5H1UA

Complex structure of trim24 phd-bromodomain and inhibitor 2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
180
structure length
174
Chain Sequence
DWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 51
structure length 174
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1uA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1uA01
5ENIA 4NYXA 5II1A 3G0LA 3UV2A 3MB4A 4R7EA 4WIVA 4PCEA 2QIZA 3ONIA 5AITA 4TT2A 3UV5A 5TB6A 1X4JA 2L84A 5CQ8A 4LDFA 1RMDA 1WEQA 2RNWA 3MB3A 2KGIA 3DAIA 4A9IA 2OUOA 1VFYA 2LV9A 4XYAA 2OO1A 4QR4A 4F3IA 3ZPVE 3RPGC 3SVGA 4PPEA 5EWDA 2E6SA 4O7EA 5IGNA 1WGMA 4IORA 3UVDA 4A9NA 5DLXA 3O35A 4YBTA 2VPEA 4AP4A 4LRGA 4AKNA 1JSPB 2YEKA 5CUGA 5FH8A 5ENFA 4YK0A 3QZSA 3D7CA 4NXJA 5CU8A 3O34A 5ENHA 4YC9A 5DW2A 2YW5A 4MEPA 4QSUA 2L5UA 2VPGA 5KHMA 4NUDA 3DQVR 2ECGA 3MXFA 2YEMA 4QR3A 4WHUA 4IC2A 4O64A 5HELA 5AD3A 1WEVA 4HXNA 4UIYA 5FDZA 5DYUA 2MD7B 3O7AA 4C67A 2KGGA 4YH3A 5D25A 1JM4B 4I7BA 5LCWB 3ZNIA 5EM3A 2Y1NA 5C11A 5CPEA 3HCUA 2YURA 5CRZA 4XI1A 4HBYA 1E6IA 5H1UA 4O7CA 1VYXA 2MNYA 2KWOA 2YQLA 4KCXA 4Z93A 2Y1MA 4QSXA 4QSSA 2L5EA 5HM0A 5HRXA 2MIQA 3C5KA 4Z1QA 3SVFA 2LRIC 5IGLA 2F6JA 5C8GA 1LDKC 4CUQA 5FFWA 3O36A 4C9ZA 5F60A 5TBNA 2PNXA 5CQ7A 5HFQA 4BW3A 4YYNA 2G6QA 3IHPA 4YYIA 2KWNA 2DX8A 3HMEA 5FG6A 2NXBA 5EQ1A 2CKLB 4HXPA 4WHWA 5D7XA 5DLZA 5EYAF 3SHBA 2Y43A 1CHCA 4NR4A 4BW1A 5CUBA 2CKLA 5FH6A 5H1TA 3JVMA 4NUCA 2MNZA 4LJNA 4A9KA 3N9MA 4LYWA 5DKAA 3P1DA 5HRVA 5LVRA 2H0DB 4MR3A 2RI7A 2ECWA 5BT3A 2LDRA 5EWCA 5CUDA 5CZGA 4I7CA 5I29A 4QEWA 5HJCA 5DKHA 5I3LA 3O33A 4NR7A 4TZ2A 4UYEA 5ETBA 5HFRA 4NRBA 2M85A 3AADA 4LZRA 4QR5A 4LC2A 5C13A 5A7CA 2HYED 5EK9A 4LR6A 2YU4A 4YADA 4IR6A 4QSRA 3Q2EA 5JG6A 2DWWA 5E9MA 2VJFB 4BHWA 5HEMA 3ASLA 5L8TA 3TLPA 4FLPA 5E9YA 1WESA 1JOCA 4RVRA 5HQ6A 2RNYA 5FH7A 5FE2A 4GB0A 3ZTGA 5II2A 4FJCA 4OUFA 3O37A 3UVYA 5B75A 4A9OA 2K16A 4O7FA 5D3NA 1WENA 4QSVA 4HBXA 2YQMA 5CFWA 4V3LC 5F62A 4QF3A 5DFBA 4ZUXU 5E74A 3K2JA 5EGUA 4BBQA 2YQDA 4QSQA 5EPBA 4YABA 2KR4A 4WZ0A 2KU3A 2VP7A 2YUCA 5EISA 3U5NA 4PKLA 2AN6A 5IGKA 2ZETC 1DVPA 4PY6A 5TDWA 3U5PA 2L43A 1FP0A 4TT6A 2C2VS 5I86A 3T6RA 4A4BA 4YY4A 4XY9A 2MA5A 4S3OB 4A9HA 4YH4A 4UYFA 4QNSA 3KV5A 5DY7A 5F63A 4X3GA 4HXLA 4O72A 5F2PA 5HRWA 5DYCA 5B76A 2E7OA 5H1VA 4O78A 1X4UA 4O75A 5I80A 4CFLA 4ZQLA 4CUPA 2YHNA 4E96A 4A49A 2G4AA 5EP7A 3MUKA 2EA6A 3L11A 2ECIA 2YT5A 4TZ8A 5A5PA 3KQIA 3N9NA 3P1CA 5KH3A 3HTKC 5CQAA 5IGMA 1MM3A 4O74A 4WA6A 5FE1A 5G05B 4QYLA 4HXOA 5CQTA 3N9PA 5BT4A 3HMHA 2DVSA 5A83A 4Z6HA 5DINA 2KWKA 5KH7A 5CTLA 5D26A 2UZGA 4YY6A 3RCWA 2ECNA 1HYJA 2E3KA 5A81A 1WEWA 4HBVA 1E4UA 5FG4A 5LVQA 4N4HA 2EGPA 2FUUA 5FE8A 2WP1A 5EPRA 2LGVA 3G0JA 5CGPA 5C85A 5J0DA 4HXSA 4QC1A 4LK9A 3ZVYA 5D1LB 1VD4A 5DFCA 5B8DA 2JMIA 4YBMA 2VPBA 3GV4A 3HCTA 4NRAA 5D3HA 5FFVA 5ENJA 4IOOA 5CUCA 5FE9A 2LN0A 4KV4A 5FFYA 5D1KB 3ZVZB 5A5NA 4HBWA 4LYSA 5E73A 5EICA 3SVHA 3U5OA 1XWHA 3I2DA 4XUAA 4FIPA 1U6GB 3V43A 2R0SA 1WEMA 4AYCB 3U5KA 5LKZA 5D0CA 4O7BA 4Q0OA 2MJVB 5FE7A 2L85A 4TYLA 5I40A 2LGLA 5ACYA 4GNGA 2MA6A 2HDPA 4Z1SA 5D3JA 1WIMA 4NYWA 5CUAA 4QUUA 3T7LA 5L98A 5HENA 5DFDA 5F61A 2FSAA 5H85A 5JWMA 3LRQA 3DWYA 4YYGA 5DW1A 2CT2A 3HMFA 2JMDA 5EI4A 5A5RA 5DKDA 2H0DA 5H9MA 4NR9A 5LJ2A 2YYNA 3GL6A 3L1XA 5AMFA 3N9LA 5EU1A 2YELA 4O76A 3NXBA 4HXMA 5IG6A 5E9LA 4Z6IA 3PHDA 4CUTA 3P1EA 2KTBB 5A5QA 4QYDA 3KV6A 2YHOA 3M99A 5L97A 4S3OC 5IIDA 4YAXA 4UYGA 5AIUA 5EWVA 5ENBA 5E9IA 5COIA 1FBVA 2YSJA 2OSSA 5F36A 4QEUA 2KYUA 4BW4A 4UIWA 3P5OA 3MQMA 5ETDA 1Z2QA 1Z60A 3GG3A 2OXQC 4QB3A 3ZYUA 5KO4A 1WEOA 2VJFA 4IR5A 5CP5A 5LKTA 4Q6FA 2E6RA 2KE1A 5D3LA 4A0CD 2VNFA 3S92A 2LXHC 5DYXA 4YYKA 4F52B 5CQ4A 4YYJA 5F1HA 5HCLA 5E0RA 3SOXA 5EPSA 4L7XA 1JM7B 3EB6A 5TDRA 4QY4A 1X0JA 2KREA 2KWJA 4UI9B 1JM7A 3LQIA 4HXKA 4IR4A 5DBMA 5TRBA 3N9QA 2ECTA 4O7AA 3S91A 2M6MA 5EV9A 3SOWA 4KV1A 3IU6A 1F68A 5F5ZA 5F3AA 2I7KA 2C2LA 3LJWA 2ECVA 2FUIA 4XUBA 5FE0A 3N9OA 5CQ6A 2MD8C 4J1PA 4MVTA 4J0SA 4N3WA 2DVQA 4NRCA 2R0VA 5G04B 4A9EA 5B77A 2M3HA 4UP5A 3EB5A 2KFTA 5TABA 3AQAA 3LQHA 2ECJA 2DATA 4ZW1A 5L96A 2I8NA 2YDWA 4QUTA 4LZSA 2L80A 2N9GA 5I83A 4TKPB 5AD2A 1K2FA 1LDJB 5KTXA 4YATA 2LXPC 5L8UA 2G45A 3JVKA 5HQ7A 4YYMA 4CA1A 2DVVA 4UIXA 4ZC9A 5ENCA 3PURA 4PCIA 3KNVA 4NQMA 4MR5A 4IR3A 2MUMA 4J3IA 5C4QA 2K4DA 4YBSA 4B86C 1ZS5A 3VK6A 3I3JA 2L0BA 3M62A 3ZYQA 1WFKA 5C87A 5CY9A 5B79A 2R0YA 4MR4A 2YW8A 4LZ2A 5F1LA 1N87A 4A4CA 5LJ0A 5FE4A 3PUQA 4CFKA 2JMJA 4UIVA 5A5SA 4NN2A 5E7DA 3U5MA 2XB1A 1WILA 2DKWA 4O77A 4GNDA 4CLBA 5I1QA 3QZTA 5G4RA 4OGJA 2LGGA 4NS5A 4NUEA 4B7YC 3LXJA 3Q2FA 3ZPV1 4WZ2A 5EWWA 1BORA 4R8PK 4BJXA 4HXRA 1WEEA 5CS8A 5EVAA 2YYRA 5FBXA 5FG5A 5F25A 3UVWA 4N4FA 4IOQA 1Z6UA 3FKMX 5E9VA 4Q0NA 5IBNA 2LSPB 5LKXA 5BT5A 2WP2A 4NYVA 4GNEA 5A5OA 5FB0A 2XEUA 4NR8A 5D3SA 3O70A 3MHHA 3MULA 4TS8A 1V87A 4PTBA 2L75A 2D82A 1ZBDB 4IC3A 5DX4A 2RNXA 4N4IA 4YYDA 1X4IA 4AYCA 4GPJA 5D3TA 5KH9A 4A9JA 3C6WA 5A82A 3SOUA 3UVXA 5AMEA 5KTUA 2PUYA 5D24A 5FERA 5LUUA 4QSWA 4CCGX 2LGKA 2G43A 4GNFA 4AUQB 5KTWA 3RPGB 5D1MB 1F62A 4O70A 4CUSA 4CUUA 4QSTA 1T1HA 5CUEA 1EQFA 2GRCA 2R10A 4MSXA 2VJEB 4QSPA 5FE6A 2BAYA 4UP0A 4UIUA 5HQ5A 2M1RA 3UV4A 2VJEA 5HLSA 4A9LA 2EODA 4MEOA 4QEVA 4UIZA 5I7XA 4CURA 2CSZA 3FL2A 5B78A 1WE9A 2JRJA 2F42A 2LQ6A 4LLBA 1WEPA 2I50A 4I7DA 4XY8A 3RTRB 3LQJA 5CRMA 4C66A 3NG2A 4R2YA 4TTEA 5I88A 2QICA 4ZDTA 4TT4A 4LKAA 2E7NA 2D8SA 4WZ3B 2CSYA 4BW2A 3L1ZB 5FE3A 4L58A 2D9EA 5JI8A 3MHSA 3IU5A 5FEYA 4V3KC 3U5JA 4AVXA 5L99A 5C89A 4X2IA 4MR6A 3P1FA 2RSDA 2YSMA 5D3RA 2YREA 4P5OB 4QBMA 4UYHA 5KU3A 4FO9A 4OGIA 5TCMA 1IYMA 2RFJA 4TU4A 5DKCA 5LKUA 1MM2A 5I89A 3U5LA 1HYIA 2NAAA 3QZVA 3HCSA 5E9KA 4A9MA 4NQNA 4MEQA 2DVRA 4MENA 5CQ5A 4NR6A 5FB1A 5G4SA 1WEUA 3UW9A 1G25A 4QC3A 5A85A 4UITA 5CQ3A 2K1JA 2RS9B 5FE5A 5D3PA 4CL9A 2QJ0A 4A9FA 5J3XA 5I7YA 4LADB 1N72A 5K29A 4N4GA 5E3GA 2MT5A 3M63A 2F6NA 2IDAA 5E3DA 4TQNA 4Y03A 2K17A 4QF2A 4W4UA 4ALHA 4LYIA 4O71A 3JVJA 2VPDA 5C7NA 5LJ1A 2RO1A 1WUGA 4ALGA 1WUMA 4YYHA 5DYAA 4FK5A 4PS5A 4QZSA 4TU6A 4NR5A 5ENGA 5EA1A 3JVLA 5ENEA 2KIZA 3DPLR 5G0FA 4DONA 2H60A 5EWHA 4UYDA 4UYFB 4J0RA
