5H1UA

Complex structure of trim24 phd-bromodomain and inhibitor 2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
180
structure length
174
Chain Sequence
DWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 51
structure length 174
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1uA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1uA01
4A9IA 2HDPA 2L80A 5DW2A 4QYLA 4I7DA 2YQLA 5EVAA 2ECNA 5LVRA 4FLPA 1Z60A 5AITA 2YEKA 5FH8A 2QJ0A 4X3GA 4C9ZA 4A9NA 5D24A 2LRIC 3JVMA 2L43A 2MA5A 4UP5A 4UYFA 2E6RA 4QC1A 2KGGA 4LRGA 4TTEA 4YYGA 2YHNA 4PCIA 4V3KC 5DKDA 2MNZA 4A49A 3U5OA 3UV2A 3I2DA 5HQ5A 3MULA 5EPBA 2CSYA 5A5SA 4C67A 5EYAF 3ZPVE 3MB4A 3T6RA 5FFYA 5CZGA 5CUCA 5TRBA 4O7AA 5L8UA 1WEQA 3O35A 4YBTA 4J3IA 4YYNA 3JVLA 5E9YA 3LQJA 4A9EA 5CUGA 5CTLA 4GNFA 2LGGA 4NQNA 5EWDA 2PNXA 3M99A 4BBQA 3O70A 1V87A 2I8NA 3U5LA 4BW4A 3LQIA 2QIZA 1LDKC 2RNXA 5B77A 2MT5A 2YUCA 3L1XA 1RMDA 5H9MA 5I29A 3SVFA 1WENA 3ASLA 4PPEA 1K2FA 5KHMA 4QR5A 3V43A 2ECJA 4NUEA 4QBMA 5CQ4A 1MM3A 2RSDA 4CCGX 5CS8A 1WESA 5F1HA 4CFLA 4A9HA 5ENFA 2KR4A 3L1ZB 3ZPV1 1MM2A 5TABA 2XEUA 3MHSA 2RI7A 3G0LA 5EPSA 3P1FA 2KWJA 2M3HA 3PURA 5FE8A 4LK9A 5FERA 1X4UA 5HRVA 4IR3A 4O64A 2H60A 4AYCB 2VJFA 2DVQA 1CHCA 4LYWA 4NUDA 3SHBA 2LGVA 4MSXA 1Z2QA 4XUBA 1WEEA 5LJ0A 5A5QA 4IOOA 5FE9A 4CURA 2WP2A 3LQHA 5E7DA 5FH7A 4E96A 4CLBA 5B75A 5KH3A 5H1UA 5EM3A 4QSUA 5D3SA 4MR6A 4GNGA 5F36A 2MJVB 5E9VA 2YQMA 2LQ6A 2Y43A 4J1PA 4LYSA 4LKAA 4QR3A 5EP7A 4IC2A 2YU4A 4AVXA 4O7FA 4TYLA 5B8DA 4ALGA 3HCSA 4FIPA 5A85A 5G4RA 5AMFA 2DX8A 2R10A 2OO1A 3NXBA 2OSSA 5TDRA 4A9FA 4AUQB 5CFWA 5HQ7A 1XWHA 4HXOA 5BT3A 4GNDA 3SOXA 5FE0A 3GG3A 3HCUA 5HLSA 5DKAA 5C85A 5DW1A 3C5KA 3N9OA 2KWKA 4Z93A 4MENA 1X4IA 4QSSA 5HFQA 5A5NA 4LZ2A 5C13A 4UIXA 5CP5A 4HXMA 4O78A 2CSZA 5FB0A 4IR6A 3ZTGA 5I7YA 5L8TA 1IYMA 4UIYA 5B78A 5CQTA 4CUUA 5HENA 2YSJA 5EA1A 3SVGA 4Q0OA 5I83A 5I40A 4O70A 5EQ1A 2KWOA 2DVSA 2L0BA 5EWVA 4GB0A 2M85A 3N9NA 3M62A 4WHUA 4O75A 3UVWA 4A4CA 3Q2EA 5HJCA 4O7BA 4MR5A 4UIZA 5ENBA 5L97A 4HBWA 5DX4A 2PUYA 4XI1A 2L5UA 2ECTA 4NRCA 4MEOA 3UV5A 2DATA 3MB3A 3HTKC 4IR4A 4MR4A 4TU4A 3Q2FA 5DYAA 2ECWA 5TBNA 5C11A 3P1DA 2G4AA 2YT5A 4L58A 5F62A 5LKTA 5II1A 5CRMA 4HXRA 5LKZA 1WIMA 4WHWA 2F6JA 4GNEA 4HBXA 4YYHA 5KH9A 3UVDA 3ONIA 3T7LA 4NXJA 5F61A 1Z6UA 1WUMA 5EISA 5I80A 4QEWA 1WEOA 5F60A 3AADA 3ZVZB 3AQAA 3S92A 4UIUA 4XY9A 5D3PA 3NG2A 5ENEA 1WFKA 4NR4A 2VP7A 5CUBA 4UI9B 2L84A 4YABA 2MA6A 2YW5A 4RVRA 5ENIA 2LGLA 1E6IA 5I89A 2ZETC 3QZVA 2VPGA 5D0CA 3O36A 3EB6A 5L96A 4A9JA 4FJCA 3U5JA 2KTBB 1HYIA 1EQFA 4UYDA 5BT5A 2D8SA 5H1VA 4N4FA 4Z6HA 2KWNA 3M63A 1WE9A 2KFTA 2YYRA 4NR6A 1VD4A 5IGLA 4A0CD 3DPLR 5COIA 4NYWA 4PY6A 2JMJA 3VK6A 5D1KB 2Y1NA 2K17A 3GL6A 3RPGB 2CT2A 1WGMA 5HELA 2MUMA 2E7OA 4TZ8A 2VJEB 4B86C 1DVPA 3KQIA 2CKLB 2M1RA 3P1CA 4ZDTA 2BAYA 3U5NA 2EODA 2KU3A 3N9LA 2K4DA 4F52B 5TDWA 3LRQA 4LZSA 3KV5A 3TLPA 5I3LA 4LLBA 5C8GA 5CQ6A 5DLZA 4J0SA 5EV9A 4CUPA 2XB1A 5F5ZA 2YDWA 5IG6A 4YBSA 3UVXA 5CUAA 4OGIA 3HMHA 4F3IA 1WUGA 5C89A 4NR9A 2LXPC 1FP0A 4TT2A 5DYUA 5KTXA 4NYXA 4QSPA 5AD3A 5CUEA 5CQ5A 5CQ7A 5DYCA 4MEQA 4S3OC 3KV6A 5ACYA 3UW9A 5FE1A 1JM7B 5EI4A 2WP1A 4YYJA 2G45A 2YHOA 2R0VA 2AN6A 4HXSA 5FG4A 5DKHA 5LVQA 5D3LA 2MIQA 2DVVA 5G04B 4AYCA 2I50A 5KH7A 2QICA 4YATA 2YSMA 1G25A 4TT4A 1JM7A 5HFRA 4OUFA 5DLXA 2YURA 4DONA 5I7XA 5ETBA 2KREA 3P5OA 4A9MA 2E7NA 4N4GA 5D3NA 4NN2A 5FE6A 5D7XA 2L85A 3JVJA 4ZC9A 3P1EA 4N4HA 3LXJA 4YY6A 4NS5A 5E3DA 4BW1A 5ENCA 5HQ6A 2MNYA 4I7BA 4LZRA 2ECGA 5DBMA 2RO1A 5KO4A 4NR5A 4QEUA 5JI8A 1WILA 5FG6A 4N3WA 3S91A 5KTUA 2L5EA 4X2IA 5EICA 4QR4A 2F42A 5C4QA 2LV9A 3D7CA 4TS8A 4MVTA 4S3OB 4WZ0A 4YAXA 3SOWA 5E9LA 5DINA 2RS9B 4R8PK 5A5RA 1HYJA 3N9QA 1N72A 1U6GB 4P5OB 4YK0A 2UZGA 5A82A 2GRCA 4QSVA 4Q0NA 2FUIA 4ALHA 4QB3A 1F62A 5BT4A 3RPGC 3UVYA 2ECIA 1LDJB 3PUQA 2E3KA 1F68A 3QZTA 3PHDA 5IGNA 2D9EA 5D26A 3MHHA 5CU8A 1WEVA 3KNVA 3ZYQA 1JM4B 4QSTA 2IDAA 4UIVA 4YYIA 4LADB 1FBVA 5D3HA 2ECVA 2KGIA 4L7XA 4NRBA 4CUQA 1T1HA 4HXNA 2VPEA 5D1LB 4NR8A 1X0JA 3GV4A 4QSQA 2LDRA 2MD7B 4NUCA 4CFKA 5F1LA 2EA6A 2HYED 5G05B 5JG6A 3U5KA 1JSPB 5KU3A 4NRAA 4QF2A 3G0JA 2JMDA 5FE2A 5B79A 3HMFA 2RNYA 5DKCA 5EU1A 5A7CA 5D1MB 5ENJA 5HCLA 2DWWA 2Y1MA 3MXFA 3SOUA 5E9MA 5LJ1A 3DAIA 3EB5A 5E74A 5HRXA 4QUTA 5EK9A 4FO9A 4UITA 4UYFB 3JVKA 5ENHA 5FB1A 5EWCA 3O7AA 4W4UA 4CA1A 4O72A 4TQNA 4WIVA 3U5PA 4YH4A 5FDZA 5I1QA 5FE7A 3O34A 4HBYA 4QNSA 5J0DA 2KE1A 2KIZA 4BW2A 2VPDA 4A9LA 3ZNIA 4ZW1A 4LC2A 3ZVYA 1WEWA 4XUAA 3K2JA 5CY9A 5C87A 5L99A 4HXKA 5LKUA 4LR6A 4O76A 5IGMA 4XYAA 4QEVA 3DWYA 5K29A 4R2YA 4TU6A 4QF3A 5DFCA 5F2PA 4QSXA 5CQ8A 2VPBA 4PKLA 5DYXA 4YH3A 4IR5A 4NQMA 5LJ2A 5G0FA 4YYMA 5LUUA 2NXBA 5I86A 3N9MA 1ZBDB 2R0SA 2YELA 3IHPA 4C66A 2OUOA 2R0YA 2OXQC 2YQDA 4GPJA 4Z6IA 2VJEA 4WZ2A 1BORA 2NAAA 5FEYA 2VNFA 2K1JA 5CRZA 5B76A 5JWMA 2LGKA 2CKLA 5II2A 4B7YC 2G6QA 1ZS5A 4QC3A 1E4UA 4NR7A 5E9KA 2K16A 5H1TA 4A9OA 2RNWA 5FFVA 5IBNA 2D82A 4YYDA 2C2LA 4Z1QA 4WZ3B 3O37A 5CPEA 5J3XA 4HXPA 5CQ3A 5DY7A 5H85A 5AD2A 2VJFB 5D25A 2DKWA 3LJWA 5E73A 5FFWA 5D3RA 2LXHC 3UV4A 4UYHA 2N9GA 5TCMA 3SVHA 4I7CA 5D3TA 4UYGA 2FUUA 4TKPB 4QYDA 5DFDA 4O71A 4YADA 5A81A 4YBMA 2DVRA 4UIWA 1VYXA 4R7EA 5IGKA 1N87A 4IORA 4LJNA 4Y03A 2EGPA 5AIUA 5A5OA 3FL2A 4PS5A 5IIDA 1X4JA 4QSWA 4N4IA 5A83A 5EGUA 5FG5A 5F63A 5LCWB 4QSRA 2YYNA 2LN0A 4ZUXU 4QZSA 2JMIA 4KV4A 5DFBA 4CUSA 3HMEA 4LDFA 2C2VS 5HRWA 4ZQLA 3MUKA 2YREA 2H0DB 3C6WA 5TB6A 4WA6A 2FSAA 4YYKA 4NYVA 2JRJA 4J0RA 3I3JA 3RCWA 3FKMX 5E3GA 4V3LC 4KV1A 4IC3A 1WEUA 4YY4A 5L98A 5F3AA 5FBXA 2RFJA 5E9IA 5CQAA 5EWHA 4Q6FA 3ZYUA 3QZSA 2H0DA 4AP4A 4IOQA 5G4SA 5KTWA 3HCTA 3N9PA 4QUUA 4TZ2A 4CUTA 5FE3A 4UYEA 5FH6A 4XY8A 4BHWA 1JOCA 4HXLA 4A9KA 2YW8A 4Z1SA 2F6NA 3RTRB 5A5PA 1WEMA 4O77A 2I7KA 5EPRA 4O7CA 5C7NA 3DQVR 4A4BA 2M6MA 2YEMA 4FK5A 5EWWA 2KYUA 4MEPA 4O74A 4OGJA 3L11A 5AMEA 4UP0A 4KCXA 5ENGA 5FE4A 4YC9A 5I88A 3MQMA 4AKNA 5HM0A 4LYIA 4PCEA 4MR3A 2E6SA 5FE5A 4HBVA 5CGPA 1VFYA 5D3JA 3IU5A 4O7EA 5CUDA 4CL9A 4PTBA 2G43A 4BJXA 4BW3A 5F25A 5HEMA 2LSPB 2L75A 5ETDA 5E0RA 1WEPA 4QY4A 4TT6A 3U5MA 3O33A 2MD8C 5LKXA 3IU6A
