6NA 4PTBA 2FUUA 4ZQLA 3ZVYA 5KH3A 4YABA 1Z60A 2BAYA 1WIMA 1WFKA 2LV9A 1XWHA 2KFTA 5I3LA 2MNYA 5DKAA 3U5NA 2ECWA 1DVPA 2MUMA 4FIPA 3LRQA 4CA1A 2AN6A 5LKZA 4XI1A 2EA6A 4A49A 1JM7B 2VPGA 4IC3A 3SOWA 4V3LC 3O33A 4LKAA 4YADA 3PURA 3L11A 2JMIA 1WGMA 3IHPA 1JM7A 4IC2A 2F6JA 2F42A 2IDAA 2EODA 2YQMA 2VP7A 5AIUA 1FBVA 4GNDA 1WEQA 4TKPB 1CHCA 4I7DA 4CCGX 2K16A 5TABA 1LDJB 3U5OA 2JRJA 1X4JA 2K4DA 1Z6UA 4AP4A 3T7LA 2VJEB 4MSXA 2FSAA 3KV5A 3O7AA 2ZETC 2LDRA 4L58A 4L7XA 3RTRB 2VJEA 3EB5A 3DQVR 3HTKC 1RMDA 2YU4A 2PNXA 2C2LA 2L43A 2YYRA 3O37A 4YC9A 4GB0A 4WZ0A 4BBQA 2QIZA 2M85A 5B77A 1WEEA 2KIZA 4UP5A 4ZDTA 2LGVA 4S3OC 2H0DB 5D1LB 1WEUA 2MT5A 2LGKA 2M1RA 4P5OB 4YAXA 3L1ZB 2MNZA 4QF3A 1FP0A 2L80A 3LQIA 2MIQA 5B79A 2H0DA 5G0FA 2LQ6A 4V3KC 4FK5A 3QZVA 2ECTA 4LJNA 3N9PA 3N9MA 1WEVA 2K17A 2VPEA 3N9QA 2G43A 1U6GB 2JMDA 3PHDA 1BORA 3HCTA 4W4UA 2RSDA 4Q6FA 2HDPA 3KNVA 2KGIA 2M3HA 2EGPA 4MVTA 5AITA 3O70A 2CSZA 5B78A 5D1MB 3SHBA 4N4FA 1N87A 2KWOA 2K1JA 3NG2A 5B75A 3O35A 4YBTA 2KWJA 4N3WA 3ASLA 1HYIA 2YUCA 2XB1A 3DPLR 1VD4A 4B86C 3FL2A 3LQJA 2XEUA 2PUYA 5B76A 3EB6A 4LLBA 3V43A 5B8DA 4R8PK 2LXPC 5J3XA 2KREA 1MM3A 4R2YA 1ZBDB 1G25A 5JG6A 3U5PA 1WEMA 1Z2QA 2MD7B 5C13A 5H1VA 2ECJA 1HYJA 3M63A 5C11A 5LKXA 4A4BA 4C9ZA 2YURA 3HCSA 1WEOA 4YBMA 2ECGA 4FO9A 4GNEA 2VNFA 5D1KB 2QJ0A 4BHWA 2YREA 2Y1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6R A;  2KU3 A;  4UI9 B;  2DX8 A;  3MHH A;  2YSM A;  3LQH A;  5FER A;  2RI7 A;  2KWN A;  3N9L A;  2YHN A;  4WA6 A;  2VJF B;  1E4U A;  2L0B A;  2UZG A;  3L1X A;  2L75 A;  4GNG A;  2KGG A;  3VK6 A;  2VPB A;  2E6R A;  2VJF A;  2QIC A;  1V87 A;  4LK9 A;  2G6Q A;  5LKU A;  5LKT A;  1WIL A;  4WZ2 A;  4LAD B;  3RPG B;  2LRI C;  4F52 B;  2KE1 A;  4AUQ B;  5H1U A;  3ZNI A;  2ECI A;  3KQI A;  3ZTG A;  2LXH C;  3N9N A;  4I7C A;  3M62 A;  2NAA A;  5G05 B;  5H9M A;  3ZPV 1;  1WEP A;  2CKL B;  2KWK A;  3O34 A;  5KH9 A;  2KR4 A;  2MA6 A;  2C2V S;  1T1H A;  1LDK C;  3ZVZ B;  2CKL A;  2YT5 A;  2OXQ C;  2ECV A;  4A4C A;  2JMJ A;  3U5M A;  4PPE A;  1JOC A;  5G04 B;  2MD8 C;  5TDR A;  3C5K A;  3I2D