chains in the Genus database with same CATH superfamily
5ENIA 4NYXA 5II1A 3VKGA 3G0LA 3UV2A 3MB4A 4R7EA 1DCQA 4WIVA 2JUNA 4PCEA 2QIZA 5AITA 4TT2A 3UV5A 5SVIB 5TB6A 1X4JA 2L84A 5CQ8A 4LDFA 1RMDA 1WEQA 2RNWA 3MB3A 2KGIA 3DAIA 4A9IA 2OUOA 1VFYA 2LV9A 4XYAA 2OO1A 4QR4A 4F3IA 3ZPVE 3LVQE 3RPGC 3SVGA 4PPEA 5EWDA 2E6SA 4O7EA 5IGNA 1WGMA 4IORA 3UVDA 4A9NA 5DLXA 3O35A 4YBTA 2VPEA 4AP4A 4LRGA 4AKNA 1JSPB 2YEKA 5CUGA 5FH8A 5ENFA 4YK0A 3QZSA 3D7CA 4NXJA 5CU8A 3O34A 5ENHA 4YC9A 5DW2A 2YW5A 4MEPA 4QSUA 2L5UA 2VPGA 5KHMA 4NUDA 3DQVR 3E2DA 2ECGA 3MXFA 2YEMA 4QR3A 4WHUA 4IC2A 4O64A 3KDEC 5HELA 5AD3A 1WEVA 4HXNA 4UIYA 5FDZA 5DYUA 2MD7B 3O7AA 4C67A 2KGGA 4YH3A 5D25A 1JM4B 4I7BA 5LCWB 3ZNIA 5EM3A 2Y1NA 5C11A 5CPEA 3HCUA 2L7PA 4H9DA 2YURA 5CRZA 4XI1A 4HBYA 1E6IA 5H1UA 4O7CA 1VYXA 2MNYA 2KWOA 2XOYA 2YQLA 4KCXA 4Z93A 2Y1MA 4QSXA 4QSSA 2L5EA 5HM0A 5HRXA 2MIQA 2M13A 3C5KA 4Z1QA 3SVFA 2LRIC 5IGLA 2F6JA 4OGCA 5C8GA 1LDKC 4CUQA 5FFWA 3O36A 4C9ZA 5F60A 5TBNA 2PNXA 5CQ7A 5HFQA 4BW3A 4YYNA 2G6QA 3IHPA 4YYIA 2KWNA 2DX8A 3HMEA 5FG6A 2NXBA 5EQ1A 2CKLB 4HXPA 4WHWA 5D7XA 5DLZA 3FEHA 4AI6A 2Y43A 1CHCA 4NR4A 5EYAF 3SHBA 4BW1A 5CUBA 2CKLA 5FH6A 5H1TA 3JVMA 4NUCA 2MNZA 4LJNA 4A9KA 3N9MA 4LYWA 5DKAA 3P1DA 5HRVA 5LVRA 2H0DB 4MR3A 2RI7A 2ECWA 5BT3A 2LDRA 5EWCA 5CUDA 5CZGA 4I7CA 5I29A 4QEWA 5HJCA 5DKHA 5I3LA 3O33A 4NR7A 4TZ2A 4UYEA 5ETBA 5HFRA 2CSVA 4NRBA 2M85A 3AADA 4LZRA 4QR5A 4LC2A 5C13A 5A7CA 2HYED 5EK9A 4LR6A 2YU4A 4YADA 4IR6A 4QSRA 3Q2EA 5JG6A 3T9KA 2DWWA 5E9MA 2VJFB 4BHWA 5HEMA 3ASLA 5L8TA 3TLPA 4FLPA 5E9YA 1WESA 1JOCA 4RVRA 5HQ6A 2RNYA 5FH7A 5FE2A 4GB0A 3ZTGA 2MKEA 5II2A 4FJCA 4OUFA 3O37A 3UVYA 5B75A 4A9OA 2K16A 4O7FA 5D3NA 1WENA 4QSVA 4HBXA 2YQMA 5CFWA 4V3LC 5F62A 2FFWA 4QF3A 3H7HA 5DFBA 4ZUXU 5E74A 3K2JA 5EGUA 4BBQA 2YQDA 4QSQA 5EPBA 4YABA 2KR4A 4WZ0A 2KU3A 2VP7A 2YUCA 5EISA 3U5NA 4PKLA 2AN6A 5IGKA 2ZETC 1DVPA 4PY6A 5TDWA 3U5PA 2L43A 1FP0A 4TT6A 2C2VS 5I86A 3T6RA 4A4BA 4YY4A 4XY9A 2MA5A 4S3OB 3JUEA 4A9HA 4YH4A 4UYFA 4QNSA 4AKIA 3KV5A 5DY7A 5F63A 4X3GA 4HXLA 4O72A 5F2PA 5HRWA 5DYCA 5B76A 2E7OA 5H1VA 4O78A 1X4UA 5SVIA 4O75A 5I80A 4CFLA 4ZQLA 4CUPA 2YHNA 4E96A 4A49A 4F1PA 2G4AA 5EP7A 3MUKA 2EA6A 3L11A 2ECIA 2YT5A 4TZ8A 5A5PA 3KQIA 3N9NA 3P1CA 5KH3A 3HTKC 5CQAA 5IGMA 1MM3A 4O74A 2LAUA 4WA6A 2IQJA 5FE1A 5G05B 4QYLA 4HXOA 5CQTA 3N9PA 5BT4A 3HMHA 2DVSA 5A83A 4Z6HA 5DINA 2KWKA 5KH7A 5CTLA 5D26A 2UZGA 4YY6A 3LJUX 3RCWA 2ECNA 1HYJA 2E3KA 5A81A 1WEWA 4HBVA 1E4UA 5FG4A 5LVQA 4N4HA 2EGPA 2FUUA 5FE8A 2WP1A 2EXUA 5EPRA 2LGVA 3G0JA 5CGPA 5C85A 5J0DA 4HXSA 4QC1A 4LK9A 3ZVYA 5D1LB 1VD4A 5DFCA 5B8DA 4O62A 2JMIA 4YBMA 1ZKRA 2VPBA 3GV4A 3HCTA 4NRAA 5D3HA 3SUBA 5FFVA 5ENJA 4IOOA 5CUCA 5FE9A 2LN0A 4KV4A 5FFYA 5D1KB 3ZVZB 5A5NA 4HBWA 4LYSA 5E73A 5EICA 3SVHA 3U5OA 1XWHA 3I2DA 4XUAA 4FIPA 1U6GB 3V43A 2R0SA 1WEMA 4AYCB 3U5KA 5LKZA 5D0CA 4O7BA 4Q0OA 2MJVB 5FE7A 2L85A 3M7KA 3D1DA 4TYLA 5I40A 2LGLA 5ACYA 3FANA 4GNGA 2MA6A 2HDPA 4Z1SA 5D3JA 1WIMA 4NYWA 4QQ4A 5CUAA 4QUUA 3T7LA 5L98A 5HENA 5DFDA 5F61A 2FSAA 5H85A 5JWMA 3LRQA 3DWYA 4YYGA 5DW1A 2CT2A 3HMFA 2JMDA 5EI4A 4OGEA 5A5RA 5DKDA 2H0DA 2XOZA 5H9MA 4NR9A 5LJ2A 2YYNA 3GL6A 3L1XA 2JM3A 5AMFA 3N9LA 2OWAA 5EU1A 2YELA 4O76A 3VKHA 2EJNA 3NXBA 4HXMA 5IG6A 5E9LA 4Z6IA 4AKGA 4CUTA 3PHDA 3P1EA 2KTBB 3Q1DA 5A5QA 4QYDA 3KV6A 2YHOA 3M99A 5L97A 4S3OC 5IIDA 4YAXA 4UYGA 5AIUA 2XOCA 5EWVA 5ENBA 5E9IA 5COIA 1FBVA 2YSJA 2OSSA 5F36A 4QEUA 2KYUA 4BW4A 4UIWA 3P5OA 3O47A 3MQMA 5ETDA 1Z2QA 1Z60A 3GG3A 2OXQC 4QB3A 3ZYUA 5KO4A 1WEOA 2VJFA 4IR5A 5CP5A 5LKTA 4Q6FA 2E6RA 2KE1A 5D3LA 4A0CD 2VNFA 3S92A 2LXHC 5DYXA 4YYKA 2RR4A 5CQ4A 4YYJA 4F52B 5F1HA 5HCLA 5E0RA 3SOXA 5EPSA 4L7XA 1JM7B 3EB6A 5TDRA 4QY4A 1X0JA 2CRWA 2KREA 2KWJA 4UI9B 3LQIA 4HXKA 4IR4A 5DBMA 1JM7A 5TRBA 3N9QA 2ECTA 4O7AA 3S91A 2M6MA 2YVRA 5EV9A 3SOWA 4KV1A 3IU6A 1F68A 5F5ZA 5F3AA 2I7KA 2C2LA 3LJWA 2ECVA 2FUIA 4XUBA 2FD4A 5FE0A 3N9OA 5CQ6A 2MD8C 4J1PA 4MVTA 4J0SA 4N3WA 2DVQA 4NRCA 2R0VA 5G04B 4A9EA 5B77A 2B0OE 2M3HA 4UP5A 3EB5A 2KFTA 5TABA 3AQAA 3LQHA 2ECJA 2DATA 4ZW1A 5L96A 2I8NA 2YDWA 4QUTA 4LZSA 2L80A 2KKYA 2N9GA 5I83A 4TKPB 5AD2A 1K2FA 1LDJB 5KTXA 4YATA 2XP0A 2LXPC 5L8UA 2G45A 3JVKA 5HQ7A 4YYMA 4CA1A 2DVVA 4UIXA 4ZC9A 5ENCA 3PURA 4PCIA 3KNVA 4UYFB 4NQMA 4MR5A 4IR3A 2MUMA 4J3IA 5C4QA 4Z0RA 2K4DA 4YBSA 5SVXA 4B86C 1ZS5A 3VK6A 3I3JA 2L0BA 3M62A 3ZYQA 1WFKA 5C87A 5CY9A 5B79A 2R0YA 4MR4A 2YW8A 4LZ2A 2DJAA 5SVYA 5F1LA 1N87A 3FJUB 5LJ0A 4A4CA 5FE4A 3PUQA 4CFKA 2JMJA 4UIVA 5A5SA 4NN2A 5E7DA 3U5MA 2XB1A 1WILA 2DKWA 4O77A 4GNDA 4CLBA 5I1QA 3QZTA 5G4RA 4OGJA 2LGGA 4NS5A 4NUEA 4B7YC 3LXJA 3Q2FA 3ZPV1 4WZ2A 5EWWA 1BORA 4R8PK 4BJXA 4HXRA 1WEEA 5CS8A 5EVAA 2YYRA 5FBXA 5FG5A 5F25A 3UVWA 4N4FA 4IOQA 1PUOA 1Z6UA 3FKMX 5E9VA 4Q0NA 5IBNA 2LSPB 5LKXA 5BT5A 2WP2A 4NYVA 4GNEA 5A5OA 5FB0A 2XEUA 4NR8A 2CONA 5D3SA 3O70A 3MHHA 3MULA 4TS8A 1V87A 4PTBA 2L75A 2D82A 1ZBDB 4IC3A 5DX4A 2RNXA 4N4IA 4YYDA 1X4IA 4AYCA 4GPJA 5D3TA 5KH9A 4A9JA 3C6WA 5A82A 3SOUA 3UVXA 5AMEA 5KTUA 2PUYA 5D24A 5FERA 5LUUA 3ERRA 4QSWA 4CCGX 2LGKA 2G43A 4GNFA 4AUQB 5KTWA 3LDYA 3RPGB 5D1MB 1F62A 4O70A 4CUSA 4CUUA 4QSTA 