chains in the Genus database with same CATH superfamily
4A9IA 2HDPA 2L80A 5DW2A 4QYLA 2EGMA 4I7DA 2YQLA 5EVAA 2ECNA 3SUBA 5LVRA 4FLPA 1Z60A 3MDBC 5AITA 3LJUX 2YEKA 5FH8A 2QJ0A 4X3GA 4C9ZA 4A9NA 5D24A 2LRIC 3JVMA 2L43A 2MA5A 4UP5A 2FD4A 4UYFA 4AKHA 2E6RA 4QC1A 2KGGA 3D1BA 4LRGA 4TTEA 4YYGA 2YHNA 4PCIA 4V3KC 5DKDA 2MNZA 4A49A 3U5OA 3UV2A 3I2DA 5HQ5A 3MULA 5EPBA 2CSYA 1ZKRA 4C67A 5A5SA 5EYAF 3ZPVE 2D8UA 3MB4A 3T6RA 5FFYA 5CZGA 5CUCA 5TRBA 4O7AA 5L8UA 1WEQA 3O35A 4YBTA 4J3IA 4YYNA 3JVLA 5E9YA 3LQJA 4A9EA 5CUGA 5CTLA 4GNFA 2LGGA 4NQNA 5EWDA 2PNXA 3M99A 4BBQA 3O70A 1V87A 2I8NA 3U5LA 4BW4A 3LQIA 2QIZA 1LDKC 2RNXA 5B77A 3FJUB 2MT5A 2YUCA 3L1XA 1RMDA 5H9MA 5I29A 3SVFA 1WENA 3ASLA 4PPEA 1K2FA 5KHMA 3FAOA 4QR5A 3VKGA 2ECJA 4NUEA 4QBMA 5CQ4A 1MM3A 2RSDA 3V43A 3FM8C 4CCGX 5CS8A 1WESA 5F1HA 4CFLA 4A9HA 5ENFA 2KR4A 3L1ZB 3ZPV1 1MM2A 5TABA 2XEUA 3MHSA 2RI7A 3G0LA 5EPSA 3P1FA 2KWJA 2M3HA 3PURA 5FE8A 4LK9A 5FERA 1X4UA 5HRVA 4IR3A 4O64A 2H60A 4AYCB 2VJFA 2DVQA 1CHCA 4LYWA 4NUDA 3SHBA 2LGVA 4MSXA 1Z2QA 4XUBA 1WEEA 5LJ0A 5A5QA 4IOOA 5FE9A 2KKXA 4CURA 2WP2A 3LQHA 5E7DA 5FH7A 4E96A 2CSVA 4CLBA 5B75A 5KH3A 5SVXA 5H1UA 5EM3A 4QSUA 5D3SA 4MR6A 4GNGA 5F36A 2MJVB 5E9VA 2YQMA 2LQ6A 2Y43A 4J1PA 4LYSA 4LKAA 4QR3A 5EP7A 4IC2A 2XOZA 2YU4A 4O7FA 4AVXA 4TYLA 5B8DA 4ALGA 3HCSA 4FIPA 5A85A 5G4RA 5AMFA 2DX8A 2R10A 2OO1A 2XP0A 3NXBA 2OSSA 5TDRA 4A9FA 4AUQB 5CFWA 5HQ7A 1XWHA 4HXOA 5SVIB 5BT3A 4GNDA 3SOXA 5FE0A 5K3QA 3GG3A 3D1DA 3HCUA 5HLSA 5DKAA 5C85A 3M7KA 5DW1A 3C5KA 2LAUA 3N9OA 2KWKA 2P57A 4Z93A 4MENA 1X4IA 4QSSA 5HFQA 5A5NA 4LZ2A 5C13A 4UIXA 5CP5A 4HXMA 4O78A 2CSZA 5FB0A 4IR6A 3ZTGA 5I7YA 5L8TA 1IYMA 4UIYA 5B78A 5CQTA 4CUUA 5HENA 2YSJA 5EA1A 3SVGA 4Q0OA 5I83A 5I40A 4O70A 5EQ1A 2KWOA 2DVSA 2L0BA 5EWVA 4GB0A 2M85A 3N9NA 3M62A 4WHUA 4O75A 3UVWA 4A4CA 3Q2EA 5HJCA 4O7BA 4MR5A 4UIZA 5ENBA 5L97A 4HBWA 5DX4A 2PUYA 4XI1A 2L5UA 2ECTA 4NRCA 4MEOA 3UV5A 2DATA 3MB3A 3HTKC 4IR4A 4MR4A 4TU4A 3Q2FA 5DYAA 2ECWA 5TBNA 5SVYA 5C11A 3P1DA 2G4AA 2YT5A 4L58A 5F62A 5LKTA 5II1A 5CRMA 2YVRA 4HXRA 5LKZA 1WIMA 4WHWA 2F6JA 4GNEA 4HBXA 4YYHA 5KH9A 3UVDA 1MBMA 3ONIA 3T7LA 4NXJA 5F61A 1Z6UA 1WUMA 5EISA 2XOYA 5I80A 4QEWA 1WEOA 5F60A 3AADA 3ZVZB 3AQAA 3S92A 4Z0OA 4UIUA 4XY9A 5D3PA 3NG2A 5ENEA 1WFKA 4NR4A 2VP7A 5CUBA 4UI9B 2L84A 4YABA 2MA6A 3DWDA 2YW5A 4RVRA 5ENIA 2LGLA 1E6IA 5I89A 2ZETC 3QZVA 2VPGA 5D0CA 3O36A 3EB6A 5L96A 4A9JA 2CRWA 3U5JA 2L7PA 4FJCA 2KTBB 1HYIA 1EQFA 4UYDA 5BT5A 2D8SA 5H1VA 4N4FA 4Z6HA 2KWNA 3M63A 1WE9A 2KFTA 2YYRA 4NR6A 1VD4A 5IGLA 4A0CD 3DPLR 5COIA 4NYWA 3DDTA 4PY6A 2JMJA 3VK6A 5D1KB 2Y1NA 3JUEA 2K17A 3GL6A 3RPGB 2CT2A 1WGMA 5HELA 2MUMA 2E7OA 4TZ8A 2VJEB 4B86C 1DVPA 3KQIA 2CKLB 2M1RA 3P1CA 4ZDTA 2BAYA 3U5NA 2EODA 2KU3A 3N9LA 2K4DA 4F52B 5TDWA 3LRQA 2EJNA 4LZSA 3KV5A 3TLPA 5I3LA 4LLBA 5C8GA 5CQ6A 5DLZA 4J0SA 5EV9A 4CUPA 2XB1A 5F5ZA 2YDWA 5IG6A 4YBSA 3UVXA 5CUAA 4OGIA 3HMHA 4F3IA 1WUGA 5C89A 4NR9A 2LXPC 1FP0A 4TT2A 5DYUA 5KTXA 4NYXA 4QSPA 5AD3A 2CRRA 5CUEA 5CQ5A 5CQ7A 5DYCA 4MEQA 2MKEA 4S3OC 3KV6A 5ACYA 3UW9A 5FE1A 1JM7B 5EI4A 2WP1A 4YYJA 2G45A 2YHOA 4AKGA 2R0VA 2AN6A 4HXSA 5FG4A 5DKHA 5LVQA 5D3LA 2MIQA 2DVVA 5G04B 4AYCA 2I50A 5KH7A 2QICA 4YATA 2YSMA 1G25A 4TT4A 1JM7A 5HFRA 4OUFA 5DLXA 2YURA 4DONA 5I7XA 2RR4A 5ETBA 2KREA 3P5OA 4A9MA 2E7NA 4N4GA 5D3NA 4NN2A 5FE6A 5D7XA 2L85A 3JVJA 3ERRA 3P1EA 4ZC9A 4N4HA 3LXJA 4YY6A 4NS5A 5E3DA 4BW1A 4O62A 5ENCA 5HQ6A 4F1PA 2MNYA 4I7BA 4LZRA 2ECGA 5DBMA 2RO1A 5KO4A 4NR5A 4OGEA 5SVIA 4QEUA 5JI8A 1WILA 5FG6A 4N3WA 3S91A 4OGCA 2CONA 5KTUA 2L5EA 4X2IA 5EICA 4QR4A 2F42A 5C4QA 2LV9A 3D7CA 4TS8A 4MVTA 4S3OB 4WZ0A 4YAXA 3SOWA 5E9LA 5DINA 2RS9B 4R8PK 5A5RA 3LDYA 3N9QA 1HYJA 1N72A 1U6GB 4P5OB 4YK0A 2UZGA 5A82A 2GRCA 4QSVA 4Q0NA 2KKYA 2FUIA 4ALHA 4QB3A 1F62A 5BT4A 3RPGC 3UVYA 2ECIA 1LDJB 3PUQA 2E3KA 1F68A 3QZTA 3PHDA 5IGNA 2D9EA 5D26A 3MHHA 5CU8A 1WEVA 4AKIA 3KNVA 3T9KA 1JM4B 3ZYQA 4QSTA 4H9DA 2IDAA 4UIVA 4YYIA 4LADB 1FBVA 5D3HA 2ECVA 2KGIA 3FEHA 4L7XA 4NRBA 4CUQA 1T1HA 4HXNA 2VPEA 5D1LB 2OWAA 1PUOA 4NR8A 1X0JA 3GV4A 4QSQA 2LDRA 2MD7B 4NUCA 4CFKA 5F1LA 2EA6A 2HYED 5G05B 5JG6A 3U5KA 1JSPB 5KU3A 4NRAA 4QF2A 3G0JA 2JMDA 5FE2A 5B79A 3HMFA 2RNYA 5DKCA 5EU1A 5A7CA 5D1MB 5ENJA 5HCLA 2DWWA 2Y1MA 3MXFA 3SOUA 5E9MA 5LJ1A 3DAIA 3EB5A 5E74A 5HRXA 4QUTA 5EK9A 4FO9A 4UITA 4UYFB 3JVKA 5ENHA 5FB1A 5EWCA 3O7AA 4W4UA 4CA1A 4O72A 4TQNA 4WIVA 3U5PA 4YH4A 5FDZA 5I1QA 5FE7A 3O34A 4HBYA 4QNSA 5J0DA 2KE1A 2KIZA 4BW2A 2VPDA 4A9LA 3ZNIA 4ZW1A 4LC2A 3ZVYA 1WEWA 4XUAA 3K2JA 5CY9A 5C87A 5L99A 4HXKA 5LKUA 3H7HA 4LR6A 4O76A 5IGMA 4XYAA 2M13A 4QEVA 3DWYA 2JUNA 5K29A 4R2YA 4TU6A 4QF3A 5DFCA 5F2PA 4QSXA 5CQ8A 2VPBA 4PKLA 5DYXA 4YH3A 4IR5A 4NQMA 5LJ2A 5G0FA 3O47A 4YYMA 5LUUA 2FFWA 2NXBA 5I86A 3N9MA 1ZBDB 2R0SA 2YELA 3IHPA 4C66A 2OUOA 2R0YA 2OXQC 3LVRE 2YQDA 4GPJA 4Z6IA 2VJEA 4WZ2A 1BORA 2NAAA 5FEYA 2VNFA 2K1JA 5CRZA 5B76A 5JWMA 2LGKA 2CKLA 5II2A 4B7YC 2G6QA 4QC3A 1ZS5A 1E4UA 4NR7A 5E9KA 2K16A 5H1TA 4A9OA 2RNWA 5FFVA 5IBNA 2D82A 4YYDA 2DJAA 2C2LA 4Z1QA 4WZ3B 3O37A 5CPEA 5J3XA 4HXPA 5CQ3A 5DY7A 5H85A 5AD2A 2VJFB 5D25A 2DKWA 3LJWA 2EXUA 5E73A 