A;  3MHS A;  5KH7 A;  1X4U A;  4R7E A;  4ZUX U;  1MM2 A;  1F62 A;  2CSY A;  2MA5 A;  4FJC A;  2I50 A;  4O64 A;  4B7Y C;  3GV4 A;  2ECN A;  3ZPV E;  1VYX A;  4A0C D;  3SOU A;  1VFY A;  4AYC B;  1X4I A;  5FEY A;  4YBS A;  4AVX A;  3PUQ A;  2Y43 A;  5TBN A;  2YQL A;  4AYC A;  5TRB A;  2Y1M A;  2CT2 A;  4NN2 A;  2LN0 A;  4QF2 A;  2E6S A;  3C6W A;  3KV6 A;  4UP0 A;  3M99 A;  2YSJ A;  2L5U A;  1WE9 A;  2YHO A;  5FB0 A;  5H1T A;  3O36 A;  2LGL A;  4GNF A;  4S3O B;  1WEW A;  4WZ3 B;  1WES A;  1WEN A;  4YAT A;  2M6M A;  2LGG A;  2G45 A;  3HCU A;  1K2F A;  1IYM A;  3SOX A;  5TDW A;  2FUI A;  2VPD A;  4I7B A;  4X3G A;  5LCW B;  2KYU A;  5FB1 A;  3ZYQ A;  3GL6 A;  2HYE D;  5DIN A;  2D8S A;  2YW8 A;  3RPG C;  5EYA F;  3N9O A;  2F6N A;  4PTB A;  2FUU A;  4ZQL A;  3ZVY A;  5KH3 A;  4YAB A;  1Z60 A;  2BAY A;  1WIM A;  1WFK A;  2LV9 A;  1XWH A;  2KFT A;  5I3L A;  2MNY A;  5DKA A;  3U5N A;  2ECW A;  1DVP A;  2MUM A;  4FIP A;  3LRQ A;  4CA1 A;  2AN6 A;  5LKZ A;  4XI1 A;  2EA6 A;  4A49 A;  1JM7 B;  2VPG A;  4IC3 A;  3SOW A;  4V3L C;  3O33 A;  4LKA A;  4YAD A;  3PUR A;  3L11 A;  2JMI A;  1WGM A;  3IHP A;  1JM7 A;  4IC2 A;  2F6J A;  2F42 A;  2IDA A;  2EOD A;  2YQM A;  2VP7 A;  5AIU A;  1FBV A;  4GND A;  1WEQ A;  4TKP B;  1CHC A;  4I7D A;  4CCG X;  2K16 A;  5TAB A;  1LDJ B;  3U5O A;  2JRJ A;  1X4J A;  2K4D A;  1Z6U A;  4AP4 A;  3T7L A;  2VJE B;  4MSX A;  2FSA A;  3KV5 A;  3O7A A;  2ZET C;  2LDR A;  4L58 A;  4L7X A;  3RTR B;  2VJE A;  3EB5 A;  3DQV R;  3HTK C;  1RMD A;  2YU4 A;  2PNX A;  2C2L A;  2L43 A;  2YYR A;  3O37 A;  4YC9 A;  4GB0 A;  4WZ0 A;  4BBQ A;  2QIZ A;  2M85 A;  5B77 A;  1WEE A;  2KIZ A;  4UP5 A;  4ZDT A;  2LGV A;  4S3O C;  2H0D B;  5D1L B;  1WEU A;  2MT5 A;  2LGK A;  2M1R A;  4P5O B;  4YAX A;  3L1Z B;  2MNZ A;  4QF3 A;  1FP0 A;  2L80 A;  3LQI A;  2MIQ A;  5B79 A;  2H0D A;  5G0F A;  2LQ6 A;  4V3K C;  4FK5 A;  3QZV A;  2ECT A;  4LJN A;  3N9P A;  3N9M A;  1WEV A;  2K17 A;  2VPE A;  3N9Q A;  2G43 A;  1U6G B;  2JMD A;  3PHD A;  1BOR A;  3HCT A;  4W4U A;  2RSD A;  4Q6F A;  2HDP A;  3KNV A;  2KGI