1T1HA 5CUEA 1EQFA 2GRCA 2R10A 4MSXA 2VJEB 4QSPA 5FE6A 2BAYA 4UP0A 4UIUA 5HQ5A 2KKXA 2M1RA 3UV4A 2VJEA 5HLSA 4A9LA 2EODA 4MEOA 4QEVA 4UIZA 5I7XA 4CURA 3MDBC 2D8UA 2CSZA 3FL2A 5B78A 1WE9A 2JRJA 2F42A 4Z0OA 2LQ6A 4LLBA 3D1BA 1WEPA 2I50A 4I7DA 4XY8A 3RTRB 3LQJA 5CRMA 2DSMA 1MBMA 4C66A 3NG2A 4R2YA 4TTEA 5I88A 2QICA 3LVRE 4TT4A 4ZDTA 3FAOA 5K3QA 4LKAA 2E7NA 2D8SA 4WZ3B 2CSYA 3DWDA 4BW2A 2EGMA 3L1ZB 5FE3A 4L58A 2D9EA 5JI8A 3MHSA 3IU5A 2E61A 5FEYA 4V3KC 3U5JA 4AVXA 5L99A 3PLWA 5C89A 4X2IA 4MR6A 3P1FA 2RSDA 2YSMA 5D3RA 2YREA 4P5OB 4QBMA 4UYHA 5KU3A 4FO9A 4OGIA 5TCMA 1IYMA 2RFJA 4TU4A 5DKCA 5LKUA 1MM2A 5I89A 3U5LA 1HYIA 2NAAA 3QZVA 3HCSA 5E9KA 4A9MA 4NQNA 4MEQA 2DVRA 4MENA 5CQ5A 4NR6A 5FB1A 5G4SA 1WEUA 3UW9A 1G25A 4QC3A 5A85A 4UITA 5CQ3A 2K1JA 2RS9B 5FE5A 5D3PA 4CL9A 2QJ0A 4A9FA 2P57A 5J3XA 5I7YA 4LADB 1N72A 5K29A 4N4GA 5E3GA 2MT5A 3M63A 2F6NA 2IDAA 5E3DA 4TQNA 4Y03A 2K17A 3DDTA 4QF2A 4W4UA 4ALHA 4LYIA 4O71A 3JVJA 2VPDA 5C7NA 5LJ1A 4AKHA 2RO1A 1WUGA 4ALGA 1WUMA 4YYHA 5DYAA 4FK5A 4PS5A 4QZSA 4TU6A 4NR5A 5ENGA 5EA1A 3JVLA 5ENEA 2KIZA 3DPLR 5G0FA 4DONA 2H60A 5EWHA 4UYDA 3ONIA 3FM8C 4J0RA 2CRRA
chains in the Genus database with same CATH topology
5ENIA 4NYXA 5II1A 3G0LA 3UV2A 3MB4A 4R7EA 4WIVA 4PCEA 2QIZA 3ONIA 5AITA 4TT2A 3UV5A 5TB6A 1X4JA 2L84A 5CQ8A 4LDFA 1RMDA 1WEQA 2RNWA 3MB3A 2KGIA 3DAIA 4A9IA 2OUOA 1VFYA 2LV9A 4XYAA 2OO1A 4QR4A 4F3IA 3ZPVE 3RPGC 3SVGA 4PPEA 5EWDA 2E6SA 4O7EA 5IGNA 1WGMA 4IORA 3UVDA 4A9NA 5DLXA 3O35A 4YBTA 2VPEA 4AP4A 4LRGA 4AKNA 1JSPB 2YEKA 5CUGA 5FH8A 5ENFA 4YK0A 3QZSA 3D7CA 4NXJA 5CU8A 3O34A 5ENHA 4YC9A 5DW2A 2YW5A 4MEPA 4QSUA 2L5UA 2VPGA 5KHMA 4NUDA 3DQVR 2ECGA 3MXFA 2YEMA 4QR3A 4WHUA 4IC2A 4O64A 5HELA 5AD3A 1WEVA 4HXNA 4UIYA 5FDZA 5DYUA 2MD7B 3O7AA 4C67A 2KGGA 4YH3A 5D25A 1JM4B 4I7BA 5LCWB 3ZNIA 5EM3A 2Y1NA 5C11A 5CPEA 3HCUA 2YURA 5CRZA 4XI1A 4HBYA 1E6IA 5H1UA 4O7CA 1VYXA 2MNYA 2KWOA 2YQLA 4KCXA 4Z93A 2Y1MA 4QSXA 4QSSA 2L5EA 5HM0A 5HRXA 2MIQA 3C5KA 4Z1QA 3SVFA 2LRIC 5IGLA 2F6JA 5C8GA 1LDKC 4CUQA 5FFWA 3O36A 4C9ZA 5F60A 5TBNA 2PNXA 5CQ7A 5HFQA 4BW3A 4YYNA 2G6QA 3IHPA 4YYIA 2KWNA 2DX8A 3HMEA 5FG6A 2NXBA 5EQ1A 2CKLB 4HXPA 4WHWA 5D7XA 5DLZA 5EYAF 3SHBA 2Y43A 1CHCA 4NR4A 4BW1A 5CUBA 2CKLA 5FH6A 5H1TA 3JVMA 4NUCA 2MNZA 4LJNA 4A9KA 3N9MA 4LYWA 5DKAA 3P1DA 5HRVA 5LVRA 2H0DB 4MR3A 2RI7A 2ECWA 5BT3A 2LDRA 5EWCA 5CUDA 5CZGA 4I7CA 5I29A 4QEWA 5HJCA 5DKHA 5I3LA 3O33A 4NR7A 4TZ2A 4UYEA 5ETBA 5HFRA 4NRBA 2M85A 3AADA 4LZRA 4QR5A 4LC2A 5C13A 5A7CA 2HYED 5EK9A 4LR6A 2YU4A 4YADA 4IR6A 4QSRA 3Q2EA 5JG6A 2DWWA 5E9MA 2VJFB 4BHWA 5HEMA 3ASLA 5L8TA 3TLPA 4FLPA 5E9YA 1WESA 1JOCA 4RVRA 5HQ6A 2RNYA 5FH7A 5FE2A 4GB0A 3ZTGA 5II2A 4FJCA 4OUFA 3O37A 3UVYA 5B75A 4A9OA 2K16A 4O7FA 5D3NA 1WENA 4QSVA 4HBXA 2YQMA 5CFWA 4V3LC 5F62A 4QF3A 5DFBA 4ZUXU 5E74A 3K2JA 5EGUA 4BBQA 2YQDA 4QSQA 5EPBA 4YABA 2KR4A 4WZ0A 2KU3A 2VP7A 2YUCA 5EISA 3U5NA 4PKLA 2AN6A 5IGKA 2ZETC 1DVPA 4PY6A 5TDWA 3U5PA 2L43A 1FP0A 4TT6A 2C2VS 5I86A 3T6RA 4A4BA 4YY4A 4XY9A 2MA5A 4S3OB 4A9HA 4YH4A 4UYFA 4QNSA 3KV5A 5DY7A 5F63A 4X3GA 4HXLA 4O72A 5F2PA 5HRWA 5DYCA 5B76A 2E7OA 5H1VA 4O78A 1X4UA 4O75A 5I80A 4CFLA 4ZQLA 4CUPA 2YHNA 4E96A 4A49A 2G4AA 5EP7A 3MUKA 2EA6A 3L11A 2ECIA 2YT5A 4TZ8A 5A5PA 3KQIA 3N9NA 3P1CA 5KH3A 3HTKC 5CQAA 5IGMA 1MM3A 4O74A 4WA6A 5FE1A 5G05B 4QYLA 4HXOA 5CQTA 3N9PA 5BT4A 3HMHA 2DVSA 5A83A 4Z6HA 5DINA 2KWKA 5KH7A 5CTLA 5D26A 2UZGA 4YY6A 3RCWA 2ECNA 1HYJA 2E3KA 5A81A 1WEWA 4HBVA 1E4UA 5FG4A 5LVQA 4N4HA 2EGPA 2FUUA 5FE8A 2WP1A 5EPRA 2LGVA 3G0JA 5CGPA 5C85A 5J0DA 4HXSA 4QC1A 4LK9A 3ZVYA 5D1LB 1VD4A 5DFCA 5B8DA 2JMIA 4YBMA 2VPBA 3GV4A 3HCTA 4NRAA 5D3HA 5FFVA 5ENJA 4IOOA 5CUCA 5FE9A 2LN0A 4KV4A 5FFYA 5D1KB 3ZVZB 5A5NA 4HBWA 4LYSA 5E73A 5EICA 3SVHA 3U5OA 1XWHA 3I2DA 4XUAA 4FIPA 1U6GB 3V43A 2R0SA 1WEMA 4AYCB 3U5KA 5LKZA 5D0CA 4O7BA 4Q0OA 2MJVB 5FE7A 2L85A 4TYLA 5I40A 2LGLA 5ACYA 4GNGA 2MA6A 2HDPA 4Z1SA 5D3JA 1WIMA 4NYWA 5CUAA 4QUUA 3T7LA 5L98A 5HENA 5DFDA 5F61A 2FSAA 5H85A 5JWMA 3LRQA 3DWYA 4YYGA 5DW1A 2CT2A 3HMFA 2JMDA 5EI4A 5A5RA 5DKDA 2H0DA 5H9MA 4NR9A 5LJ2A 2YYNA 3GL6A 3L1XA 5AMFA 3N9LA 5EU1A 2YELA 4O76A 3NXBA 4HXMA 5IG6A 5E9LA 4Z6IA 3PHDA 4CUTA 3P1EA 2KTBB 5A5QA 4QYDA 3KV6A 2YHOA 3M99A 5L97A 4S3OC 5IIDA 4YAXA 4UYGA 5AIUA 5EWVA 5ENBA 5E9IA 5COIA 1FBVA 2YSJA 2OSSA 5F36A 4QEUA 2KYUA 4BW4A 4UIWA 3P5OA 3MQMA 5ETDA 1Z2QA 1Z60A 3GG3A 2OXQC 4QB3A 3ZYUA 5KO4A 1WEOA 2VJFA 4IR5A 5CP5A 5LKTA 4Q6FA 2E6RA 2KE1A 5D3LA 4A0CD 2VNFA 3S92A 2LXHC 5DYXA 4YYKA 4F52B 5CQ4A 4YYJA 5F1HA 5HCLA 5E0RA 3SOXA 5EPSA 4L7XA 1JM7B 3EB6A 5TDRA 4QY4A 1X0JA 2KREA 2KWJA 4UI9B 1JM7A 3LQIA 4HXKA 4IR4A 5DBMA 5TRBA 3N9QA 2ECTA 4O7AA 3S91A 2M6MA 5EV9A 3SOWA 4KV1A 3IU6A 1F68A 5F5ZA 5F3AA 2I7KA 2C2LA 3LJWA 2ECVA 2FUIA 4XUBA 5FE0A 3N9OA 5CQ6A 2MD8C 4J1PA 4MVTA 4J0SA 4N3WA 2DVQA 4NRCA 2R0VA 5G04B 4A9EA 5B77A 2M3HA 4UP5A 3EB5A 2KFTA 5TABA 3AQAA 3LQHA 2ECJA 2DATA 4ZW1A 5L96A 2I8NA 2YDWA 4QUTA 4LZSA 2L80A 2N9GA 5I83A 4TKPB 5AD2A 1K2FA 1LDJB 5KTXA 4YATA 2LXPC 5L8UA 2G45A 3JVKA 5HQ7A 4YYMA 4CA1A 2DVVA 4UIXA 4ZC9A 5ENCA 3PURA 4PCIA 3KNVA 4NQMA 4MR5A 4IR3A 2MUMA 4J3IA 5C4QA 2K4DA 4YBSA 4B86C 1ZS5A 3VK6A 3I3JA 2L0BA 3M62A 3ZYQA 1WFKA 5C87A 5CY9A 5B79A 2R0YA 4MR4A 2YW8A 4LZ2A 5F1LA 1N87A 4A4CA 5LJ0A 5FE4A 3PUQA 4CFKA 2JMJA 4UIVA 5A5SA 4NN2A 5E7DA 3U5MA 2XB1A 1WILA 2DKWA 4O77A 4GNDA 4CLBA 5I1QA 3QZTA 5G4RA 4OGJA 2LGGA 4NS5A 4NUEA 4B7YC 3LXJA 3Q2FA 3ZPV1 4WZ2A 5EWWA 1BORA 4R8PK 4BJXA 4HXRA 1WEEA 5CS8A 5EVAA 2YYRA 5FBXA 5FG5A 5F25A 3UVWA 4N4FA 4IOQA 1Z6UA 3FKMX 5E9VA 4Q0NA 5IBNA 2LSPB 5LKXA 5BT5A 2WP2A 4NYVA 4GNEA 5A5OA 5FB0A 2XEUA 