5FFWA 5D3RA 2LXHC 3UV4A 4UYHA 2N9GA 5TCMA 3LVQE 3SVHA 4I7CA 5D3TA 4UYGA 2FUUA 4TKPB 4QYDA 5DFDA 4O71A 4YADA 5A81A 4YBMA 2DVRA 4QQ4A 2IQJA 4UIWA 1VYXA 4R7EA 5IGKA 1N87A 4IORA 4LJNA 4Y03A 2EGPA 5AIUA 5A5OA 3FL2A 4PS5A 5IIDA 1X4JA 4QSWA 4N4IA 5A83A 2E61A 3VKHA 5EGUA 5FG5A 5F63A 5LCWB 4QSRA 2YYNA 2LN0A 4ZUXU 4QZSA 2JMIA 4KV4A 5DFBA 4CUSA 3HMEA 4LDFA 2C2VS 5HRWA 4ZQLA 3MUKA 2YREA 2H0DB 3C6WA 5TB6A 4WA6A 2FSAA 4YYKA 4NYVA 2JRJA 4J0RA 3I3JA 3RCWA 3FKMX 5E3GA 4V3LC 4KV1A 4IC3A 1WEUA 4YY4A 5L98A 5F3AA 5FBXA 2RFJA 5E9IA 2B0OE 5CQAA 5EWHA 4Q6FA 3ZYUA 3QZSA 2H0DA 4AP4A 4IOQA 5G4SA 5KTWA 3E2DA 3HCTA 3N9PA 4QUUA 4TZ2A 4CUTA 5FE3A 4UYEA 5FH6A 4XY8A 4BHWA 1JOCA 4HXLA 4A9KA 2YW8A 4Z1SA 2F6NA 4AI6A 3RTRB 5A5PA 1WEMA 3PLWA 4O77A 2I7KA 5EPRA 4O7CA 5C7NA 3DQVR 4A4BA 2M6MA 2YEMA 3Q1DA 4FK5A 5EWWA 2JM3A 2KYUA 4MEPA 4O74A 4OGJA 3FANA 5AMEA 3L11A 4KCXA 5ENGA 5FE4A 4UP0A 4YC9A 5I88A 3MQMA 4AKNA 5HM0A 4LYIA 4PCEA 4MR3A 4Z0RA 2E6SA 5FE5A 4HBVA 5CGPA 1VFYA 5D3JA 3IU5A 4O7EA 5CUDA 4CL9A 4PTBA 2DSMA 2G43A 4BJXA 4BW3A 5F25A 5HEMA 2LSPB 2L75A 3KDEC 5ETDA 1DCQA 5E0RA 1WEPA 4QY4A 4TT6A 3U5MA 3O33A 2XOCA 2MD8C 5LKXA 3IU6A
chains in the Genus database with same CATH topology
4A9IA 2HDPA 2L80A 5DW2A 4QYLA 4I7DA 2YQLA 5EVAA 2ECNA 5LVRA 4FLPA 1Z60A 5AITA 2YEKA 5FH8A 2QJ0A 4X3GA 4C9ZA 4A9NA 5D24A 2LRIC 3JVMA 2L43A 2MA5A 4UP5A 4UYFA 2E6RA 4QC1A 2KGGA 4LRGA 4TTEA 4YYGA 2YHNA 4PCIA 4V3KC 5DKDA 2MNZA 4A49A 3U5OA 3UV2A 3I2DA 5HQ5A 3MULA 5EPBA 2CSYA 5A5SA 4C67A 5EYAF 3ZPVE 3MB4A 3T6RA 5FFYA 5CZGA 5CUCA 5TRBA 4O7AA 5L8UA 1WEQA 3O35A 4YBTA 4J3IA 4YYNA 3JVLA 5E9YA 3LQJA 4A9EA 5CUGA 5CTLA 4GNFA 2LGGA 4NQNA 5EWDA 2PNXA 3M99A 4BBQA 3O70A 1V87A 2I8NA 3U5LA 4BW4A 3LQIA 2QIZA 1LDKC 2RNXA 5B77A 2MT5A 2YUCA 3L1XA 1RMDA 5H9MA 5I29A 3SVFA 1WENA 3ASLA 4PPEA 1K2FA 5KHMA 4QR5A 3V43A 2ECJA 4NUEA 4QBMA 5CQ4A 1MM3A 2RSDA 4CCGX 5CS8A 1WESA 5F1HA 4CFLA 4A9HA 5ENFA 2KR4A 3L1ZB 3ZPV1 1MM2A 5TABA 2XEUA 3MHSA 2RI7A 3G0LA 5EPSA 3P1FA 2KWJA 2M3HA 3PURA 5FE8A 4LK9A 5FERA 1X4UA 5HRVA 4IR3A 4O64A 2H60A 4AYCB 2VJFA 2DVQA 1CHCA 4LYWA 4NUDA 3SHBA 2LGVA 4MSXA 1Z2QA 4XUBA 1WEEA 5LJ0A 5A5QA 4IOOA 5FE9A 4CURA 2WP2A 3LQHA 5E7DA 5FH7A 4E96A 4CLBA 5B75A 5KH3A 5H1UA 5EM3A 4QSUA 5D3SA 4MR6A 4GNGA 5F36A 2MJVB 5E9VA 2YQMA 2LQ6A 2Y43A 4J1PA 4LYSA 4LKAA 4QR3A 5EP7A 4IC2A 2YU4A 4AVXA 4O7FA 4TYLA 5B8DA 4ALGA 3HCSA 4FIPA 5A85A 5G4RA 5AMFA 2DX8A 2R10A 2OO1A 3NXBA 2OSSA 5TDRA 4A9FA 4AUQB 5CFWA 5HQ7A 1XWHA 4HXOA 5BT3A 4GNDA 3SOXA 5FE0A 3GG3A 3HCUA 5HLSA 5DKAA 5C85A 5DW1A 3C5KA 3N9OA 2KWKA 4Z93A 4MENA 1X4IA 4QSSA 5HFQA 5A5NA 4LZ2A 5C13A 4UIXA 5CP5A 4HXMA 4O78A 2CSZA 5FB0A 4IR6A 3ZTGA 5I7YA 5L8TA 1IYMA 4UIYA 5B78A 5CQTA 4CUUA 5HENA 2YSJA 5EA1A 3SVGA 4Q0OA 5I83A 5I40A 4O70A 5EQ1A 2KWOA 2DVSA 2L0BA 5EWVA 4GB0A 2M85A 3N9NA 3M62A 4WHUA 4O75A 3UVWA 4A4CA 3Q2EA 5HJCA 4O7BA 4MR5A 4UIZA 5ENBA 5L97A 4HBWA 5DX4A 2PUYA 4XI1A 2L5UA 2ECTA 4NRCA 4MEOA 3UV5A 2DATA 3MB3A 3HTKC 4IR4A 4MR4A 4TU4A 3Q2FA 5DYAA 2ECWA 5TBNA 5C11A 3P1DA 2G4AA 2YT5A 4L58A 5F62A 5LKTA 5II1A 5CRMA 4HXRA 5LKZA 1WIMA 4WHWA 2F6JA 4GNEA 4HBXA 4YYHA 5KH9A 3UVDA 3ONIA 3T7LA 4NXJA 5F61A 1Z6UA 1WUMA 5EISA 5I80A 4QEWA 1WEOA 5F60A 3AADA 3ZVZB 3AQAA 3S92A 4UIUA 4XY9A 5D3PA 3NG2A 5ENEA 1WFKA 4NR4A 2VP7A 5CUBA 4UI9B 2L84A 4YABA 2MA6A 2YW5A 4RVRA 5ENIA 2LGLA 1E6IA 5I89A 2ZETC 3QZVA 2VPGA 5D0CA 3O36A 3EB6A 5L96A 4A9JA 4FJCA 3U5JA 2KTBB 1HYIA 1EQFA 4UYDA 5BT5A 2D8SA 5H1VA 4N4FA 4Z6HA 2KWNA 3M63A 1WE9A 2KFTA 2YYRA 4NR6A 1VD4A 5IGLA 4A0CD 3DPLR 5COIA 4NYWA 4PY6A 2JMJA 3VK6A 5D1KB 2Y1NA 2K17A 3GL6A 3RPGB 2CT2A 1WGMA 5HELA 2MUMA 2E7OA 4TZ8A 2VJEB 4B86C 1DVPA 3KQIA 2CKLB 2M1RA 3P1CA 4ZDTA 2BAYA 3U5NA 2EODA 2KU3A 3N9LA 2K4DA 4F52B 5TDWA 3LRQA 4LZSA 3KV5A 3TLPA 5I3LA 4LLBA 5C8GA 5CQ6A 5DLZA 4J0SA 5EV9A 4CUPA 2XB1A 5F5ZA 2YDWA 5IG6A 4YBSA 3UVXA 5CUAA 4OGIA 3HMHA 4F3IA 1WUGA 5C89A 4NR9A 2LXPC 1FP0A 4TT2A 5DYUA 5KTXA 4NYXA 4QSPA 5AD3A 5CUEA 5CQ5A 5CQ7A 5DYCA 4MEQA 4S3OC 3KV6A 5ACYA 3UW9A 5FE1A 1JM7B 5EI4A 2WP1A 4YYJA 2G45A 2YHOA 2R0VA 2AN6A 4HXSA 5FG4A 5DKHA 5LVQA 5D3LA 2MIQA 2DVVA 5G04B 4AYCA 2I50A 5KH7A 2QICA 4YATA 2YSMA 1G25A 4TT4A 1JM7A 5HFRA 4OUFA 5DLXA 2YURA 4DONA 5I7XA 5ETBA 2KREA 3P5OA 4A9MA 2E7NA 4N4GA 5D3NA 4NN2A 5FE6A 5D7XA 2L85A 3JVJA 4ZC9A 3P1EA 4N4HA 3LXJA 4YY6A 4NS5A 5E3DA 4BW1A 5ENCA 5HQ6A 2MNYA 4I7BA 4LZRA 2ECGA 5DBMA 2RO1A 5KO4A 4NR5A 4QEUA 5JI8A 1WILA 5FG6A 4N3WA 3S91A 5KTUA 2L5EA 4X2IA 5EICA 4QR4A 2F42A 5C4QA 2LV9A 3D7CA 4TS8A 4MVTA 4S3OB 4WZ0A 4YAXA 3SOWA 5E9LA 5DINA 2RS9B 4R8PK 5A5RA 1HYJA 3N9QA 1N72A 1U6GB 4P5OB 4YK0A 2UZGA 5A82A 2GRCA 4QSVA 4Q0NA 2FUIA 4ALHA 4QB3A 1F62A 5BT4A 3RPGC 3UVYA 2ECIA 1LDJB 3PUQA 2E3KA 1F68A 3QZTA 3PHDA 5IGNA 2D9EA 5D26A 3MHHA 5CU8A 1WEVA 3KNVA 3ZYQA 1JM4B 4QSTA 2IDAA 4UIVA 4YYIA 4LADB 1FBVA 5D3HA 2ECVA 2KGIA 4L7XA 4NRBA 4CUQA 1T1HA 4HXNA 2VPEA 5D1LB 4NR8A 1X0JA 3GV4A 4QSQA 2LDRA 2MD7B 4NUCA 4CFKA 5F1LA 2EA6A 2HYED 5G05B 5JG6A 3U5KA 1JSPB 5KU3A 4NRAA 4QF2A 3G0JA 2JMDA 5FE2A 5B79A 3HMFA 2RNYA 5DKCA 5EU1A 5A7CA 5D1MB 5ENJA 5HCLA 2DWWA 2Y1MA 3MXFA 3SOUA 5E9MA 5LJ1A 3DAIA 3EB5A 5E74A 5HRXA 4QUTA 5EK9A 4FO9A 4UITA 4UYFB 3JVKA 5ENHA 5FB1A 5EWCA 3O7AA 4W4UA 4CA1A 4O72A 4TQNA 4WIVA 3U5PA 4YH4A 5FDZA 5I1QA 5FE7A 3O34A 4HBYA 4QNSA 5J0DA 2KE1A 2KIZA 4BW2A 2VPDA 4A9LA 3ZNIA 4ZW1A 4LC2A 3ZVYA 1WEWA 4XUAA 3K2JA 5CY9A 5C87A 5L99A 4HXKA 5LKUA 4LR6A 4O76A 5IGMA 4XYAA 4QEVA 3DWYA 5K29A 4R2YA 4TU6A 4QF3A 5DFCA 5F2PA 4QSXA 5CQ8A 2VPBA 4PKLA 5DYXA 4YH3A 4IR5A 4NQMA 5LJ2A 5G0FA 4YYMA 5LUUA 2NXBA 5I86A 3N9MA 1ZBDB 2R0SA 2YELA 3IHPA 4C66A 2OUOA 2R0YA 2OXQC 2YQDA 4GPJA 4Z6IA 2VJEA 