A;  2M3H A;  2EGP A;  4MVT A;  5AIT A;  3O70 A;  2CSZ A;  5B78 A;  5D1M B;  3SHB A;  4N4F A;  1N87 A;  2KWO A;  2K1J A;  3NG2 A;  5B75 A;  3O35 A;  4YBT A;  2KWJ A;  4N3W A;  3ASL A;  1HYI A;  2YUC A;  2XB1 A;  3DPL R;  1VD4 A;  4B86 C;  3FL2 A;  3LQJ A;  2XEU A;  2PUY A;  5B76 A;  3EB6 A;  4LLB A;  3V43 A;  5B8D A;  4R8P K;  2LXP C;  5J3X A;  2KRE A;  1MM3 A;  4R2Y A;  1ZBD B;  1G25 A;  5JG6 A;  3U5P A;  1WEM A;  1Z2Q A;  2MD7 B;  5C13 A;  5H1V A;  2ECJ A;  1HYJ A;  3M63 A;  5C11 A;  5LKX A;  4A4B A;  4C9Z A;  2YUR A;  3HCS A;  1WEO A;  4YBM A;  2ECG A;  4FO9 A;  4GNE A;  2VNF A;  5D1K B;  2QJ0 A;  4BHW A;  2YRE A;  2Y1N A; 
#chains in the Genus database with same CATH topology
 3T6R A;  2KU3 A;  4UI9 B;  2DX8 A;  3MHH A;  2YSM A;  3LQH A;  5FER A;  2RI7 A;  2KWN A;  3N9L A;  3KDE C;  2YHN A;  4WA6 A;  2VJF B;  1E4U A;  4QQ4 A;  2L0B A;  2UZG A;  3L1X A;  2L75 A;  3M7K A;  4GNG A;  2KGG A;  3VK6 A;  2VPB A;  2E6R A;  2VJF A;  2QIC A;  1V87 A;  4LK9 A;  2G6Q A;  5LKU A;  5LKT A;  1WIL A;  4WZ2 A;  4LAD B;  3RPG B;  2LRI C;  2XOC A;  4F52 B;  2KE1 A;  3PLW A;  5SVI B;  4AUQ B;  5H1U A;  3ZNI A;  2ECI A;  3KQI A;  3ZTG A;  2LXH C;  2YVR A;  3N9N A;  4I7C A;  5SVI A;  3M62 A;  2NAA A;  5G05 B;  5H9M A;  3ZPV 1;  1WEP A;  2CKL B;  2KWK A;  3O34 A;  5KH9 A;  3FJU B;  4Z0O A;  2KR4 A;  2MA6 A;  2C2V S;  1T1H A;  1LDK C;  3ZVZ B;  2CKL A;  2YT5 A;  2OXQ C;  2ECV A;  4A4C A;  2JMJ A;  3U5M A;  4PPE A;  5K3Q A;  1JOC A;  5G04 B;  2MD8 C;  5TDR A;  3C5K A;  3I2D A;  3MHS A;  5KH7 A;  1X4U A;  4R7E A;  4OGC A;  4ZUX U;  1MM2 A;  5SVX A;  1F62 A;  2CSY A;  3E2D A;  2D8U A;  2XOZ A;  2MA5 A;  4FJC A;  2I50 A;  2M13 A;  2L7P A;  4O64 A;  3GV4 A;  3MDB C;  4B7Y C;  2ECN A;  3ZPV E;  3T9K A;  3O47 A;  1VYX A;  4A0C D;  3SOU A;  1VFY A;  4AYC B;  3DDT A;  1X4I A;  2XOY A;  5FEY A;  2IQJ A;  4YBS A;  4AVX A;  3PUQ A;  2Y43 A;  5TBN A;  2YQL A;  4AYC A;  5TRB A;  2Y1M A;  2CT2 A;  2CSV A;  4NN2 A;  2LN0 A;  4QF2 A;  2E6S A;  3C6W A;  3KV6 A;  4H9D A;  3M99 A;  4UP0 A;  2YSJ A;  2L5U A;  1WE9 A;  2YHO A;  