4NR8A 5D3SA 3O70A 3MHHA 3MULA 4TS8A 1V87A 4PTBA 2L75A 2D82A 1ZBDB 4IC3A 5DX4A 2RNXA 4N4IA 4YYDA 1X4IA 4AYCA 4GPJA 5D3TA 5KH9A 4A9JA 3C6WA 5A82A 3SOUA 3UVXA 5AMEA 5KTUA 2PUYA 5D24A 5FERA 5LUUA 4QSWA 4CCGX 2LGKA 2G43A 4GNFA 4AUQB 5KTWA 3RPGB 5D1MB 1F62A 4O70A 4CUSA 4CUUA 4QSTA 1T1HA 5CUEA 1EQFA 2GRCA 2R10A 4MSXA 2VJEB 4QSPA 5FE6A 2BAYA 4UP0A 4UIUA 5HQ5A 2M1RA 3UV4A 2VJEA 5HLSA 4A9LA 2EODA 4MEOA 4QEVA 4UIZA 5I7XA 4CURA 2CSZA 3FL2A 5B78A 1WE9A 2JRJA 2F42A 2LQ6A 4LLBA 1WEPA 2I50A 4I7DA 4XY8A 3RTRB 3LQJA 5CRMA 4C66A 3NG2A 4R2YA 4TTEA 5I88A 2QICA 4ZDTA 4TT4A 4LKAA 2E7NA 2D8SA 4WZ3B 2CSYA 4BW2A 3L1ZB 5FE3A 4L58A 2D9EA 5JI8A 3MHSA 3IU5A 5FEYA 4V3KC 3U5JA 4AVXA 5L99A 5C89A 4X2IA 4MR6A 3P1FA 2RSDA 2YSMA 5D3RA 2YREA 4P5OB 4QBMA 4UYHA 5KU3A 4FO9A 4OGIA 5TCMA 1IYMA 2RFJA 4TU4A 5DKCA 5LKUA 1MM2A 5I89A 3U5LA 1HYIA 2NAAA 3QZVA 3HCSA 5E9KA 4A9MA 4NQNA 4MEQA 2DVRA 4MENA 5CQ5A 4NR6A 5FB1A 5G4SA 1WEUA 3UW9A 1G25A 4QC3A 5A85A 4UITA 5CQ3A 2K1JA 2RS9B 5FE5A 5D3PA 4CL9A 2QJ0A 4A9FA 5J3XA 5I7YA 4LADB 1N72A 5K29A 4N4GA 5E3GA 2MT5A 3M63A 2F6NA 2IDAA 5E3DA 4TQNA 4Y03A 2K17A 4QF2A 4W4UA 4ALHA 4LYIA 4O71A 3JVJA 2VPDA 5C7NA 5LJ1A 2RO1A 1WUGA 4ALGA 1WUMA 4YYHA 5DYAA 4FK5A 4PS5A 4QZSA 4TU6A 4NR5A 5ENGA 5EA1A 3JVLA 5ENEA 2KIZA 3DPLR 5G0FA 4DONA 2H60A 5EWHA 4UYDA 4UYFB 4J0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENI A;  4NYX A;  5II1 A;  3G0L A;  3UV2 A;  3MB4 A;  4R7E A;  4WIV A;  4PCE A;  2QIZ A;  3ONI A;  5AIT A;  4TT2 A;  3UV5 A;  5TB6 A;  1X4J A;  2L84 A;  5CQ8 A;  4LDF A;  1RMD A;  1WEQ A;  2RNW A;  3MB3 A;  2KGI A;  3DAI A;  4A9I A;  2OUO A;  1VFY A;  2LV9 A;  4XYA A;  2OO1 A;  4QR4 A;  4F3I A;  3ZPV E;  3RPG C;  3SVG A;  4PPE A;  5EWD A;  2E6S A;  4O7E A;  5IGN A;  1WGM A;  4IOR A;  3UVD A;  4A9N A;  5DLX A;  3O35 A;  4YBT A;  2VPE A;  4AP4 A;  4LRG A;  4AKN A;  1JSP B;  2YEK A;  5CUG A;  5FH8 A;  5ENF A;  4YK0 A;  3QZS A;  3D7C A;  4NXJ A;  5CU8 A;  3O34 A;  5ENH A;  4YC9 A;  5DW2 A;  2YW5 A;  4MEP A;  4QSU A;  2L5U A;  2VPG A;  5KHM A;  4NUD A;  3DQV R;  2ECG A;  3MXF A;  2YEM A;  4QR3 A;  4WHU A;  4IC2 A;  4O64 A;  5HEL A;  5AD3 A;  1WEV A;  4HXN A;  4UIY A;  5FDZ A;  5DYU A;  2MD7 B;  3O7A A;  4C67 A;  2KGG A;  4YH3 A;  5D25 A;  1JM4 B;  4I7B A;  5LCW B;  3ZNI A;  5EM3 A;  2Y1N A;  5C11 A;  5CPE A;  3HCU A;  2YUR A;  5CRZ A;  4XI1 A;  4HBY A;  1E6I A;  5H1U A;  4O7C A;  1VYX A;  2MNY A;  2KWO A;  2YQL A;  4KCX A;  4Z93 A;  2Y1M A;  4QSX A;  4QSS A;  2L5E A;  5HM0 A;  5HRX A;  2MIQ A;  3C5K A;  4Z1Q A;  3SVF A;  2LRI C;  5IGL A;  2F6J A;  5C8G A;  1LDK C;  4CUQ A;  5FFW A;  3O36 A;  4C9Z A;  5F60 A;  5TBN A;  2PNX A;  5CQ7 A;  5HFQ A;  4BW3 A;  4YYN A;  2G6Q A;  3IHP A;  4YYI A;  2KWN A;  2DX8 A;  3HME A;  5FG6 A;  2NXB A;  5EQ1 A;  2CKL B;  4HXP A;  4WHW A;  5D7X A;  5DLZ A;  5EYA F;  3SHB A;  2Y43 A;  1CHC A;  4NR4 A;  4BW1 A;  5CUB A;  2CKL A;  5FH6 A;  5H1T A;  3JVM A;  4NUC A;  2MNZ A;  4LJN A;  4A9K A;  3N9M A;  4LYW A;  5DKA A;  3P1D A;  5HRV A;  5LVR A;  2H0D B;  4MR3 A;  2RI7 A;  2ECW A;  5BT3 A;  2LDR A;  5EWC A;  5CUD A;  5CZG A;  4I7C A;  5I29 A;  4QEW A;  5HJC A;  5DKH A;  5I3L A;  3O33 A;  4NR7 A;  4TZ2 A;  4UYE A;  5ETB A;  5HFR A;  4NRB A;  2M85 A;  3AAD A;  4LZR A;  4QR5 A;  4LC2 A;  5C13 A;  5A7C A;  2HYE D;  5EK9 A;  4LR6 A;  2YU4 A;  4YAD A;  4IR6 A;  4QSR A;  3Q2E A;  5JG6 A;  2DWW A;  5E9M A;  2VJF B;  4BHW A;  5HEM A;  3ASL A;  5L8T A;  3TLP A;  4FLP A;  5E9Y A;  1WES A;  1JOC A;  4RVR A;  5HQ6 A;  2RNY A;  5FH7 A;  5FE2 A;  4GB0 A;  3ZTG A;  5II2 A;  4FJC A;  4OUF A;  3O37 A;  3UVY A;  5B75 A;  4A9O A;  2K16 A;  4O7F A;  5D3N A;  1WEN A;  4QSV A;  4HBX A;  2YQM A;  5CFW A;  4V3L C;  5F62 A;  4QF3 A;  5DFB A;  4ZUX U;  5E74 A;  3K2J A;  5EGU A;  4BBQ A;  2YQD A;  4QSQ A;  5EPB A;  4YAB A;  2KR4 A;  4WZ0 A;  2KU3 A;  2VP7 A;  2YUC A;  5EIS A;  3U5N A;  4PKL A;  2AN6 A;  5IGK A;  2ZET C;  1DVP A;  4PY6 A;  5TDW A;  3U5P A;  2L43 A;  1FP0 A;  4TT6 A;  2C2V S;  5I86 A;  3T6R A;  4A4B A;  4YY4 A;  4XY9 A;  2MA5 A;  4S3O B;  4A9H A;  4YH4 A;  4UYF A;  4QNS A;  3KV5 A;  5DY7 A;  5F63 A;  4X3G A;  4HXL A;  4O72 A;  5F2P A;  5HRW A;  5DYC A;  5B76 A;  2E7O A;  5H1V A;  4O78 A;  1X4U A;  4O75 A;  5I80 A;  4CFL A;  4ZQL A;  4CUP A;  2YHN A;  4E96 A;  4A49 A;  2G4A A;  5EP7 A;  3MUK A;  2EA6 A;  3L11 A;  2ECI A;  2YT5 A;  4TZ8 A;  5A5P A;  3KQI A;  3N9N A;  3P1C A;  5KH3 A;  3HTK C;  5CQA A;  5IGM A;  1MM3 A;  4O74 A;  4WA6 A;  5FE1 A;  5G05 B;  4QYL A;  4HXO A;  5CQT A;  3N9P A;  5BT4 A;  3HMH A;  2DVS A;  5A83 A;  4Z6H A;  5DIN A;  2KWK A;  5KH7 A;  5CTL A;  5D26 A;  2UZG A;  4YY6 A;  3RCW A;  2ECN A;  1HYJ A;  2E3K A;  5A81 A;  1WEW A;  4HBV A;  1E4U A;  5FG4 A;  5LVQ A;  4N4H A;  2EGP A;  2FUU A;  5FE8 A;  2WP1 A;  5EPR A;  2LGV A;  3G0J A;  5CGP A;  5C85 A;  5J0D A;  4HXS A;  4QC1 A;  4LK9 A;  3ZVY A;  5D1L B;  1VD4 A;  5DFC A;  5B8D A;  2JMI A;  4YBM A;  2VPB A;  3GV4 A;  3HCT A;  4NRA A;  5D3H A;  5FFV A;  5ENJ A;  4IOO A;  5CUC A;  5FE9 A;  2LN0 A;  4KV4 A;  5FFY A;  5D1K B;  3ZVZ B;  5A5N A;  4HBW A;  4LYS A;  5E73 A;  5EIC A;  3SVH A;  3U5O A;  1XWH A;  3I2D A;  4XUA A;  4FIP A;  1U6G B;  3V43 A;  2R0S A;  1WEM A;  4AYC B;  3U5K A;  5LKZ A;  5D0C A;  4O7B A;  4Q0O A;  2MJV B;  5FE7 A;  2L85 A;  4TYL A;  5I40 A;  2LGL A;  5ACY A;  4GNG A;  2MA6 A;  2HDP A;  4Z1S A;  5D3J A;  1WIM A;  4NYW A;  5CUA A;  4QUU A;  3T7L A;  5L98 A;  5HEN A;  5DFD A;  5F61 A;  2FSA A;  5H85 A;  5JWM A;  3LRQ A;  3DWY A;  4YYG A;  5DW1 A;  2CT2 A;  