4WZ2A 1BORA 2NAAA 5FEYA 2VNFA 2K1JA 5CRZA 5B76A 5JWMA 2LGKA 2CKLA 5II2A 4B7YC 2G6QA 1ZS5A 4QC3A 1E4UA 4NR7A 5E9KA 2K16A 5H1TA 4A9OA 2RNWA 5FFVA 5IBNA 2D82A 4YYDA 2C2LA 4Z1QA 4WZ3B 3O37A 5CPEA 5J3XA 4HXPA 5CQ3A 5DY7A 5H85A 5AD2A 2VJFB 5D25A 2DKWA 3LJWA 5E73A 5FFWA 5D3RA 2LXHC 3UV4A 4UYHA 2N9GA 5TCMA 3SVHA 4I7CA 5D3TA 4UYGA 2FUUA 4TKPB 4QYDA 5DFDA 4O71A 4YADA 5A81A 4YBMA 2DVRA 4UIWA 1VYXA 4R7EA 5IGKA 1N87A 4IORA 4LJNA 4Y03A 2EGPA 5AIUA 5A5OA 3FL2A 4PS5A 5IIDA 1X4JA 4QSWA 4N4IA 5A83A 5EGUA 5FG5A 5F63A 5LCWB 4QSRA 2YYNA 2LN0A 4ZUXU 4QZSA 2JMIA 4KV4A 5DFBA 4CUSA 3HMEA 4LDFA 2C2VS 5HRWA 4ZQLA 3MUKA 2YREA 2H0DB 3C6WA 5TB6A 4WA6A 2FSAA 4YYKA 4NYVA 2JRJA 4J0RA 3I3JA 3RCWA 3FKMX 5E3GA 4V3LC 4KV1A 4IC3A 1WEUA 4YY4A 5L98A 5F3AA 5FBXA 2RFJA 5E9IA 5CQAA 5EWHA 4Q6FA 3ZYUA 3QZSA 2H0DA 4AP4A 4IOQA 5G4SA 5KTWA 3HCTA 3N9PA 4QUUA 4TZ2A 4CUTA 5FE3A 4UYEA 5FH6A 4XY8A 4BHWA 1JOCA 4HXLA 4A9KA 2YW8A 4Z1SA 2F6NA 3RTRB 5A5PA 1WEMA 4O77A 2I7KA 5EPRA 4O7CA 5C7NA 3DQVR 4A4BA 2M6MA 2YEMA 4FK5A 5EWWA 2KYUA 4MEPA 4O74A 4OGJA 3L11A 5AMEA 4UP0A 4KCXA 5ENGA 5FE4A 4YC9A 5I88A 3MQMA 4AKNA 5HM0A 4LYIA 4PCEA 4MR3A 2E6SA 5FE5A 4HBVA 5CGPA 1VFYA 5D3JA 3IU5A 4O7EA 5CUDA 4CL9A 4PTBA 2G43A 4BJXA 4BW3A 5F25A 5HEMA 2LSPB 2L75A 5ETDA 5E0RA 1WEPA 4QY4A 4TT6A 3U5MA 3O33A 2MD8C 5LKXA 3IU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9I A;  2HDP A;  2L80 A;  5DW2 A;  4QYL A;  4I7D A;  2YQL A;  5EVA A;  2ECN A;  5LVR A;  4FLP A;  1Z60 A;  5AIT A;  2YEK A;  5FH8 A;  2QJ0 A;  4X3G A;  4C9Z A;  4A9N A;  5D24 A;  2LRI C;  3JVM A;  2L43 A;  2MA5 A;  4UP5 A;  4UYF A;  2E6R A;  4QC1 A;  2KGG A;  4LRG A;  4TTE A;  4YYG A;  2YHN A;  4PCI A;  4V3K C;  5DKD A;  2MNZ A;  4A49 A;  3U5O A;  3UV2 A;  3I2D A;  5HQ5 A;  3MUL A;  5EPB A;  2CSY A;  5A5S A;  4C67 A;  5EYA F;  3ZPV E;  3MB4 A;  3T6R A;  5FFY A;  5CZG A;  5CUC A;  5TRB A;  4O7A A;  5L8U A;  1WEQ A;  3O35 A;  4YBT A;  4J3I A;  4YYN A;  3JVL A;  5E9Y A;  3LQJ A;  4A9E A;  5CUG A;  5CTL A;  4GNF A;  2LGG A;  4NQN A;  5EWD A;  2PNX A;  3M99 A;  4BBQ A;  3O70 A;  1V87 A;  2I8N A;  3U5L A;  4BW4 A;  3LQI A;  2QIZ A;  1LDK C;  2RNX A;  5B77 A;  2MT5 A;  2YUC A;  3L1X A;  1RMD A;  5H9M A;  5I29 A;  3SVF A;  1WEN A;  3ASL A;  4PPE A;  1K2F A;  5KHM A;  4QR5 A;  3V43 A;  2ECJ A;  4NUE A;  4QBM A;  5CQ4 A;  1MM3 A;  2RSD A;  4CCG X;  5CS8 A;  1WES A;  5F1H A;  4CFL A;  4A9H A;  5ENF A;  2KR4 A;  3L1Z B;  3ZPV 1;  1MM2 A;  5TAB A;  2XEU A;  3MHS A;  2RI7 A;  3G0L A;  5EPS A;  3P1F A;  2KWJ A;  2M3H A;  3PUR A;  5FE8 A;  4LK9 A;  5FER A;  1X4U A;  5HRV A;  4IR3 A;  4O64 A;  2H60 A;  4AYC B;  2VJF A;  2DVQ A;  1CHC A;  4LYW A;  4NUD A;  3SHB A;  2LGV A;  4MSX A;  1Z2Q A;  4XUB A;  1WEE A;  5LJ0 A;  5A5Q A;  4IOO A;  5FE9 A;  4CUR A;  2WP2 A;  3LQH A;  5E7D A;  5FH7 A;  4E96 A;  4CLB A;  5B75 A;  5KH3 A;  5H1U A;  5EM3 A;  4QSU A;  5D3S A;  4MR6 A;  4GNG A;  5F36 A;  2MJV B;  5E9V A;  2YQM A;  2LQ6 A;  2Y43 A;  4J1P A;  4LYS A;  4LKA A;  4QR3 A;  5EP7 A;  4IC2 A;  2YU4 A;  4AVX A;  4O7F A;  4TYL A;  5B8D A;  4ALG A;  3HCS A;  4FIP A;  5A85 A;  5G4R A;  5AMF A;  2DX8 A;  2R10 A;  2OO1 A;  3NXB A;  2OSS A;  5TDR A;  4A9F A;  4AUQ B;  5CFW A;  5HQ7 A;  1XWH A;  4HXO A;  5BT3 A;  4GND A;  3SOX A;  5FE0 A;  3GG3 A;  3HCU A;  5HLS A;  5DKA A;  5C85 A;  5DW1 A;  3C5K A;  3N9O A;  2KWK A;  4Z93 A;  4MEN A;  1X4I A;  4QSS A;  5HFQ A;  5A5N A;  4LZ2 A;  5C13 A;  4UIX A;  5CP5 A;  4HXM A;  4O78 A;  2CSZ A;  5FB0 A;  4IR6 A;  3ZTG A;  5I7Y A;  5L8T A;  1IYM A;  4UIY A;  5B78 A;  5CQT A;  4CUU A;  5HEN A;  2YSJ A;  5EA1 A;  3SVG A;  4Q0O A;  5I83 A;  5I40 A;  4O70 A;  5EQ1 A;  2KWO A;  2DVS A;  2L0B A;  5EWV A;  4GB0 A;  2M85 A;  3N9N A;  3M62 A;  4WHU A;  4O75 A;  3UVW A;  4A4C A;  3Q2E A;  5HJC A;  4O7B A;  4MR5 A;  4UIZ A;  5ENB A;  5L97 A;  4HBW A;  5DX4 A;  2PUY A;  4XI1 A;  2L5U A;  2ECT A;  4NRC A;  4MEO A;  3UV5 A;  2DAT A;  3MB3 A;  3HTK C;  4IR4 A;  4MR4 A;  4TU4 A;  3Q2F A;  5DYA A;  2ECW A;  5TBN A;  5C11 A;  3P1D A;  2G4A A;  2YT5 A;  4L58 A;  5F62 A;  5LKT A;  5II1 A;  5CRM A;  4HXR A;  5LKZ A;  1WIM A;  4WHW A;  2F6J A;  4GNE A;  4HBX A;  4YYH A;  5KH9 A;  3UVD A;  3ONI A;  3T7L A;  4NXJ A;  5F61 A;  1Z6U A;  1WUM A;  5EIS A;  5I80 A;  4QEW A;  1WEO A;  5F60 A;  3AAD A;  3ZVZ B;  3AQA A;  3S92 A;  4UIU A;  4XY9 A;  5D3P A;  3NG2 A;  5ENE A;  1WFK A;  4NR4 A;  2VP7 A;  5CUB A;  4UI9 B;  2L84 A;  4YAB A;  2MA6 A;  2YW5 A;  4RVR A;  5ENI A;  2LGL A;  1E6I A;  5I89 A;  2ZET C;  3QZV A;  2VPG A;  5D0C A;  3O36 A;  3EB6 A;  5L96 A;  4A9J A;  4FJC A;  3U5J A;  2KTB B;  1HYI A;  1EQF A;  4UYD A;  5BT5 A;  2D8S A;  5H1V A;  4N4F A;  4Z6H A;  2KWN A;  3M63 A;  1WE9 A;  2KFT A;  2YYR A;  4NR6 A;  1VD4 A;  5IGL A;  4A0C D;  3DPL R;  5COI A;  4NYW A;  4PY6 A;  2JMJ A;  3VK6 A;  5D1K B;  2Y1N A;  2K17 A;  3GL6 A;  3RPG B;  2CT2 A;  1WGM A;  5HEL A;  2MUM A;  2E7O A;  4TZ8 A;  2VJE B;  4B86 C;  1DVP A;  3KQI A;  2CKL B;  2M1R A;  3P1C A;  4ZDT A;  2BAY A;  3U5N A;  2EOD A;  2KU3 A;  3N9L A;  2K4D A;  4F52 B;  5TDW A;  3LRQ A;  4LZS A;  3KV5 A;  3TLP A;  5I3L A;  4LLB A;  5C8G A;  5CQ6 A;  5DLZ A;  4J0S A;  5EV9 A;  4CUP A;  2XB1 A;  5F5Z A;  2YDW A;  5IG6 A;  4YBS A;  3UVX A;  5CUA A;  4OGI A;  3HMH A;  4F3I A;  1WUG A;  5C89 A;  4NR9 A;  2LXP C;  1FP0 A;  4TT2 A;  5DYU A;  5KTX A;  4NYX A;  4QSP A;  5AD3 A;  5CUE A;  5CQ5 A;  5CQ7 A;  5DYC A;  4MEQ A;  4S3O C;  3KV6 A;  5ACY A;  3UW9 A;  5FE1 A;  1JM7 B;  5EI4 A;  2WP1 A;  4YYJ A;  2G45 A;  2YHO A;  2R0V A;  