5FB0 A;  5H1T A;  3O36 A;  2LGL A;  4GNF A;  4S3O B;  1WEW A;  4WZ3 B;  1WES A;  1WEN A;  2XP0 A;  4YAT A;  2FD4 A;  2M6M A;  2LGG A;  2G45 A;  3HCU A;  1K2F A;  1IYM A;  3SOX A;  2CON A;  3JUE A;  5TDW A;  2FUI A;  2VPD A;  4I7B A;  4X3G A;  5LCW B;  2KYU A;  5FB1 A;  3ZYQ A;  2FFW A;  2KKX A;  3GL6 A;  2HYE D;  5DIN A;  2D8S A;  2YW8 A;  1DCQ A;  3RPG C;  5EYA F;  3N9O A;  2F6N A;  3FAN A;  4PTB A;  2FUU A;  4ZQL A;  3ZVY A;  5KH3 A;  4YAB A;  1Z60 A;  2BAY A;  1WIM A;  3FEH A;  1WFK A;  2LV9 A;  2JUN A;  1XWH A;  2KFT A;  5I3L A;  2MNY A;  5DKA A;  4Z0R A;  3U5N A;  2ECW A;  1DVP A;  2MUM A;  2DJA A;  4FIP A;  3LRQ A;  5SVY A;  4CA1 A;  2AN6 A;  5LKZ A;  2JM3 A;  4XI1 A;  2EA6 A;  4A49 A;  1JM7 B;  2VPG A;  4IC3 A;  3SOW A;  4V3L C;  3O33 A;  4LKA A;  4YAD A;  3PUR A;  3L11 A;  2JMI A;  1WGM A;  3LVR E;  3IHP A;  4F1P A;  3DWD A;  4OGE A;  1JM7 A;  4IC2 A;  2F6J A;  2F42 A;  2IDA A;  2EOD A;  2YQM A;  2MKE A;  2VP7 A;  5AIU A;  1FBV A;  4GND A;  1WEQ A;  4TKP B;  1CHC A;  4I7D A;  4CCG X;  2K16 A;  5TAB A;  1LDJ B;  3FAO A;  3U5O A;  2JRJ A;  1X4J A;  2K4D A;  1Z6U A;  4O62 A;  4AP4 A;  3T7L A;  2VJE B;  4MSX A;  2FSA A;  3KV5 A;  3O7A A;  2KKY A;  2ZET C;  2LDR A;  4L58 A;  4L7X A;  2LAU A;  3RTR B;  2VJE A;  3EB5 A;  3DQV R;  3HTK C;  1RMD A;  2YU4 A;  2PNX A;  2C2L A;  2L43 A;  2YYR A;  3FM8 C;  3O37 A;  4YC9 A;  4GB0 A;  4WZ0 A;  4BBQ A;  2QIZ A;  2M85 A;  5B77 A;  1WEE A;  2KIZ A;  4UP5 A;  4ZDT A;  2LGV A;  4S3O C;  2H0D B;  5D1L B;  1WEU A;  2MT5 A;  2LGK A;  2M1R A;  4P5O B;  2RR4 A;  4YAX A;  3L1Z B;  2MNZ A;  4QF3 A;  1FP0 A;  2L80 A;  3LQI A;  2MIQ A;  5B79 A;  2H0D A;  5G0F A;  2LQ6 A;  4V3K C;  2E61 A;  4FK5 A;  3QZV A;  2B0O E;  2ECT A;  4LJN A;  3N9P A;  3N9M A;  1WEV A;  2K17 A;  2VPE A;  3N9Q A;  2G43 A;  1U6G B;  2JMD A;  3PHD A;  1BOR A;  1MBM A;  3HCT A;  2CRW A;  4W4U A;  2RSD A;  4Q6F A;  2EXU A;  2HDP A;  3KNV A;  2KGI A;  2M3H A;  2EGP A;  4MVT A;  5AIT A;  3Q1D A;  3O70 A;  2CSZ A;  5B78 A;  5D1M B;  3SHB A;  4N4F A;  1N87 A;  3LVQ E;  2KWO A;  2K1J A;  