3HMF A;  2JMD A;  5EI4 A;  5A5R A;  5DKD A;  2H0D A;  5H9M A;  4NR9 A;  5LJ2 A;  2YYN A;  3GL6 A;  3L1X A;  5AMF A;  3N9L A;  5EU1 A;  2YEL A;  4O76 A;  3NXB A;  4HXM A;  5IG6 A;  5E9L A;  4Z6I A;  3PHD A;  4CUT A;  3P1E A;  2KTB B;  5A5Q A;  4QYD A;  3KV6 A;  2YHO A;  3M99 A;  5L97 A;  4S3O C;  5IID A;  4YAX A;  4UYG A;  5AIU A;  5EWV A;  5ENB A;  5E9I A;  5COI A;  1FBV A;  2YSJ A;  2OSS A;  5F36 A;  4QEU A;  2KYU A;  4BW4 A;  4UIW A;  3P5O A;  3MQM A;  5ETD A;  1Z2Q A;  1Z60 A;  3GG3 A;  2OXQ C;  4QB3 A;  3ZYU A;  5KO4 A;  1WEO A;  2VJF A;  4IR5 A;  5CP5 A;  5LKT A;  4Q6F A;  2E6R A;  2KE1 A;  5D3L A;  4A0C D;  2VNF A;  3S92 A;  2LXH C;  5DYX A;  4YYK A;  4F52 B;  5CQ4 A;  4YYJ A;  5F1H A;  5HCL A;  5E0R A;  3SOX A;  5EPS A;  4L7X A;  1JM7 B;  3EB6 A;  5TDR A;  4QY4 A;  1X0J A;  2KRE A;  2KWJ A;  4UI9 B;  1JM7 A;  3LQI A;  4HXK A;  4IR4 A;  5DBM A;  5TRB A;  3N9Q A;  2ECT A;  4O7A A;  3S91 A;  2M6M A;  5EV9 A;  3SOW A;  4KV1 A;  3IU6 A;  1F68 A;  5F5Z A;  5F3A A;  2I7K A;  2C2L A;  3LJW A;  2ECV A;  2FUI A;  4XUB A;  5FE0 A;  3N9O A;  5CQ6 A;  2MD8 C;  4J1P A;  4MVT A;  4J0S A;  4N3W A;  2DVQ A;  4NRC A;  2R0V A;  5G04 B;  4A9E A;  5B77 A;  2M3H A;  4UP5 A;  3EB5 A;  2KFT A;  5TAB A;  3AQA A;  3LQH A;  2ECJ A;  2DAT A;  4ZW1 A;  5L96 A;  2I8N A;  2YDW A;  4QUT A;  4LZS A;  2L80 A;  2N9G A;  5I83 A;  4TKP B;  5AD2 A;  1K2F A;  1LDJ B;  5KTX A;  4YAT A;  2LXP C;  5L8U A;  2G45 A;  3JVK A;  5HQ7 A;  4YYM A;  4CA1 A;  2DVV A;  4UIX A;  4ZC9 A;  5ENC A;  3PUR A;  4PCI A;  3KNV A;  4NQM A;  4MR5 A;  4IR3 A;  2MUM A;  4J3I A;  5C4Q A;  2K4D A;  4YBS A;  4B86 C;  1ZS5 A;  3VK6 A;  3I3J A;  2L0B A;  3M62 A;  3ZYQ A;  1WFK A;  5C87 A;  5CY9 A;  5B79 A;  2R0Y A;  4MR4 A;  2YW8 A;  4LZ2 A;  5F1L A;  1N87 A;  4A4C A;  5LJ0 A;  5FE4 A;  3PUQ A;  4CFK A;  2JMJ A;  4UIV A;  5A5S A;  4NN2 A;  5E7D A;  3U5M A;  2XB1 A;  1WIL A;  2DKW A;  4O77 A;  4GND A;  4CLB A;  5I1Q A;  3QZT A;  5G4R A;  4OGJ A;  2LGG A;  4NS5 A;  4NUE A;  4B7Y C;  3LXJ A;  3Q2F A;  3ZPV 1;  4WZ2 A;  5EWW A;  1BOR A;  4R8P K;  4BJX A;  4HXR A;  1WEE A;  5CS8 A;  5EVA A;  2YYR A;  5FBX A;  5FG5 A;  5F25 A;  3UVW A;  4N4F A;  4IOQ A;  1Z6U A;  3FKM X;  5E9V A;  4Q0N A;  5IBN A;  2LSP B;  5LKX A;  5BT5 A;  2WP2 A;  4NYV A;  4GNE A;  5A5O A;  5FB0 A;  2XEU A;  4NR8 A;  5D3S A;  3O70 A;  3MHH A;  3MUL A;  4TS8 A;  1V87 A;  4PTB A;  2L75 A;  2D82 A;  1ZBD B;  4IC3 A;  5DX4 A;  2RNX A;  4N4I A;  4YYD A;  1X4I A;  4AYC A;  4GPJ A;  5D3T A;  5KH9 A;  4A9J A;  3C6W A;  5A82 A;  3SOU A;  3UVX A;  5AME A;  5KTU A;  2PUY A;  5D24 A;  5FER A;  5LUU A;  4QSW A;  4CCG X;  2LGK A;  2G43 A;  4GNF A;  4AUQ B;  5KTW A;  3RPG B;  5D1M B;  1F62 A;  4O70 A;  4CUS A;  4CUU A;  4QST A;  1T1H A;  5CUE A;  1EQF A;  2GRC A;  2R10 A;  4MSX A;  2VJE B;  4QSP A;  5FE6 A;  2BAY A;  4UP0 A;  4UIU A;  5HQ5 A;  2M1R A;  3UV4 A;  2VJE A;  5HLS A;  4A9L A;  2EOD A;  4MEO A;  4QEV A;  4UIZ A;  5I7X A;  4CUR A;  2CSZ A;  3FL2 A;  5B78 A;  1WE9 A;  2JRJ A;  2F42 A;  2LQ6 A;  4LLB A;  1WEP A;  2I50 A;  4I7D A;  4XY8 A;  3RTR B;  3LQJ A;  5CRM A;  4C66 A;  3NG2 A;  4R2Y A;  4TTE A;  5I88 A;  2QIC A;  4ZDT A;  4TT4 A;  4LKA A;  2E7N A;  2D8S A;  4WZ3 B;  2CSY A;  4BW2 A;  3L1Z B;  5FE3 A;  4L58 A;  2D9E A;  5JI8 A;  3MHS A;  3IU5 A;  5FEY A;  4V3K C;  3U5J A;  4AVX A;  5L99 A;  5C89 A;  4X2I A;  4MR6 A;  3P1F A;  2RSD A;  2YSM A;  5D3R A;  2YRE A;  4P5O B;  4QBM A;  4UYH A;  5KU3 A;  4FO9 A;  4OGI A;  5TCM A;  1IYM A;  2RFJ A;  4TU4 A;  5DKC A;  5LKU A;  1MM2 A;  5I89 A;  3U5L A;  1HYI A;  2NAA A;  3QZV A;  3HCS A;  5E9K A;  4A9M A;  4NQN A;  4MEQ A;  2DVR A;  4MEN A;  5CQ5 A;  4NR6 A;  5FB1 A;  5G4S A;  1WEU A;  3UW9 A;  1G25 A;  4QC3 A;  5A85 A;  4UIT A;  5CQ3 A;  2K1J A;  2RS9 B;  5FE5 A;  5D3P A;  4CL9 A;  2QJ0 A;  4A9F A;  5J3X A;  5I7Y A;  4LAD B;  1N72 A;  5K29 A;  4N4G A;  5E3G A;  2MT5 A;  3M63 A;  2F6N A;  2IDA A;  5E3D A;  4TQN A;  4Y03 A;  2K17 A;  4QF2 A;  4W4U A;  4ALH A;  4LYI A;  4O71 A;  3JVJ A;  2VPD A;  5C7N A;  5LJ1 A;  2RO1 A;  1WUG A;  4ALG A;  1WUM A;  4YYH A;  5DYA A;  4FK5 A;  4PS5 A;  4QZS A;  4TU6 A;  4NR5 A;  5ENG A;  5EA1 A;  3JVL A;  5ENE A;  2KIZ A;  3DPL R;  5G0F A;  4DON A;  2H60 A;  5EWH A;  4UYD A;  4UYF B;  4J0R A; 
#chains in the Genus database with same CATH topology
 5ENI A;  4NYX A;  5II1 A;  3VKG A;  3G0L A;  3UV2 A;  3MB4 A;  4R7E A;  1DCQ A;  4WIV A;  2JUN A;  4PCE A;  2QIZ A;  5AIT A;  4TT2 A;  3UV5 A;  5SVI B;  5TB6 A;  1X4J A;  2L84 A;  5CQ8 A;  4LDF A;  1RMD A;  1WEQ A;  2RNW A;  3MB3 A;  2KGI A;  3DAI A;  4A9I A;  2OUO A;  1VFY A;  2LV9 A;  4XYA A;  2OO1 A;  4QR4 A;  4F3I A;  3ZPV E;  3LVQ E;  3RPG C;  3SVG A;  4PPE A;  5EWD A;  2E6S A;  4O7E A;  5IGN A;  1WGM A;  4IOR A;  3UVD A;  4A9N A;  5DLX A;  3O35 A;  4YBT A;  2VPE A;  4AP4 A;  4LRG A;  4AKN A;  1JSP B;  2YEK A;  5CUG A;  5FH8 A;  5ENF A;  4YK0 A;  3QZS A;  3D7C A;  4NXJ A;  5CU8 A;  3O34 A;  5ENH A;  4YC9 A;  5DW2 A;  2YW5 A;  4MEP A;  4QSU A;  2L5U A;  2VPG A;  5KHM A;  4NUD A;  3DQV R;  3E2D A;  2ECG A;  3MXF A;  2YEM A;  4QR3 A;  4WHU A;  4IC2 A;  4O64 A;  3KDE C;  5HEL A;  5AD3 A;  1WEV A;  4HXN A;  4UIY A;  5FDZ A;  5DYU A;  2MD7 B;  3O7A A;  4C67 A;  2KGG A;  4YH3 A;  5D25 A;  1JM4 B;  4I7B A;  5LCW B;  3ZNI A;  5EM3 A;  2Y1N A;  5C11 A;  5CPE A;  3HCU A;  2L7P A;  4H9D A;  2YUR A;  5CRZ A;  4XI1 A;  4HBY A;  1E6I A;  5H1U A;  4O7C A;  1VYX A;  2MNY A;  2KWO A;  2XOY A;  2YQL A;  4KCX A;  4Z93 A;  2Y1M A;  4QSX