2AN6 A;  4HXS A;  5FG4 A;  5DKH A;  5LVQ A;  5D3L A;  2MIQ A;  2DVV A;  5G04 B;  4AYC A;  2I50 A;  5KH7 A;  2QIC A;  4YAT A;  2YSM A;  1G25 A;  4TT4 A;  1JM7 A;  5HFR A;  4OUF A;  5DLX A;  2YUR A;  4DON A;  5I7X A;  5ETB A;  2KRE A;  3P5O A;  4A9M A;  2E7N A;  4N4G A;  5D3N A;  4NN2 A;  5FE6 A;  5D7X A;  2L85 A;  3JVJ A;  4ZC9 A;  3P1E A;  4N4H A;  3LXJ A;  4YY6 A;  4NS5 A;  5E3D A;  4BW1 A;  5ENC A;  5HQ6 A;  2MNY A;  4I7B A;  4LZR A;  2ECG A;  5DBM A;  2RO1 A;  5KO4 A;  4NR5 A;  4QEU A;  5JI8 A;  1WIL A;  5FG6 A;  4N3W A;  3S91 A;  5KTU A;  2L5E A;  4X2I A;  5EIC A;  4QR4 A;  2F42 A;  5C4Q A;  2LV9 A;  3D7C A;  4TS8 A;  4MVT A;  4S3O B;  4WZ0 A;  4YAX A;  3SOW A;  5E9L A;  5DIN A;  2RS9 B;  4R8P K;  5A5R A;  1HYJ A;  3N9Q A;  1N72 A;  1U6G B;  4P5O B;  4YK0 A;  2UZG A;  5A82 A;  2GRC A;  4QSV A;  4Q0N A;  2FUI A;  4ALH A;  4QB3 A;  1F62 A;  5BT4 A;  3RPG C;  3UVY A;  2ECI A;  1LDJ B;  3PUQ A;  2E3K A;  1F68 A;  3QZT A;  3PHD A;  5IGN A;  2D9E A;  5D26 A;  3MHH A;  5CU8 A;  1WEV A;  3KNV A;  3ZYQ A;  1JM4 B;  4QST A;  2IDA A;  4UIV A;  4YYI A;  4LAD B;  1FBV A;  5D3H A;  2ECV A;  2KGI A;  4L7X A;  4NRB A;  4CUQ A;  1T1H A;  4HXN A;  2VPE A;  5D1L B;  4NR8 A;  1X0J A;  3GV4 A;  4QSQ A;  2LDR A;  2MD7 B;  4NUC A;  4CFK A;  5F1L A;  2EA6 A;  2HYE D;  5G05 B;  5JG6 A;  3U5K A;  1JSP B;  5KU3 A;  4NRA A;  4QF2 A;  3G0J A;  2JMD A;  5FE2 A;  5B79 A;  3HMF A;  2RNY A;  5DKC A;  5EU1 A;  5A7C A;  5D1M B;  5ENJ A;  5HCL A;  2DWW A;  2Y1M A;  3MXF A;  3SOU A;  5E9M A;  5LJ1 A;  3DAI A;  3EB5 A;  5E74 A;  5HRX A;  4QUT A;  5EK9 A;  4FO9 A;  4UIT A;  4UYF B;  3JVK A;  5ENH A;  5FB1 A;  5EWC A;  3O7A A;  4W4U A;  4CA1 A;  4O72 A;  4TQN A;  4WIV A;  3U5P A;  4YH4 A;  5FDZ A;  5I1Q A;  5FE7 A;  3O34 A;  4HBY A;  4QNS A;  5J0D A;  2KE1 A;  2KIZ A;  4BW2 A;  2VPD A;  4A9L A;  3ZNI A;  4ZW1 A;  4LC2 A;  3ZVY A;  1WEW A;  4XUA A;  3K2J A;  5CY9 A;  5C87 A;  5L99 A;  4HXK A;  5LKU A;  4LR6 A;  4O76 A;  5IGM A;  4XYA A;  4QEV A;  3DWY A;  5K29 A;  4R2Y A;  4TU6 A;  4QF3 A;  5DFC A;  5F2P A;  4QSX A;  5CQ8 A;  2VPB A;  4PKL A;  5DYX A;  4YH3 A;  4IR5 A;  4NQM A;  5LJ2 A;  5G0F A;  4YYM A;  5LUU A;  2NXB A;  5I86 A;  3N9M A;  1ZBD B;  2R0S A;  2YEL A;  3IHP A;  4C66 A;  2OUO A;  2R0Y A;  2OXQ C;  2YQD A;  4GPJ A;  4Z6I A;  2VJE A;  4WZ2 A;  1BOR A;  2NAA A;  5FEY A;  2VNF A;  2K1J A;  5CRZ A;  5B76 A;  5JWM A;  2LGK A;  2CKL A;  5II2 A;  4B7Y C;  2G6Q A;  1ZS5 A;  4QC3 A;  1E4U A;  4NR7 A;  5E9K A;  2K16 A;  5H1T A;  4A9O A;  2RNW A;  5FFV A;  5IBN A;  2D82 A;  4YYD A;  2C2L A;  4Z1Q A;  4WZ3 B;  3O37 A;  5CPE A;  5J3X A;  4HXP A;  5CQ3 A;  5DY7 A;  5H85 A;  5AD2 A;  2VJF B;  5D25 A;  2DKW A;  3LJW A;  5E73 A;  5FFW A;  5D3R A;  2LXH C;  3UV4 A;  4UYH A;  2N9G A;  5TCM A;  3SVH A;  4I7C A;  5D3T A;  4UYG A;  2FUU A;  4TKP B;  4QYD A;  5DFD A;  4O71 A;  4YAD A;  5A81 A;  4YBM A;  2DVR A;  4UIW A;  1VYX A;  4R7E A;  5IGK A;  1N87 A;  4IOR A;  4LJN A;  4Y03 A;  2EGP A;  5AIU A;  5A5O A;  3FL2 A;  4PS5 A;  5IID A;  1X4J A;  4QSW A;  4N4I A;  5A83 A;  5EGU A;  5FG5 A;  5F63 A;  5LCW B;  4QSR A;  2YYN A;  2LN0 A;  4ZUX U;  4QZS A;  2JMI A;  4KV4 A;  5DFB A;  4CUS A;  3HME A;  4LDF A;  2C2V S;  5HRW A;  4ZQL A;  3MUK A;  2YRE A;  2H0D B;  3C6W A;  5TB6 A;  4WA6 A;  2FSA A;  4YYK A;  4NYV A;  2JRJ A;  4J0R A;  3I3J A;  3RCW A;  3FKM X;  5E3G A;  4V3L C;  4KV1 A;  4IC3 A;  1WEU A;  4YY4 A;  5L98 A;  5F3A A;  5FBX A;  2RFJ A;  5E9I A;  5CQA A;  5EWH A;  4Q6F A;  3ZYU A;  3QZS A;  2H0D A;  4AP4 A;  4IOQ A;  5G4S A;  5KTW A;  3HCT A;  3N9P A;  4QUU A;  4TZ2 A;  4CUT A;  5FE3 A;  4UYE A;  5FH6 A;  4XY8 A;  4BHW A;  1JOC A;  4HXL A;  4A9K A;  2YW8 A;  4Z1S A;  2F6N A;  3RTR B;  5A5P A;  1WEM A;  4O77 A;  2I7K A;  5EPR A;  4O7C A;  5C7N A;  3DQV R;  4A4B A;  2M6M A;  2YEM A;  4FK5 A;  5EWW A;  2KYU A;  4MEP A;  4O74 A;  4OGJ A;  3L11 A;  5AME A;  4UP0 A;  4KCX A;  5ENG A;  5FE4 A;  4YC9 A;  5I88 A;  3MQM A;  4AKN A;  5HM0 A;  4LYI A;  4PCE A;  4MR3 A;  2E6S A;  5FE5 A;  4HBV A;  5CGP A;  1VFY A;  5D3J A;  3IU5 A;  4O7E A;  5CUD A;  4CL9 A;  4PTB A;  2G43 A;  4BJX A;  4BW3 A;  5F25 A;  5HEM A;  2LSP B;  2L75 A;  5ETD A;  5E0R A;  1WEP A;  4QY4 A;  4TT6 A;  3U5M A;  3O33 A;  2MD8 C;  5LKX A;  3IU6 A; 
#chains in the Genus database with same CATH topology
 4A9I A;  2HDP A;  2L80 A;  5DW2 A;  4QYL A;  2EGM A;  4I7D A;  2YQL A;  5EVA A;  2ECN A;  3SUB A;  5LVR A;  4FLP A;  1Z60 A;  3MDB C;  5AIT A;  3LJU X;  2YEK A;  5FH8 A;  2QJ0 A;  4X3G A;  4C9Z A;  4A9N A;  5D24 A;  2LRI C;  3JVM A;  2L43 A;  2MA5 A;  4UP5 A;  2FD4 A;  4UYF A;  4AKH A;  2E6R A;  4QC1 A;  2KGG A;  3D1B A;  4LRG A;  4TTE A;  4YYG A;  2YHN A;  4PCI A;  4V3K C;  5DKD A;  2MNZ A;  4A49 A;  3U5O A;  3UV2 A;  3I2D A;  5HQ5 A;  3MUL A;  5EPB A;  2CSY A;  1ZKR A;  4C67 A;  5A5S A;  5EYA F;  3ZPV E;  2D8U A;  3MB4 A;  3T6R A;  5FFY A;  5CZG A;  5CUC A;  5TRB A;  4O7A A;  5L8U A;  1WEQ A;  3O35 A;  4YBT A;  4J3I A;  4YYN A;  3JVL A;  5E9Y A;  3LQJ A;  4A9E A;  5CUG A;  5CTL A;  4GNF A;  2LGG A;  4NQN A;  5EWD A;  2PNX A;  3M99 A;  4BBQ A;  3O70 A;  1V87 A;  2I8N A;  3U5L A;  4BW4 A;  3LQI A;  2QIZ A;  1LDK C;  2RNX A;  5B77 A;  3FJU B;  2MT5 A;  2YUC A;  3L1X A;  1RMD A;  5H9M A;  5I29 A;  3SVF A;  1WEN A;  3ASL A;  4PPE A;  1K2F A;  5KHM A;  3FAO A;  4QR5 A;  3VKG A;  2ECJ A;  4NUE A;  4QBM A;  5CQ4 A;  1MM3 A;  2RSD A;  3V43 A;  3FM8 C;  4CCG X;  5CS8 A;  1WES A;  5F1H A;  4CFL A;  4A9H A;  5ENF A;  2KR4 A;  3L1Z