3NG2 A;  5B75 A;  3O35 A;  4YBT A;  2KWJ A;  4N3W A;  3ASL A;  1HYI A;  2YUC A;  2XB1 A;  3DPL R;  1VD4 A;  4B86 C;  3FL2 A;  3LQJ A;  2XEU A;  2PUY A;  5B76 A;  3EB6 A;  4LLB A;  3V43 A;  5B8D A;  4R8P K;  2LXP C;  5J3X A;  2KRE A;  1MM3 A;  4R2Y A;  1ZBD B;  1G25 A;  5JG6 A;  3U5P A;  2CRR A;  1WEM A;  2EGM A;  3LJU X;  1Z2Q A;  2MD7 B;  5C13 A;  2P57 A;  5H1V A;  2ECJ A;  3H7H A;  1HYJ A;  3M63 A;  5C11 A;  5LKX A;  4A4B A;  4C9Z A;  2YUR A;  3HCS A;  3SUB A;  1WEO A;  4YBM A;  2ECG A;  4FO9 A;  4GNE A;  2VNF A;  5D1K B;  2QJ0 A;  4BHW A;  3LDY A;  2YRE A;  2OWA A;  2Y1N A;  2DSM A; 
#chains in the Genus database with same CATH homology
 3T6R A;  2KU3 A;  4UI9 B;  2DX8 A;  3MHH A;  2YSM A;  3LQH A;  5FER A;  2RI7 A;  2KWN A;  3N9L A;  2YHN A;  4WA6 A;  2VJF B;  1E4U A;  2L0B A;  2UZG A;  3L1X A;  2L75 A;  4GNG A;  2KGG A;  3VK6 A;  2VPB A;  2E6R A;  2VJF A;  2QIC A;  1V87 A;  4LK9 A;  2G6Q A;  5LKU A;  5LKT A;  1WIL A;  4WZ2 A;  4LAD B;  3RPG B;  2LRI C;  4F52 B;  2KE1 A;  4AUQ B;  5H1U A;  3ZNI A;  2ECI A;  3KQI A;  3ZTG A;  2LXH C;  3N9N A;  4I7C A;  3M62 A;  2NAA A;  5G05 B;  5H9M A;  3ZPV 1;  1WEP A;  2CKL B;  2KWK A;  3O34 A;  5KH9 A;  2KR4 A;  2MA6 A;  2C2V S;  1T1H A;  1LDK C;  3ZVZ B;  2CKL A;  2YT5 A;  2OXQ C;  2ECV A;  4A4C A;  2JMJ A;  3U5M A;  4PPE A;  1JOC A;  5G04 B;  2MD8 C;  5TDR A;  3C5K A;  3I2D A;  3MHS A;  5KH7 A;  1X4U A;  4R7E A;  4ZUX U;  1MM2 A;  1F62 A;  2CSY A;  2MA5 A;  4FJC A;  2I50 A;  4O64 A;  4B7Y C;  3GV4 A;  2ECN A;  3ZPV E;  1VYX A;  4A0C D;  3SOU A;  1VFY A;  4AYC B;  1X4I A;  5FEY A;  4YBS A;  4AVX A;  3PUQ A;  2Y43 A;  5TBN A;  2YQL A;  4AYC A;  5TRB A;  2Y1M A;  2CT2 A;  4NN2 A;  2LN0 A;  4QF2 A;  2E6S A;  3C6W A;  3KV6 A;  4UP0 A;  3M99 A;  2YSJ A;  2L5U A;  1WE9 A;  2YHO A;  5FB0 A;  5H1T A;  3O36 A;  2LGL A;  4GNF A;  4S3O B;  1WEW A;  4WZ3 B;  1WES A;  1WEN A;  4YAT A;  2M6M A;  2LGG A;  2G45 A;  3HCU A;  1K2F A;  1IYM A;  3SOX A;  5TDW A;  2FUI A;  2VPD A;  4I7B A;  4X3G A;  5LCW B;  2KYU A;  5FB1 A;  3ZYQ A;  3GL6 A;  2HYE D;  5DIN A;  2D8S