A;  4QSS A;  2L5E A;  5HM0 A;  5HRX A;  2MIQ A;  2M13 A;  3C5K A;  4Z1Q A;  3SVF A;  2LRI C;  5IGL A;  2F6J A;  4OGC A;  5C8G A;  1LDK C;  4CUQ A;  5FFW A;  3O36 A;  4C9Z A;  5F60 A;  5TBN A;  2PNX A;  5CQ7 A;  5HFQ A;  4BW3 A;  4YYN A;  2G6Q A;  3IHP A;  4YYI A;  2KWN A;  2DX8 A;  3HME A;  5FG6 A;  2NXB A;  5EQ1 A;  2CKL B;  4HXP A;  4WHW A;  5D7X A;  5DLZ A;  3FEH A;  4AI6 A;  2Y43 A;  1CHC A;  4NR4 A;  5EYA F;  3SHB A;  4BW1 A;  5CUB A;  2CKL A;  5FH6 A;  5H1T A;  3JVM A;  4NUC A;  2MNZ A;  4LJN A;  4A9K A;  3N9M A;  4LYW A;  5DKA A;  3P1D A;  5HRV A;  5LVR A;  2H0D B;  4MR3 A;  2RI7 A;  2ECW A;  5BT3 A;  2LDR A;  5EWC A;  5CUD A;  5CZG A;  4I7C A;  5I29 A;  4QEW A;  5HJC A;  5DKH A;  5I3L A;  3O33 A;  4NR7 A;  4TZ2 A;  4UYE A;  5ETB A;  5HFR A;  2CSV A;  4NRB A;  2M85 A;  3AAD A;  4LZR A;  4QR5 A;  4LC2 A;  5C13 A;  5A7C A;  2HYE D;  5EK9 A;  4LR6 A;  2YU4 A;  4YAD A;  4IR6 A;  4QSR A;  3Q2E A;  5JG6 A;  3T9K A;  2DWW A;  5E9M A;  2VJF B;  4BHW A;  5HEM A;  3ASL A;  5L8T A;  3TLP A;  4FLP A;  5E9Y A;  1WES A;  1JOC A;  4RVR A;  5HQ6 A;  2RNY A;  5FH7 A;  5FE2 A;  4GB0 A;  3ZTG A;  2MKE A;  5II2 A;  4FJC A;  4OUF A;  3O37 A;  3UVY A;  5B75 A;  4A9O A;  2K16 A;  4O7F A;  5D3N A;  1WEN A;  4QSV A;  4HBX A;  2YQM A;  5CFW A;  4V3L C;  5F62 A;  2FFW A;  4QF3 A;  3H7H A;  5DFB A;  4ZUX U;  5E74 A;  3K2J A;  5EGU A;  4BBQ A;  2YQD A;  4QSQ A;  5EPB A;  4YAB A;  2KR4 A;  4WZ0 A;  2KU3 A;  2VP7 A;  2YUC A;  5EIS A;  3U5N A;  4PKL A;  2AN6 A;  5IGK A;  2ZET C;  1DVP A;  4PY6 A;  5TDW A;  3U5P A;  2L43 A;  1FP0 A;  4TT6 A;  2C2V S;  5I86 A;  3T6R A;  4A4B A;  4YY4 A;  4XY9 A;  2MA5 A;  4S3O B;  3JUE A;  4A9H A;  4YH4 A;  4UYF A;  4QNS A;  4AKI A;  3KV5 A;  5DY7 A;  5F63 A;  4X3G A;  4HXL A;  4O72 A;  5F2P A;  5HRW A;  5DYC A;  5B76 A;  2E7O A;  5H1V A;  4O78 A;  1X4U A;  5SVI A;  4O75 A;  5I80 A;  4CFL A;  4ZQL A;  4CUP A;  2YHN A;  4E96 A;  4A49 A;  4F1P A;  2G4A A;  5EP7 A;  3MUK A;  2EA6 A;  3L11 A;  2ECI A;  2YT5 A;  4TZ8 A;  5A5P A;  3KQI A;  3N9N A;  3P1C A;  5KH3 A;  3HTK C;  5CQA A;  5IGM A;  1MM3 A;  4O74 A;  2LAU A;  4WA6 A;  2IQJ A;  5FE1 A;  5G05 B;  4QYL A;  4HXO A;  5CQT A;  3N9P A;  5BT4 A;  3HMH A;  2DVS A;  5A83 A;  4Z6H A;  5DIN A;  2KWK A;  5KH7 A;  5CTL A;  5D26 A;  2UZG A;  4YY6 A;  3LJU X;  3RCW A;  2ECN A;  1HYJ A;  2E3K A;  5A81 A;  1WEW A;  4HBV A;  1E4U A;  5FG4 A;  5LVQ A;  4N4H A;  2EGP A;  2FUU A;  5FE8 A;  2WP1 A;  2EXU A;  5EPR A;  2LGV A;  3G0J A;  5CGP A;  5C85 A;  5J0D A;  4HXS A;  4QC1 A;  4LK9 A;  3ZVY A;  5D1L B;  1VD4 A;  5DFC A;  5B8D A;  4O62 A;  2JMI A;  4YBM A;  1ZKR A;  2VPB A;  3GV4 A;  3HCT A;  4NRA A;  5D3H A;  3SUB A;  5FFV A;  5ENJ A;  4IOO A;  5CUC A;  5FE9 A;  2LN0 A;  4KV4 A;  5FFY A;  5D1K B;  3ZVZ B;  5A5N A;  4HBW A;  4LYS A;  5E73 A;  5EIC A;  3SVH A;  3U5O A;  1XWH A;  3I2D A;  4XUA A;  4FIP A;  1U6G B;  3V43 A;  2R0S A;  1WEM A;  4AYC B;  3U5K A;  5LKZ A;  5D0C A;  4O7B A;  4Q0O A;  2MJV B;  5FE7 A;  2L85 A;  3M7K A;  3D1D A;  4TYL A;  5I40 A;  2LGL A;  5ACY A;  3FAN A;  4GNG A;  2MA6 A;  2HDP A;  4Z1S A;  5D3J A;  1WIM A;  4NYW A;  4QQ4 A;  5CUA A;  4QUU A;  3T7L A;  5L98 A;  5HEN A;  5DFD A;  5F61 A;  2FSA A;  5H85 A;  5JWM A;  3LRQ A;  3DWY A;  4YYG A;  5DW1 A;  2CT2 A;  3HMF A;  2JMD A;  5EI4 A;  4OGE A;  5A5R A;  5DKD A;  2H0D A;  2XOZ A;  5H9M A;  4NR9 A;  5LJ2 A;  2YYN A;  3GL6 A;  3L1X A;  2JM3 A;  5AMF A;  3N9L A;  2OWA A;  5EU1 A;  2YEL A;  4O76 A;  3VKH A;  2EJN A;  3NXB A;  4HXM A;  5IG6 A;  5E9L A;  4Z6I A;  4AKG A;  4CUT A;  3PHD A;  3P1E A;  2KTB B;  3Q1D A;  5A5Q A;  4QYD A;  3KV6 A;  2YHO A;  3M99 A;  5L97 A;  4S3O C;  5IID A;  4YAX A;  4UYG A;  5AIU A;  2XOC A;  5EWV A;  5ENB A;  5E9I A;  5COI A;  1FBV A;  2YSJ A;  2OSS A;  5F36 A;  4QEU A;  2KYU A;  4BW4 A;  4UIW A;  3P5O A;  3O47 A;  3MQM A;  5ETD A;  1Z2Q A;  1Z60 A;  3GG3 A;  2OXQ C;  4QB3 A;  3ZYU A;  5KO4 A;  1WEO A;  2VJF A;  4IR5 A;  5CP5 A;  5LKT A;  4Q6F A;  2E6R A;  2KE1 A;  5D3L A;  4A0C D;  2VNF A;  3S92 A;  2LXH C;  5DYX A;  4YYK A;  2RR4 A;  5CQ4 A;  4YYJ A;  4F52 B;  5F1H A;  5HCL A;  5E0R A;  3SOX A;  5EPS A;  4L7X A;  1JM7 B;  3EB6 A;  5TDR A;  4QY4 A;  1X0J A;  2CRW A;  2KRE A;  2KWJ A;  4UI9 B;  3LQI A;  4HXK A;  4IR4 A;  5DBM A;  1JM7 A;  5TRB A;  3N9Q A;  2ECT A;  4O7A A;  3S91 A;  2M6M A;  2YVR A;  5EV9 A;  3SOW A;  4KV1 A;  3IU6 A;  1F68 A;  5F5Z A;  5F3A A;  2I7K A;  2C2L A;  3LJW A;  2ECV A;  2FUI A;  4XUB A;  2FD4 A;  5FE0 A;  3N9O A;  5CQ6 A;  2MD8 C;  4J1P A;  4MVT A;  4J0S A;  4N3W A;  2DVQ A;  4NRC A;  2R0V A;  5G04 B;  4A9E A;  5B77 A;  2B0O E;  2M3H A;  4UP5 A;  3EB5 A;  2KFT A;  5TAB A;  3AQA A;  3LQH A;  2ECJ A;  2DAT A;  4ZW1 A;  5L96 A;  2I8N A;  2YDW A;  4QUT A;  4LZS A;  2L80 A;  2KKY A;  2N9G A;  5I83 A;  4TKP B;  5AD2 A;  1K2F A;  1LDJ B;  5KTX A;  4YAT A;  2XP0 A;  2LXP C;  5L8U A;  2G45 A;  3JVK A;  5HQ7 A;  4YYM A;  4CA1 A;  2DVV A;  4UIX A;  4ZC9 A;  5ENC A;  3PUR A;  4PCI A;  3KNV A;  4UYF B;  4NQM A;  4MR5 A;  4IR3 A;  2MUM A;  4J3I A;  5C4Q A;  4Z0R A;  2K4D A;  4YBS A;  5SVX A;  4B86 C;  1ZS5 A;  3VK6 A;  3I3J A;  2L0B A;  3M62 A;  3ZYQ A;  1WFK A;  5C87 A;  5CY9 A;  5B79 A;  2R0Y A;  4MR4 A;  2YW8 A;  4LZ2 A;  2DJA A;  5SVY A;  5F1L A;  1N87 A;  3FJU B;  5LJ0 A;  4A4C A;  5FE4 A;  3PUQ A;  4CFK A;  2JMJ A;  4UIV A;  5A5S A;  4NN2 A;  5E7D A;  3U5M A;  2XB1 A;  1WIL A;  2DKW A;  4O77 A;  4GND A;  4CLB A;  5I1Q A;  3QZT A;  5G4R A;  4OGJ A;  2LGG A;  4NS5 A;  4NUE A;  4B7Y