B;  3ZPV 1;  1MM2 A;  5TAB A;  2XEU A;  3MHS A;  2RI7 A;  3G0L A;  5EPS A;  3P1F A;  2KWJ A;  2M3H A;  3PUR A;  5FE8 A;  4LK9 A;  5FER A;  1X4U A;  5HRV A;  4IR3 A;  4O64 A;  2H60 A;  4AYC B;  2VJF A;  2DVQ A;  1CHC A;  4LYW A;  4NUD A;  3SHB A;  2LGV A;  4MSX A;  1Z2Q A;  4XUB A;  1WEE A;  5LJ0 A;  5A5Q A;  4IOO A;  5FE9 A;  2KKX A;  4CUR A;  2WP2 A;  3LQH A;  5E7D A;  5FH7 A;  4E96 A;  2CSV A;  4CLB A;  5B75 A;  5KH3 A;  5SVX A;  5H1U A;  5EM3 A;  4QSU A;  5D3S A;  4MR6 A;  4GNG A;  5F36 A;  2MJV B;  5E9V A;  2YQM A;  2LQ6 A;  2Y43 A;  4J1P A;  4LYS A;  4LKA A;  4QR3 A;  5EP7 A;  4IC2 A;  2XOZ A;  2YU4 A;  4O7F A;  4AVX A;  4TYL A;  5B8D A;  4ALG A;  3HCS A;  4FIP A;  5A85 A;  5G4R A;  5AMF A;  2DX8 A;  2R10 A;  2OO1 A;  2XP0 A;  3NXB A;  2OSS A;  5TDR A;  4A9F A;  4AUQ B;  5CFW A;  5HQ7 A;  1XWH A;  4HXO A;  5SVI B;  5BT3 A;  4GND A;  3SOX A;  5FE0 A;  5K3Q A;  3GG3 A;  3D1D A;  3HCU A;  5HLS A;  5DKA A;  5C85 A;  3M7K A;  5DW1 A;  3C5K A;  2LAU A;  3N9O A;  2KWK A;  2P57 A;  4Z93 A;  4MEN A;  1X4I A;  4QSS A;  5HFQ A;  5A5N A;  4LZ2 A;  5C13 A;  4UIX A;  5CP5 A;  4HXM A;  4O78 A;  2CSZ A;  5FB0 A;  4IR6 A;  3ZTG A;  5I7Y A;  5L8T A;  1IYM A;  4UIY A;  5B78 A;  5CQT A;  4CUU A;  5HEN A;  2YSJ A;  5EA1 A;  3SVG A;  4Q0O A;  5I83 A;  5I40 A;  4O70 A;  5EQ1 A;  2KWO A;  2DVS A;  2L0B A;  5EWV A;  4GB0 A;  2M85 A;  3N9N A;  3M62 A;  4WHU A;  4O75 A;  3UVW A;  4A4C A;  3Q2E A;  5HJC A;  4O7B A;  4MR5 A;  4UIZ A;  5ENB A;  5L97 A;  4HBW A;  5DX4 A;  2PUY A;  4XI1 A;  2L5U A;  2ECT A;  4NRC A;  4MEO A;  3UV5 A;  2DAT A;  3MB3 A;  3HTK C;  4IR4 A;  4MR4 A;  4TU4 A;  3Q2F A;  5DYA A;  2ECW A;  5TBN A;  5SVY A;  5C11 A;  3P1D A;  2G4A A;  2YT5 A;  4L58 A;  5F62 A;  5LKT A;  5II1 A;  5CRM A;  2YVR A;  4HXR A;  5LKZ A;  1WIM A;  4WHW A;  2F6J A;  4GNE A;  4HBX A;  4YYH A;  5KH9 A;  3UVD A;  1MBM A;  3ONI A;  3T7L A;  4NXJ A;  5F61 A;  1Z6U A;  1WUM A;  5EIS A;  2XOY A;  5I80 A;  4QEW A;  1WEO A;  5F60 A;  3AAD A;  3ZVZ B;  3AQA A;  3S92 A;  4Z0O A;  4UIU A;  4XY9 A;  5D3P A;  3NG2 A;  5ENE A;  1WFK A;  4NR4 A;  2VP7 A;  5CUB A;  4UI9 B;  2L84 A;  4YAB A;  2MA6 A;  3DWD A;  2YW5 A;  4RVR A;  5ENI A;  2LGL A;  1E6I A;  5I89 A;  2ZET C;  3QZV A;  2VPG A;  5D0C A;  3O36 A;  3EB6 A;  5L96 A;  4A9J A;  2CRW A;  3U5J A;  2L7P A;  4FJC A;  2KTB B;  1HYI A;  1EQF A;  4UYD A;  5BT5 A;  2D8S A;  5H1V A;  4N4F A;  4Z6H A;  2KWN A;  3M63 A;  1WE9 A;  2KFT A;  2YYR A;  4NR6 A;  1VD4 A;  5IGL A;  4A0C D;  3DPL R;  5COI A;  4NYW A;  3DDT A;  4PY6 A;  2JMJ A;  3VK6 A;  5D1K B;  2Y1N A;  3JUE A;  2K17 A;  3GL6 A;  3RPG B;  2CT2 A;  1WGM A;  5HEL A;  2MUM A;  2E7O A;  4TZ8 A;  2VJE B;  4B86 C;  1DVP A;  3KQI A;  2CKL B;  2M1R A;  3P1C A;  4ZDT A;  2BAY A;  3U5N A;  2EOD A;  2KU3 A;  3N9L A;  2K4D A;  4F52 B;  5TDW A;  3LRQ A;  2EJN A;  4LZS A;  3KV5 A;  3TLP A;  5I3L A;  4LLB A;  5C8G A;  5CQ6 A;  5DLZ A;  4J0S A;  5EV9 A;  4CUP A;  2XB1 A;  5F5Z A;  2YDW A;  5IG6 A;  4YBS A;  3UVX A;  5CUA A;  4OGI A;  3HMH A;  4F3I A;  1WUG A;  5C89 A;  4NR9 A;  2LXP C;  1FP0 A;  4TT2 A;  5DYU A;  5KTX A;  4NYX A;  4QSP A;  5AD3 A;  2CRR A;  5CUE A;  5CQ5 A;  5CQ7 A;  5DYC A;  4MEQ A;  2MKE A;  4S3O C;  3KV6 A;  5ACY A;  3UW9 A;  5FE1 A;  1JM7 B;  5EI4 A;  2WP1 A;  4YYJ A;  2G45 A;  2YHO A;  4AKG A;  2R0V A;  2AN6 A;  4HXS A;  5FG4 A;  5DKH A;  5LVQ A;  5D3L A;  2MIQ A;  2DVV A;  5G04 B;  4AYC A;  2I50 A;  5KH7 A;  2QIC A;  4YAT A;  2YSM A;  1G25 A;  4TT4 A;  1JM7 A;  5HFR A;  4OUF A;  5DLX A;  2YUR A;  4DON A;  5I7X A;  2RR4 A;  5ETB A;  2KRE A;  3P5O A;  4A9M A;  2E7N A;  4N4G A;  5D3N A;  4NN2 A;  5FE6 A;  5D7X A;  2L85 A;  3JVJ A;  3ERR A;  3P1E A;  4ZC9 A;  4N4H A;  3LXJ A;  4YY6 A;  4NS5 A;  5E3D A;  4BW1 A;  4O62 A;  5ENC A;  5HQ6 A;  4F1P A;  2MNY A;  4I7B A;  4LZR A;  2ECG A;  5DBM A;  2RO1 A;  5KO4 A;  4NR5 A;  4OGE A;  5SVI A;  4QEU A;  5JI8 A;  1WIL A;  5FG6 A;  4N3W A;  3S91 A;  4OGC A;  2CON A;  5KTU A;  2L5E A;  4X2I A;  5EIC A;  4QR4 A;  2F42 A;  5C4Q A;  2LV9 A;  3D7C A;  4TS8 A;  4MVT A;  4S3O B;  4WZ0 A;  4YAX A;  3SOW A;  5E9L A;  5DIN A;  2RS9 B;  4R8P K;  5A5R A;  3LDY A;  3N9Q A;  1HYJ A;  1N72 A;  1U6G B;  4P5O B;  4YK0 A;  2UZG A;  5A82 A;  2GRC A;  4QSV A;  4Q0N A;  2KKY A;  2FUI A;  4ALH A;  4QB3 A;  1F62 A;  5BT4 A;  3RPG C;  3UVY A;  2ECI A;  1LDJ B;  3PUQ A;  2E3K A;  1F68 A;  3QZT A;  3PHD A;  5IGN A;  2D9E A;  5D26 A;  3MHH A;  5CU8 A;  1WEV A;  4AKI A;  3KNV A;  3T9K A;  1JM4 B;  3ZYQ A;  4QST A;  4H9D A;  2IDA A;  4UIV A;  4YYI A;  4LAD B;  1FBV A;  5D3H A;  2ECV A;  2KGI A;  3FEH A;  4L7X A;  4NRB A;  4CUQ A;  1T1H A;  4HXN A;  2VPE A;  5D1L B;  2OWA A;  1PUO A;  4NR8 A;  1X0J A;  3GV4 A;  4QSQ A;  2LDR A;  2MD7 B;  4NUC A;  4CFK A;  5F1L A;  2EA6 A;  2HYE D;  5G05 B;  5JG6 A;  3U5K A;  1JSP B;  5KU3 A;  4NRA A;  4QF2 A;  3G0J A;  2JMD A;  5FE2 A;  5B79 A;  3HMF A;  2RNY A;  5DKC A;  5EU1 A;  5A7C A;  5D1M B;  5ENJ A;  5HCL A;  2DWW A;  2Y1M A;  3MXF A;  3SOU A;  5E9M A;  5LJ1 A;  3DAI A;  3EB5 A;  5E74 A;  5HRX A;  4QUT A;  5EK9 A;  4FO9 A;  4UIT A;  4UYF B;  3JVK A;  5ENH A;  5FB1 A;  5EWC A;  3O7A A;  4W4U A;  4CA1 A;  4O72 A;  4TQN A;  4WIV A;  3U5P A;  4YH4 A;  5FDZ A;  5I1Q A;  5FE7 A;  3O34 A;  4HBY A;  4QNS A;  5J0D A;  2KE1 A;  2KIZ A;  4BW2 A;  2VPD A;  4A9L A;  3ZNI A;  4ZW1 A;  4LC2 A;  3ZVY A;  1WEW A;  4XUA A;  3K2J A;  5CY9 A;  5C87 A;  5L99 A;  4HXK A;  5LKU A;  3H7H A;  4LR6 A;  4O76 A;  5IGM A;  4XYA A;  2M13 A;  4QEV A;  3DWY