A;  2YW8 A;  3RPG C;  5EYA F;  3N9O A;  2F6N A;  4PTB A;  2FUU A;  4ZQL A;  3ZVY A;  5KH3 A;  4YAB A;  1Z60 A;  2BAY A;  1WIM A;  1WFK A;  2LV9 A;  1XWH A;  2KFT A;  5I3L A;  2MNY A;  5DKA A;  3U5N A;  2ECW A;  1DVP A;  2MUM A;  4FIP A;  3LRQ A;  4CA1 A;  2AN6 A;  5LKZ A;  4XI1 A;  2EA6 A;  4A49 A;  1JM7 B;  2VPG A;  4IC3 A;  3SOW A;  4V3L C;  3O33 A;  4LKA A;  4YAD A;  3PUR A;  3L11 A;  2JMI A;  1WGM A;  3IHP A;  1JM7 A;  4IC2 A;  2F6J A;  2F42 A;  2IDA A;  2EOD A;  2YQM A;  2VP7 A;  5AIU A;  1FBV A;  4GND A;  1WEQ A;  4TKP B;  1CHC A;  4I7D A;  4CCG X;  2K16 A;  5TAB A;  1LDJ B;  3U5O A;  2JRJ A;  1X4J A;  2K4D A;  1Z6U A;  4AP4 A;  3T7L A;  2VJE B;  4MSX A;  2FSA A;  3KV5 A;  3O7A A;  2ZET C;  2LDR A;  4L58 A;  4L7X A;  3RTR B;  2VJE A;  3EB5 A;  3DQV R;  3HTK C;  1RMD A;  2YU4 A;  2PNX A;  2C2L A;  2L43 A;  2YYR A;  3O37 A;  4YC9 A;  4GB0 A;  4WZ0 A;  4BBQ A;  2QIZ A;  2M85 A;  5B77 A;  1WEE A;  2KIZ A;  4UP5 A;  4ZDT A;  2LGV A;  4S3O C;  2H0D B;  5D1L B;  1WEU A;  2MT5 A;  2LGK A;  2M1R A;  4P5O B;  4YAX A;  3L1Z B;  2MNZ A;  4QF3 A;  1FP0 A;  2L80 A;  3LQI A;  2MIQ A;  5B79 A;  2H0D A;  5G0F A;  2LQ6 A;  4V3K C;  4FK5 A;  3QZV A;  2ECT A;  4LJN A;  3N9P A;  3N9M A;  1WEV A;  2K17 A;  2VPE A;  3N9Q A;  2G43 A;  1U6G B;  2JMD A;  3PHD A;  1BOR A;  3HCT A;  4W4U A;  2RSD A;  4Q6F A;  2HDP A;  3KNV A;  2KGI A;  2M3H A;  2EGP A;  4MVT A;  5AIT A;  3O70 A;  2CSZ A;  5B78 A;  5D1M B;  3SHB A;  4N4F A;  1N87 A;  2KWO A;  2K1J A;  3NG2 A;  5B75 A;  3O35 A;  4YBT A;  2KWJ A;  4N3W A;  3ASL A;  1HYI A;  2YUC A;  2XB1 A;  3DPL R;  1VD4 A;  4B86 C;  3FL2 A;  3LQJ A;  2XEU A;  2PUY A;  5B76 A;  3EB6 A;  4LLB A;  3V43 A;  5B8D A;  4R8P K;  2LXP C;  5J3X A;  2KRE A;  1MM3 A;  4R2Y A;  1ZBD B;  1G25 A;  5JG6 A;  3U5P A;  1WEM A;  1Z2Q A;  2MD7 B;  5C13 A;  5H1V A;  2ECJ A;  1HYJ A;  3M63 A;  5C11 A;  5LKX A;  4A4B A;  4C9Z A;  2YUR A;  3HCS A;  1WEO A;  4YBM A;  2ECG A;  4FO9 A;  4GNE A;  2VNF A;  5D1K B;  2QJ0 A;  4BHW A;  2YRE A;  2Y1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...