C;  3LXJ A;  3Q2F A;  3ZPV 1;  4WZ2 A;  5EWW A;  1BOR A;  4R8P K;  4BJX A;  4HXR A;  1WEE A;  5CS8 A;  5EVA A;  2YYR A;  5FBX A;  5FG5 A;  5F25 A;  3UVW A;  4N4F A;  4IOQ A;  1PUO A;  1Z6U A;  3FKM X;  5E9V A;  4Q0N A;  5IBN A;  2LSP B;  5LKX A;  5BT5 A;  2WP2 A;  4NYV A;  4GNE A;  5A5O A;  5FB0 A;  2XEU A;  4NR8 A;  2CON A;  5D3S A;  3O70 A;  3MHH A;  3MUL A;  4TS8 A;  1V87 A;  4PTB A;  2L75 A;  2D82 A;  1ZBD B;  4IC3 A;  5DX4 A;  2RNX A;  4N4I A;  4YYD A;  1X4I A;  4AYC A;  4GPJ A;  5D3T A;  5KH9 A;  4A9J A;  3C6W A;  5A82 A;  3SOU A;  3UVX A;  5AME A;  5KTU A;  2PUY A;  5D24 A;  5FER A;  5LUU A;  3ERR A;  4QSW A;  4CCG X;  2LGK A;  2G43 A;  4GNF A;  4AUQ B;  5KTW A;  3LDY A;  3RPG B;  5D1M B;  1F62 A;  4O70 A;  4CUS A;  4CUU A;  4QST A;  1T1H A;  5CUE A;  1EQF A;  2GRC A;  2R10 A;  4MSX A;  2VJE B;  4QSP A;  5FE6 A;  2BAY A;  4UP0 A;  4UIU A;  5HQ5 A;  2KKX A;  2M1R A;  3UV4 A;  2VJE A;  5HLS A;  4A9L A;  2EOD A;  4MEO A;  4QEV A;  4UIZ A;  5I7X A;  4CUR A;  3MDB C;  2D8U A;  2CSZ A;  3FL2 A;  5B78 A;  1WE9 A;  2JRJ A;  2F42 A;  4Z0O A;  2LQ6 A;  4LLB A;  3D1B A;  1WEP A;  2I50 A;  4I7D A;  4XY8 A;  3RTR B;  3LQJ A;  5CRM A;  2DSM A;  1MBM A;  4C66 A;  3NG2 A;  4R2Y A;  4TTE A;  5I88 A;  2QIC A;  3LVR E;  4TT4 A;  4ZDT A;  3FAO A;  5K3Q A;  4LKA A;  2E7N A;  2D8S A;  4WZ3 B;  2CSY A;  3DWD A;  4BW2 A;  2EGM A;  3L1Z B;  5FE3 A;  4L58 A;  2D9E A;  5JI8 A;  3MHS A;  3IU5 A;  2E61 A;  5FEY A;  4V3K C;  3U5J A;  4AVX A;  5L99 A;  3PLW A;  5C89 A;  4X2I A;  4MR6 A;  3P1F A;  2RSD A;  2YSM A;  5D3R A;  2YRE A;  4P5O B;  4QBM A;  4UYH A;  5KU3 A;  4FO9 A;  4OGI A;  5TCM A;  1IYM A;  2RFJ A;  4TU4 A;  5DKC A;  5LKU A;  1MM2 A;  5I89 A;  3U5L A;  1HYI A;  2NAA A;  3QZV A;  3HCS A;  5E9K A;  4A9M A;  4NQN A;  4MEQ A;  2DVR A;  4MEN A;  5CQ5 A;  4NR6 A;  5FB1 A;  5G4S A;  1WEU A;  3UW9 A;  1G25 A;  4QC3 A;  5A85 A;  4UIT A;  5CQ3 A;  2K1J A;  2RS9 B;  5FE5 A;  5D3P A;  4CL9 A;  2QJ0 A;  4A9F A;  2P57 A;  5J3X A;  5I7Y A;  4LAD B;  1N72 A;  5K29 A;  4N4G A;  5E3G A;  2MT5 A;  3M63 A;  2F6N A;  2IDA A;  5E3D A;  4TQN A;  4Y03 A;  2K17 A;  3DDT A;  4QF2 A;  4W4U A;  4ALH A;  4LYI A;  4O71 A;  3JVJ A;  2VPD A;  5C7N A;  5LJ1 A;  4AKH A;  2RO1 A;  1WUG A;  4ALG A;  1WUM A;  4YYH A;  5DYA A;  4FK5 A;  4PS5 A;  4QZS A;  4TU6 A;  4NR5 A;  5ENG A;  5EA1 A;  3JVL A;  5ENE A;  2KIZ A;  3DPL R;  5G0F A;  4DON A;  2H60 A;  5EWH A;  4UYD A;  3ONI A;  3FM8 C;  4J0R A;  2CRR A; 
#chains in the Genus database with same CATH homology
 5ENI A;  4NYX A;  5II1 A;  3G0L A;  3UV2 A;  3MB4 A;  4R7E A;  4WIV A;  4PCE A;  2QIZ A;  3ONI A;  5AIT A;  4TT2 A;  3UV5 A;  5TB6 A;  1X4J A;  2L84 A;  5CQ8 A;  4LDF A;  1RMD A;  1WEQ A;  2RNW A;  3MB3 A;  2KGI A;  3DAI A;  4A9I A;  2OUO A;  1VFY A;  2LV9 A;  4XYA A;  2OO1 A;  4QR4 A;  4F3I A;  3ZPV E;  3RPG C;  3SVG A;  4PPE A;  5EWD A;  2E6S A;  4O7E A;  5IGN A;  1WGM A;  4IOR A;  3UVD A;  4A9N A;  5DLX A;  3O35 A;  4YBT A;  2VPE A;  4AP4 A;  4LRG A;  4AKN A;  1JSP B;  2YEK A;  5CUG A;  5FH8 A;  5ENF A;  4YK0 A;  3QZS A;  3D7C A;  4NXJ A;  5CU8 A;  3O34 A;  5ENH A;  4YC9 A;  5DW2 A;  2YW5 A;  4MEP A;  4QSU A;  2L5U A;  2VPG A;  5KHM A;  4NUD A;  3DQV R;  2ECG A;  3MXF A;  2YEM A;  4QR3 A;  4WHU A;  4IC2 A;  4O64 A;  5HEL A;  5AD3 A;  1WEV A;  4HXN A;  4UIY A;  5FDZ A;  5DYU A;  2MD7 B;  3O7A A;  4C67 A;  2KGG A;  4YH3 A;  5D25 A;  1JM4 B;  4I7B A;  5LCW B;  3ZNI A;  5EM3 A;  2Y1N A;  5C11 A;  5CPE A;  3HCU A;  2YUR A;  5CRZ A;  4XI1 A;  4HBY A;  1E6I A;  5H1U A;  4O7C A;  1VYX A;  2MNY A;  2KWO A;  2YQL A;  4KCX A;  4Z93 A;  2Y1M A;  4QSX A;  4QSS A;  2L5E A;  5HM0 A;  5HRX A;  2MIQ A;  3C5K A;  4Z1Q A;  3SVF A;  2LRI C;  5IGL A;  2F6J A;  5C8G A;  1LDK C;  4CUQ A;  5FFW A;  3O36 A;  4C9Z A;  5F60 A;  5TBN A;  2PNX A;  5CQ7 A;  5HFQ A;  4BW3 A;  4YYN A;  2G6Q A;  3IHP A;  4YYI A;  2KWN A;  2DX8 A;  3HME A;  5FG6 A;  2NXB A;  5EQ1 A;  2CKL B;  4HXP A;  4WHW A;  5D7X A;  5DLZ A;  5EYA F;  3SHB A;  2Y43 A;  1CHC A;  4NR4 A;  4BW1 A;  5CUB A;  2CKL A;  5FH6 A;  5H1T A;  3JVM A;  4NUC A;  2MNZ A;  4LJN A;  4A9K A;  3N9M A;  4LYW A;  5DKA A;  3P1D A;  5HRV A;  5LVR A;  2H0D B;  4MR3 A;  2RI7 A;  2ECW A;  5BT3 A;  2LDR A;  5EWC A;  5CUD A;  5CZG A;  4I7C A;  5I29 A;  4QEW A;  5HJC A;  5DKH A;  5I3L A;  3O33 A;  4NR7 A;  4TZ2 A;  4UYE A;  5ETB A;  5HFR A;  4NRB A;  2M85 A;  3AAD A;  4LZR A;  4QR5 A;  4LC2 A;  5C13 A;  5A7C A;  2HYE D;  5EK9 A;  4LR6 A;  2YU4 A;  4YAD A;  4IR6 A;  4QSR A;  3Q2E A;  5JG6 A;  2DWW A;  5E9M A;  2VJF B;  4BHW A;  5HEM A;  3ASL A;  5L8T A;  3TLP A;  4FLP A;  5E9Y A;  1WES A;  1JOC A;  4RVR A;  5HQ6 A;  2RNY A;  5FH7 A;  5FE2 A;  4GB0 A;  3ZTG A;  5II2 A;  4FJC A;  4OUF A;  3O37 A;  3UVY A;  5B75 A;  4A9O A;  2K16 A;  4O7F A;  5D3N A;  1WEN A;  4QSV A;  4HBX A;  2YQM A;  5CFW A;  4V3L C;  5F62 A;  4QF3 A;  5DFB A;  4ZUX U;  5E74 A;  3K2J A;  5EGU A;  4BBQ A;  2YQD A;  4QSQ A;  5EPB A;  4YAB A;  2KR4 A;  4WZ0 A;  2KU3 A;  2VP7 A;  2YUC A;  5EIS A;  3U5N A;  4PKL A;  2AN6 A;  5IGK A;  2ZET C;  1DVP A;  4PY6 A;  5TDW A;  3U5P A;  2L43 A;  1FP0 A;  4TT6 A;  2C2V S;  5I86 A;  3T6R A;  4A4B A;  4YY4 A;  4XY9 A;  2MA5 A;  4S3O B;  4A9H A;  4YH4 A;  4UYF A;  4QNS A;  3KV5 A;  5DY7 A;  5F63 A;  4X3G A;  4HXL A;  4O72 A;  5F2P A;  5HRW A;  5DYC A;  5B76 A;  2E7O A;  5H1V A;  4O78 A;  1X4U A;  4O75 A;  5I80 A;  4CFL A;  4ZQL A;  4CUP A;  2YHN A;  4E96 A;  4A49 A;  2G4A A;  5EP7 A;  3MUK A;  2EA6 A;  3L11 A;  2ECI A;  