A;  2JUN A;  5K29 A;  4R2Y A;  4TU6 A;  4QF3 A;  5DFC A;  5F2P A;  4QSX A;  5CQ8 A;  2VPB A;  4PKL A;  5DYX A;  4YH3 A;  4IR5 A;  4NQM A;  5LJ2 A;  5G0F A;  3O47 A;  4YYM A;  5LUU A;  2FFW A;  2NXB A;  5I86 A;  3N9M A;  1ZBD B;  2R0S A;  2YEL A;  3IHP A;  4C66 A;  2OUO A;  2R0Y A;  2OXQ C;  3LVR E;  2YQD A;  4GPJ A;  4Z6I A;  2VJE A;  4WZ2 A;  1BOR A;  2NAA A;  5FEY A;  2VNF A;  2K1J A;  5CRZ A;  5B76 A;  5JWM A;  2LGK A;  2CKL A;  5II2 A;  4B7Y C;  2G6Q A;  4QC3 A;  1ZS5 A;  1E4U A;  4NR7 A;  5E9K A;  2K16 A;  5H1T A;  4A9O A;  2RNW A;  5FFV A;  5IBN A;  2D82 A;  4YYD A;  2DJA A;  2C2L A;  4Z1Q A;  4WZ3 B;  3O37 A;  5CPE A;  5J3X A;  4HXP A;  5CQ3 A;  5DY7 A;  5H85 A;  5AD2 A;  2VJF B;  5D25 A;  2DKW A;  3LJW A;  2EXU A;  5E73 A;  5FFW A;  5D3R A;  2LXH C;  3UV4 A;  4UYH A;  2N9G A;  5TCM A;  3LVQ E;  3SVH A;  4I7C A;  5D3T A;  4UYG A;  2FUU A;  4TKP B;  4QYD A;  5DFD A;  4O71 A;  4YAD A;  5A81 A;  4YBM A;  2DVR A;  4QQ4 A;  2IQJ A;  4UIW A;  1VYX A;  4R7E A;  5IGK A;  1N87 A;  4IOR A;  4LJN A;  4Y03 A;  2EGP A;  5AIU A;  5A5O A;  3FL2 A;  4PS5 A;  5IID A;  1X4J A;  4QSW A;  4N4I A;  5A83 A;  2E61 A;  3VKH A;  5EGU A;  5FG5 A;  5F63 A;  5LCW B;  4QSR A;  2YYN A;  2LN0 A;  4ZUX U;  4QZS A;  2JMI A;  4KV4 A;  5DFB A;  4CUS A;  3HME A;  4LDF A;  2C2V S;  5HRW A;  4ZQL A;  3MUK A;  2YRE A;  2H0D B;  3C6W A;  5TB6 A;  4WA6 A;  2FSA A;  4YYK A;  4NYV A;  2JRJ A;  4J0R A;  3I3J A;  3RCW A;  3FKM X;  5E3G A;  4V3L C;  4KV1 A;  4IC3 A;  1WEU A;  4YY4 A;  5L98 A;  5F3A A;  5FBX A;  2RFJ A;  5E9I A;  2B0O E;  5CQA A;  5EWH A;  4Q6F A;  3ZYU A;  3QZS A;  2H0D A;  4AP4 A;  4IOQ A;  5G4S A;  5KTW A;  3E2D A;  3HCT A;  3N9P A;  4QUU A;  4TZ2 A;  4CUT A;  5FE3 A;  4UYE A;  5FH6 A;  4XY8 A;  4BHW A;  1JOC A;  4HXL A;  4A9K A;  2YW8 A;  4Z1S A;  2F6N A;  4AI6 A;  3RTR B;  5A5P A;  1WEM A;  3PLW A;  4O77 A;  2I7K A;  5EPR A;  4O7C A;  5C7N A;  3DQV R;  4A4B A;  2M6M A;  2YEM A;  3Q1D A;  4FK5 A;  5EWW A;  2JM3 A;  2KYU A;  4MEP A;  4O74 A;  4OGJ A;  3FAN A;  5AME A;  3L11 A;  4KCX A;  5ENG A;  5FE4 A;  4UP0 A;  4YC9 A;  5I88 A;  3MQM A;  4AKN A;  5HM0 A;  4LYI A;  4PCE A;  4MR3 A;  4Z0R A;  2E6S A;  5FE5 A;  4HBV A;  5CGP A;  1VFY A;  5D3J A;  3IU5 A;  4O7E A;  5CUD A;  4CL9 A;  4PTB A;  2DSM A;  2G43 A;  4BJX A;  4BW3 A;  5F25 A;  5HEM A;  2LSP B;  2L75 A;  3KDE C;  5ETD A;  1DCQ A;  5E0R A;  1WEP A;  4QY4 A;  4TT6 A;  3U5M A;  3O33 A;  2XOC A;  2MD8 C;  5LKX A;  3IU6 A; 
#chains in the Genus database with same CATH homology
 4A9I A;  2HDP A;  2L80 A;  5DW2 A;  4QYL A;  4I7D A;  2YQL A;  5EVA A;  2ECN A;  5LVR A;  4FLP A;  1Z60 A;  5AIT A;  2YEK A;  5FH8 A;  2QJ0 A;  4X3G A;  4C9Z A;  4A9N A;  5D24 A;  2LRI C;  3JVM A;  2L43 A;  2MA5 A;  4UP5 A;  4UYF A;  2E6R A;  4QC1 A;  2KGG A;  4LRG A;  4TTE A;  4YYG A;  2YHN A;  4PCI A;  4V3K C;  5DKD A;  2MNZ A;  4A49 A;  3U5O A;  3UV2 A;  3I2D A;  5HQ5 A;  3MUL A;  5EPB A;  2CSY A;  5A5S A;  4C67 A;  5EYA F;  3ZPV E;  3MB4 A;  3T6R A;  5FFY A;  5CZG A;  5CUC A;  5TRB A;  4O7A A;  5L8U A;  1WEQ A;  3O35 A;  4YBT A;  4J3I A;  4YYN A;  3JVL A;  5E9Y A;  3LQJ A;  4A9E A;  5CUG A;  5CTL A;  4GNF A;  2LGG A;  4NQN A;  5EWD A;  2PNX A;  3M99 A;  4BBQ A;  3O70 A;  1V87 A;  2I8N A;  3U5L A;  4BW4 A;  3LQI A;  2QIZ A;  1LDK C;  2RNX A;  5B77 A;  2MT5 A;  2YUC A;  3L1X A;  1RMD A;  5H9M A;  5I29 A;  3SVF A;  1WEN A;  3ASL A;  4PPE A;  1K2F A;  5KHM A;  4QR5 A;  3V43 A;  2ECJ A;  4NUE A;  4QBM A;  5CQ4 A;  1MM3 A;  2RSD A;  4CCG X;  5CS8 A;  1WES A;  5F1H A;  4CFL A;  4A9H A;  5ENF A;  2KR4 A;  3L1Z B;  3ZPV 1;  1MM2 A;  5TAB A;  2XEU A;  3MHS A;  2RI7 A;  3G0L A;  5EPS A;  3P1F A;  2KWJ A;  2M3H A;  3PUR A;  5FE8 A;  4LK9 A;  5FER A;  1X4U A;  5HRV A;  4IR3 A;  4O64 A;  2H60 A;  4AYC B;  2VJF A;  2DVQ A;  1CHC A;  4LYW A;  4NUD A;  3SHB A;  2LGV A;  4MSX A;  1Z2Q A;  4XUB A;  1WEE A;  5LJ0 A;  5A5Q A;  4IOO A;  5FE9 A;  4CUR A;  2WP2 A;  3LQH A;  5E7D A;  5FH7 A;  4E96 A;  4CLB A;  5B75 A;  5KH3 A;  5H1U A;  5EM3 A;  4QSU A;  5D3S A;  4MR6 A;  4GNG A;  5F36 A;  2MJV B;  5E9V A;  2YQM A;  2LQ6 A;  2Y43 A;  4J1P A;  4LYS A;  4LKA A;  4QR3 A;  5EP7 A;  4IC2 A;  2YU4 A;  4AVX A;  4O7F A;  4TYL A;  5B8D A;  4ALG A;  3HCS A;  4FIP A;  5A85 A;  5G4R A;  5AMF A;  2DX8 A;  2R10 A;  2OO1 A;  3NXB A;  2OSS A;  5TDR A;  4A9F A;  4AUQ B;  5CFW A;  5HQ7 A;  1XWH A;  4HXO A;  5BT3 A;  4GND A;  3SOX A;  5FE0 A;  3GG3 A;  3HCU A;  5HLS A;  5DKA A;  5C85 A;  5DW1 A;  3C5K A;  3N9O A;  2KWK A;  4Z93 A;  4MEN A;  1X4I A;  4QSS A;  5HFQ A;  5A5N A;  4LZ2 A;  5C13 A;  4UIX A;  5CP5 A;  4HXM A;  4O78 A;  2CSZ A;  5FB0 A;  4IR6 A;  3ZTG A;  5I7Y A;  5L8T A;  1IYM A;  4UIY A;  5B78 A;  5CQT A;  4CUU A;  5HEN A;  2YSJ A;  5EA1 A;  3SVG A;  4Q0O A;  5I83 A;  5I40 A;  4O70 A;  5EQ1 A;  2KWO A;  2DVS A;  2L0B A;  5EWV A;  4GB0 A;  2M85 A;  3N9N A;  3M62 A;  4WHU A;  4O75 A;  3UVW A;  4A4C A;  3Q2E A;  5HJC A;  4O7B A;  4MR5 A;  4UIZ A;  5ENB A;  5L97 A;  4HBW A;  5DX4 A;  2PUY A;  4XI1 A;  2L5U A;  2ECT A;  4NRC A;  4MEO A;  3UV5 A;  2DAT A;  3MB3 A;  3HTK C;  4IR4 A;  4MR4 A;  4TU4 A;  3Q2F A;  5DYA A;  2ECW A;  5TBN A;  5C11 A;  3P1D A;  2G4A A;  2YT5 A;  4L58 A;  5F62 A;  5LKT A;  5II1 A;  5CRM A;  4HXR A;  5LKZ A;  1WIM A;  4WHW A;  2F6J A;  4GNE A;  4HBX A;  4YYH A;  5KH9 A;  3UVD A;  3ONI A;  3T7L A;  4NXJ A;  5F61 A;  1Z6U A;  1WUM A;  5EIS A;  5I80 A;  4QEW A;  1WEO A;  5F60 A;  3AAD A;  3ZVZ B;  3AQA A;  3S92 A;  4UIU A;  4XY9 A;  5D3P A;  