2YT5 A;  4TZ8 A;  5A5P A;  3KQI A;  3N9N A;  3P1C A;  5KH3 A;  3HTK C;  5CQA A;  5IGM A;  1MM3 A;  4O74 A;  4WA6 A;  5FE1 A;  5G05 B;  4QYL A;  4HXO A;  5CQT A;  3N9P A;  5BT4 A;  3HMH A;  2DVS A;  5A83 A;  4Z6H A;  5DIN A;  2KWK A;  5KH7 A;  5CTL A;  5D26 A;  2UZG A;  4YY6 A;  3RCW A;  2ECN A;  1HYJ A;  2E3K A;  5A81 A;  1WEW A;  4HBV A;  1E4U A;  5FG4 A;  5LVQ A;  4N4H A;  2EGP A;  2FUU A;  5FE8 A;  2WP1 A;  5EPR A;  2LGV A;  3G0J A;  5CGP A;  5C85 A;  5J0D A;  4HXS A;  4QC1 A;  4LK9 A;  3ZVY A;  5D1L B;  1VD4 A;  5DFC A;  5B8D A;  2JMI A;  4YBM A;  2VPB A;  3GV4 A;  3HCT A;  4NRA A;  5D3H A;  5FFV A;  5ENJ A;  4IOO A;  5CUC A;  5FE9 A;  2LN0 A;  4KV4 A;  5FFY A;  5D1K B;  3ZVZ B;  5A5N A;  4HBW A;  4LYS A;  5E73 A;  5EIC A;  3SVH A;  3U5O A;  1XWH A;  3I2D A;  4XUA A;  4FIP A;  1U6G B;  3V43 A;  2R0S A;  1WEM A;  4AYC B;  3U5K A;  5LKZ A;  5D0C A;  4O7B A;  4Q0O A;  2MJV B;  5FE7 A;  2L85 A;  4TYL A;  5I40 A;  2LGL A;  5ACY A;  4GNG A;  2MA6 A;  2HDP A;  4Z1S A;  5D3J A;  1WIM A;  4NYW A;  5CUA A;  4QUU A;  3T7L A;  5L98 A;  5HEN A;  5DFD A;  5F61 A;  2FSA A;  5H85 A;  5JWM A;  3LRQ A;  3DWY A;  4YYG A;  5DW1 A;  2CT2 A;  3HMF A;  2JMD A;  5EI4 A;  5A5R A;  5DKD A;  2H0D A;  5H9M A;  4NR9 A;  5LJ2 A;  2YYN A;  3GL6 A;  3L1X A;  5AMF A;  3N9L A;  5EU1 A;  2YEL A;  4O76 A;  3NXB A;  4HXM A;  5IG6 A;  5E9L A;  4Z6I A;  3PHD A;  4CUT A;  3P1E A;  2KTB B;  5A5Q A;  4QYD A;  3KV6 A;  2YHO A;  3M99 A;  5L97 A;  4S3O C;  5IID A;  4YAX A;  4UYG A;  5AIU A;  5EWV A;  5ENB A;  5E9I A;  5COI A;  1FBV A;  2YSJ A;  2OSS A;  5F36 A;  4QEU A;  2KYU A;  4BW4 A;  4UIW A;  3P5O A;  3MQM A;  5ETD A;  1Z2Q A;  1Z60 A;  3GG3 A;  2OXQ C;  4QB3 A;  3ZYU A;  5KO4 A;  1WEO A;  2VJF A;  4IR5 A;  5CP5 A;  5LKT A;  4Q6F A;  2E6R A;  2KE1 A;  5D3L A;  4A0C D;  2VNF A;  3S92 A;  2LXH C;  5DYX A;  4YYK A;  4F52 B;  5CQ4 A;  4YYJ A;  5F1H A;  5HCL A;  5E0R A;  3SOX A;  5EPS A;  4L7X A;  1JM7 B;  3EB6 A;  5TDR A;  4QY4 A;  1X0J A;  2KRE A;  2KWJ A;  4UI9 B;  1JM7 A;  3LQI A;  4HXK A;  4IR4 A;  5DBM A;  5TRB A;  3N9Q A;  2ECT A;  4O7A A;  3S91 A;  2M6M A;  5EV9 A;  3SOW A;  4KV1 A;  3IU6 A;  1F68 A;  5F5Z A;  5F3A A;  2I7K A;  2C2L A;  3LJW A;  2ECV A;  2FUI A;  4XUB A;  5FE0 A;  3N9O A;  5CQ6 A;  2MD8 C;  4J1P A;  4MVT A;  4J0S A;  4N3W A;  2DVQ A;  4NRC A;  2R0V A;  5G04 B;  4A9E A;  5B77 A;  2M3H A;  4UP5 A;  3EB5 A;  2KFT A;  5TAB A;  3AQA A;  3LQH A;  2ECJ A;  2DAT A;  4ZW1 A;  5L96 A;  2I8N A;  2YDW A;  4QUT A;  4LZS A;  2L80 A;  2N9G A;  5I83 A;  4TKP B;  5AD2 A;  1K2F A;  1LDJ B;  5KTX A;  4YAT A;  2LXP C;  5L8U A;  2G45 A;  3JVK A;  5HQ7 A;  4YYM A;  4CA1 A;  2DVV A;  4UIX A;  4ZC9 A;  5ENC A;  3PUR A;  4PCI A;  3KNV A;  4NQM A;  4MR5 A;  4IR3 A;  2MUM A;  4J3I A;  5C4Q A;  2K4D A;  4YBS A;  4B86 C;  1ZS5 A;  3VK6 A;  3I3J A;  2L0B A;  3M62 A;  3ZYQ A;  1WFK A;  5C87 A;  5CY9 A;  5B79 A;  2R0Y A;  4MR4 A;  2YW8 A;  4LZ2 A;  5F1L A;  1N87 A;  4A4C A;  5LJ0 A;  5FE4 A;  3PUQ A;  4CFK A;  2JMJ A;  4UIV A;  5A5S A;  4NN2 A;  5E7D A;  3U5M A;  2XB1 A;  1WIL A;  2DKW A;  4O77 A;  4GND A;  4CLB A;  5I1Q A;  3QZT A;  5G4R A;  4OGJ A;  2LGG A;  4NS5 A;  4NUE A;  4B7Y C;  3LXJ A;  3Q2F A;  3ZPV 1;  4WZ2 A;  5EWW A;  1BOR A;  4R8P K;  4BJX A;  4HXR A;  1WEE A;  5CS8 A;  5EVA A;  2YYR A;  5FBX A;  5FG5 A;  5F25 A;  3UVW A;  4N4F A;  4IOQ A;  1Z6U A;  3FKM X;  5E9V A;  4Q0N A;  5IBN A;  2LSP B;  5LKX A;  5BT5 A;  2WP2 A;  4NYV A;  4GNE A;  5A5O A;  5FB0 A;  2XEU A;  4NR8 A;  5D3S A;  3O70 A;  3MHH A;  3MUL A;  4TS8 A;  1V87 A;  4PTB A;  2L75 A;  2D82 A;  1ZBD B;  4IC3 A;  5DX4 A;  2RNX A;  4N4I A;  4YYD A;  1X4I A;  4AYC A;  4GPJ A;  5D3T A;  5KH9 A;  4A9J A;  3C6W A;  5A82 A;  3SOU A;  3UVX A;  5AME A;  5KTU A;  2PUY A;  5D24 A;  5FER A;  5LUU A;  4QSW A;  4CCG X;  2LGK A;  2G43 A;  4GNF A;  4AUQ B;  5KTW A;  3RPG B;  5D1M B;  1F62 A;  4O70 A;  4CUS A;  4CUU A;  4QST A;  1T1H A;  5CUE A;  1EQF A;  2GRC A;  2R10 A;  4MSX A;  2VJE B;  4QSP A;  5FE6 A;  2BAY A;  4UP0 A;  4UIU A;  5HQ5 A;  2M1R A;  3UV4 A;  2VJE A;  5HLS A;  4A9L A;  2EOD A;  4MEO A;  4QEV A;  4UIZ A;  5I7X A;  4CUR A;  2CSZ A;  3FL2 A;  5B78 A;  1WE9 A;  2JRJ A;  2F42 A;  2LQ6 A;  4LLB A;  1WEP A;  2I50 A;  4I7D A;  4XY8 A;  3RTR B;  3LQJ A;  5CRM A;  4C66 A;  3NG2 A;  4R2Y A;  4TTE A;  5I88 A;  2QIC A;  4ZDT A;  4TT4 A;  4LKA A;  2E7N A;  2D8S A;  4WZ3 B;  2CSY A;  4BW2 A;  3L1Z B;  5FE3 A;  4L58 A;  2D9E A;  5JI8 A;  3MHS A;  3IU5 A;  5FEY A;  4V3K C;  3U5J A;  4AVX A;  5L99 A;  5C89 A;  4X2I A;  4MR6 A;  3P1F A;  2RSD A;  2YSM A;  5D3R A;  2YRE A;  4P5O B;  4QBM A;  4UYH A;  5KU3 A;  4FO9 A;  4OGI A;  5TCM A;  1IYM A;  2RFJ A;  4TU4 A;  5DKC A;  5LKU A;  1MM2 A;  5I89 A;  3U5L A;  1HYI A;  2NAA A;  3QZV A;  3HCS A;  5E9K A;  4A9M A;  4NQN A;  4MEQ A;  2DVR A;  4MEN A;  5CQ5 A;  4NR6 A;  5FB1 A;  5G4S A;  1WEU A;  3UW9 A;  1G25 A;  4QC3 A;  5A85 A;  4UIT A;  5CQ3 A;  2K1J A;  2RS9 B;  5FE5 A;  5D3P A;  4CL9 A;  2QJ0 A;  4A9F A;  5J3X A;  5I7Y A;  4LAD B;  1N72 A;  5K29 A;  4N4G A;  5E3G A;  2MT5 A;  3M63 A;  2F6N A;  2IDA A;  5E3D A;  4TQN A;  4Y03 A;  2K17 A;  4QF2 A;  4W4U A;  4ALH A;  4LYI A;  4O71 A;  3JVJ A;  2VPD A;  5C7N A;  5LJ1 A;  2RO1 A;  1WUG A;  4ALG A;  1WUM A;  4YYH A;  5DYA A;  4FK5 A;  4PS5 A;  4QZS A;  4TU6 A;  4NR5 A;  5ENG A;  5EA1 A;  3JVL A;  5ENE A;  2KIZ A;  3DPL R;  5G0F A;  4DON A;  2H60 A;  5EWH A;  4UYD A;  4UYF B;  4J0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...