3NG2 A;  5ENE A;  1WFK A;  4NR4 A;  2VP7 A;  5CUB A;  4UI9 B;  2L84 A;  4YAB A;  2MA6 A;  2YW5 A;  4RVR A;  5ENI A;  2LGL A;  1E6I A;  5I89 A;  2ZET C;  3QZV A;  2VPG A;  5D0C A;  3O36 A;  3EB6 A;  5L96 A;  4A9J A;  4FJC A;  3U5J A;  2KTB B;  1HYI A;  1EQF A;  4UYD A;  5BT5 A;  2D8S A;  5H1V A;  4N4F A;  4Z6H A;  2KWN A;  3M63 A;  1WE9 A;  2KFT A;  2YYR A;  4NR6 A;  1VD4 A;  5IGL A;  4A0C D;  3DPL R;  5COI A;  4NYW A;  4PY6 A;  2JMJ A;  3VK6 A;  5D1K B;  2Y1N A;  2K17 A;  3GL6 A;  3RPG B;  2CT2 A;  1WGM A;  5HEL A;  2MUM A;  2E7O A;  4TZ8 A;  2VJE B;  4B86 C;  1DVP A;  3KQI A;  2CKL B;  2M1R A;  3P1C A;  4ZDT A;  2BAY A;  3U5N A;  2EOD A;  2KU3 A;  3N9L A;  2K4D A;  4F52 B;  5TDW A;  3LRQ A;  4LZS A;  3KV5 A;  3TLP A;  5I3L A;  4LLB A;  5C8G A;  5CQ6 A;  5DLZ A;  4J0S A;  5EV9 A;  4CUP A;  2XB1 A;  5F5Z A;  2YDW A;  5IG6 A;  4YBS A;  3UVX A;  5CUA A;  4OGI A;  3HMH A;  4F3I A;  1WUG A;  5C89 A;  4NR9 A;  2LXP C;  1FP0 A;  4TT2 A;  5DYU A;  5KTX A;  4NYX A;  4QSP A;  5AD3 A;  5CUE A;  5CQ5 A;  5CQ7 A;  5DYC A;  4MEQ A;  4S3O C;  3KV6 A;  5ACY A;  3UW9 A;  5FE1 A;  1JM7 B;  5EI4 A;  2WP1 A;  4YYJ A;  2G45 A;  2YHO A;  2R0V A;  2AN6 A;  4HXS A;  5FG4 A;  5DKH A;  5LVQ A;  5D3L A;  2MIQ A;  2DVV A;  5G04 B;  4AYC A;  2I50 A;  5KH7 A;  2QIC A;  4YAT A;  2YSM A;  1G25 A;  4TT4 A;  1JM7 A;  5HFR A;  4OUF A;  5DLX A;  2YUR A;  4DON A;  5I7X A;  5ETB A;  2KRE A;  3P5O A;  4A9M A;  2E7N A;  4N4G A;  5D3N A;  4NN2 A;  5FE6 A;  5D7X A;  2L85 A;  3JVJ A;  4ZC9 A;  3P1E A;  4N4H A;  3LXJ A;  4YY6 A;  4NS5 A;  5E3D A;  4BW1 A;  5ENC A;  5HQ6 A;  2MNY A;  4I7B A;  4LZR A;  2ECG A;  5DBM A;  2RO1 A;  5KO4 A;  4NR5 A;  4QEU A;  5JI8 A;  1WIL A;  5FG6 A;  4N3W A;  3S91 A;  5KTU A;  2L5E A;  4X2I A;  5EIC A;  4QR4 A;  2F42 A;  5C4Q A;  2LV9 A;  3D7C A;  4TS8 A;  4MVT A;  4S3O B;  4WZ0 A;  4YAX A;  3SOW A;  5E9L A;  5DIN A;  2RS9 B;  4R8P K;  5A5R A;  1HYJ A;  3N9Q A;  1N72 A;  1U6G B;  4P5O B;  4YK0 A;  2UZG A;  5A82 A;  2GRC A;  4QSV A;  4Q0N A;  2FUI A;  4ALH A;  4QB3 A;  1F62 A;  5BT4 A;  3RPG C;  3UVY A;  2ECI A;  1LDJ B;  3PUQ A;  2E3K A;  1F68 A;  3QZT A;  3PHD A;  5IGN A;  2D9E A;  5D26 A;  3MHH A;  5CU8 A;  1WEV A;  3KNV A;  3ZYQ A;  1JM4 B;  4QST A;  2IDA A;  4UIV A;  4YYI A;  4LAD B;  1FBV A;  5D3H A;  2ECV A;  2KGI A;  4L7X A;  4NRB A;  4CUQ A;  1T1H A;  4HXN A;  2VPE A;  5D1L B;  4NR8 A;  1X0J A;  3GV4 A;  4QSQ A;  2LDR A;  2MD7 B;  4NUC A;  4CFK A;  5F1L A;  2EA6 A;  2HYE D;  5G05 B;  5JG6 A;  3U5K A;  1JSP B;  5KU3 A;  4NRA A;  4QF2 A;  3G0J A;  2JMD A;  5FE2 A;  5B79 A;  3HMF A;  2RNY A;  5DKC A;  5EU1 A;  5A7C A;  5D1M B;  5ENJ A;  5HCL A;  2DWW A;  2Y1M A;  3MXF A;  3SOU A;  5E9M A;  5LJ1 A;  3DAI A;  3EB5 A;  5E74 A;  5HRX A;  4QUT A;  5EK9 A;  4FO9 A;  4UIT A;  4UYF B;  3JVK A;  5ENH A;  5FB1 A;  5EWC A;  3O7A A;  4W4U A;  4CA1 A;  4O72 A;  4TQN A;  4WIV A;  3U5P A;  4YH4 A;  5FDZ A;  5I1Q A;  5FE7 A;  3O34 A;  4HBY A;  4QNS A;  5J0D A;  2KE1 A;  2KIZ A;  4BW2 A;  2VPD A;  4A9L A;  3ZNI A;  4ZW1 A;  4LC2 A;  3ZVY A;  1WEW A;  4XUA A;  3K2J A;  5CY9 A;  5C87 A;  5L99 A;  4HXK A;  5LKU A;  4LR6 A;  4O76 A;  5IGM A;  4XYA A;  4QEV A;  3DWY A;  5K29 A;  4R2Y A;  4TU6 A;  4QF3 A;  5DFC A;  5F2P A;  4QSX A;  5CQ8 A;  2VPB A;  4PKL A;  5DYX A;  4YH3 A;  4IR5 A;  4NQM A;  5LJ2 A;  5G0F A;  4YYM A;  5LUU A;  2NXB A;  5I86 A;  3N9M A;  1ZBD B;  2R0S A;  2YEL A;  3IHP A;  4C66 A;  2OUO A;  2R0Y A;  2OXQ C;  2YQD A;  4GPJ A;  4Z6I A;  2VJE A;  4WZ2 A;  1BOR A;  2NAA A;  5FEY A;  2VNF A;  2K1J A;  5CRZ A;  5B76 A;  5JWM A;  2LGK A;  2CKL A;  5II2 A;  4B7Y C;  2G6Q A;  1ZS5 A;  4QC3 A;  1E4U A;  4NR7 A;  5E9K A;  2K16 A;  5H1T A;  4A9O A;  2RNW A;  5FFV A;  5IBN A;  2D82 A;  4YYD A;  2C2L A;  4Z1Q A;  4WZ3 B;  3O37 A;  5CPE A;  5J3X A;  4HXP A;  5CQ3 A;  5DY7 A;  5H85 A;  5AD2 A;  2VJF B;  5D25 A;  2DKW A;  3LJW A;  5E73 A;  5FFW A;  5D3R A;  2LXH C;  3UV4 A;  4UYH A;  2N9G A;  5TCM A;  3SVH A;  4I7C A;  5D3T A;  4UYG A;  2FUU A;  4TKP B;  4QYD A;  5DFD A;  4O71 A;  4YAD A;  5A81 A;  4YBM A;  2DVR A;  4UIW A;  1VYX A;  4R7E A;  5IGK A;  1N87 A;  4IOR A;  4LJN A;  4Y03 A;  2EGP A;  5AIU A;  5A5O A;  3FL2 A;  4PS5 A;  5IID A;  1X4J A;  4QSW A;  4N4I A;  5A83 A;  5EGU A;  5FG5 A;  5F63 A;  5LCW B;  4QSR A;  2YYN A;  2LN0 A;  4ZUX U;  4QZS A;  2JMI A;  4KV4 A;  5DFB A;  4CUS A;  3HME A;  4LDF A;  2C2V S;  5HRW A;  4ZQL A;  3MUK A;  2YRE A;  2H0D B;  3C6W A;  5TB6 A;  4WA6 A;  2FSA A;  4YYK A;  4NYV A;  2JRJ A;  4J0R A;  3I3J A;  3RCW A;  3FKM X;  5E3G A;  4V3L C;  4KV1 A;  4IC3 A;  1WEU A;  4YY4 A;  5L98 A;  5F3A A;  5FBX A;  2RFJ A;  5E9I A;  5CQA A;  5EWH A;  4Q6F A;  3ZYU A;  3QZS A;  2H0D A;  4AP4 A;  4IOQ A;  5G4S A;  5KTW A;  3HCT A;  3N9P A;  4QUU A;  4TZ2 A;  4CUT A;  5FE3 A;  4UYE A;  5FH6 A;  4XY8 A;  4BHW A;  1JOC A;  4HXL A;  4A9K A;  2YW8 A;  4Z1S A;  2F6N A;  3RTR B;  5A5P A;  1WEM A;  4O77 A;  2I7K A;  5EPR A;  4O7C A;  5C7N A;  3DQV R;  4A4B A;  2M6M A;  2YEM A;  4FK5 A;  5EWW A;  2KYU A;  4MEP A;  4O74 A;  4OGJ A;  3L11 A;  5AME A;  4UP0 A;  4KCX A;  5ENG A;  5FE4 A;  4YC9 A;  5I88 A;  3MQM A;  4AKN A;  5HM0 A;  4LYI A;  4PCE A;  4MR3 A;  2E6S A;  5FE5 A;  4HBV A;  5CGP A;  1VFY A;  5D3J A;  3IU5 A;  4O7E A;  5CUD A;  4CL9 A;  4PTB A;  2G43 A;  4BJX A;  4BW3 A;  5F25 A;  5HEM A;  2LSP B;  2L75 A;  5ETD A;  5E0R A;  1WEP A;  4QY4 A;  4TT6 A;  3U5M A;  3O33 A;  2MD8 C;  5LKX A;  3IU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...