5H1UA

Complex structure of trim24 phd-bromodomain and inhibitor 2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
180
structure length
174
Chain Sequence
DWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 174
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1uA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1uA01
5E9MA 5HEMA 4YK0A 5DKDA 5A81A 4HBWA 3O70A 1Z2QA 5CQAA 4HXOA 2AN6A 2KYUA 5H1TA 1DVPA 4TU6A 5DFCA 4Z1SA 4QC3A 4UYFB 2ECNA 5KTWA 4Q0NA 4HXSA 2KU3A 4B7YC 3I2DA 2DVQA 4Z6IA 3N9QA 5HQ6A 3ZVYA 3N9NA 1WGMA 5FE4A 3UV2A 3SOUA 4B86C 2YSMA 4AYCB 4X3GA 2MA5A 1VYXA 5DYCA 4CL9A 4NR8A 4NR9A 5G4SA 4UYGA 5TB6A 2LQ6A 3M63A 2YHNA 5KO4A 4F52B 4NR5A 2RNWA 5F36A 3PHDA 2DVSA 5F2PA 2MNYA 4QR4A 4BJXA 4O70A 3AADA 4O72A 5I89A 1JSPB 5AD2A 4YY6A 4UIYA 3G0LA 4QEUA 3U5LA 5LKZA 4O71A 4WZ0A 5I3LA 5CUAA 4FIPA 3IU5A 3LQJA 4MEQA 4YYNA 5HQ5A 4S3OB 4QYDA 2ZETC 2F6NA 3HCSA 3EB5A 4BHWA 3FKMX 5BT3A 2M3HA 5EPBA 3S92A 5FE7A 5LUUA 2ECWA 5J3XA 2HYED 3RPGB 5D24A 5D3RA 2KGGA 3PURA 5COIA 4QSUA 4AKNA 5E7DA 5C8GA 4GNGA 5HFQA 5H85A 1X0JA 3MULA 3HMFA 5EM3A 5A5QA 1HYJA 4LRGA 2RFJA 3ONIA 5ENIA 4QNSA 3SVHA 1ZS5A 5E3DA 3UV4A 5B79A 4A4CA 5E9LA 1WEUA 2PNXA 4GNFA 5FFYA 4QB3A 4HXKA 5DYXA 2LRIC 4C9ZA 5TBNA 2IDAA 3N9OA 4XY8A 1WE9A 3ZPV1 4A9KA 3MHHA 4PPEA 5ETDA 3C6WA 3FL2A 5HRVA 5TABA 2DVVA 4Q6FA 3MQMA 3ZTGA 5CQ3A 5BT4A 2E6SA 2L43A 5EVAA 3UVYA 4BBQA 4IR4A 5D3LA 2YDWA 3JVJA 5L97A 5C85A 2G45A 3KV5A 3SOWA 5B75A 5DLZA 3HMHA 5KHMA 3U5KA 5EI4A 3P1CA 4BW1A 5E74A 4C67A 3ZYQA 5HJCA 5F60A 4CUUA 4CURA 5L98A 4UI9B 1WUMA 5D3TA 4UIUA 4O7BA 4O77A 4N4FA 5DYUA 4QSPA 2MD7B 4LYIA 3QZSA 4A9IA 5F1LA 3RCWA 5HCLA 4YAXA 3HCTA 2VPBA 2H0DB 4LK9A 4NR7A 4HXNA 5ENFA 5E3GA 1E6IA 4O7EA 4AUQB 4TZ8A 4NRAA 5K29A 1LDJB 4J3IA 4KV4A 2MT5A 4UIVA 5L8UA 5CZGA 5DKCA 4IC3A 5DLXA 2M6MA 4F3IA 1WESA 4Y03A 4QSSA 5IGNA 2DVRA 5TCMA 3DQVR 1FP0A 2NXBA 5CU8A 2LV9A 2N9GA 5CRZA 4CFKA 5EPSA 5L99A 3ASLA 5A82A 5D7XA 4NXJA 3NXBA 2YEMA 2YQDA 4CUTA 2ECGA 4L58A 4O7FA 5II1A 3ZYUA 4A9FA 5A85A 4CFLA 4YYJA 4ALHA 5I1QA 1WILA 3TLPA 1X4JA 4YYGA 4O7CA 4LKAA 2MUMA 5ACYA 2F6JA 4YBMA 5FB1A 5FG4A 5ENBA 2DX8A 4E96A 4O7AA 1LDKC 3GL6A 2I8NA 5CQ6A 5KU3A 5B76A 5C13A 4BW3A 5FE3A 5AITA 4YH4A 5C89A 5FE5A 4TYLA 5A5OA 4HXMA 4QYLA 4DONA 1Z60A 1XWHA 1RMDA 5LKTA 2ECTA 5EK9A 2K17A 2L5EA 1U6GB 2LGGA 4UYFA 5DKAA 2FSAA 2D9EA 2JRJA 4WHUA 2OO1A 5EICA 1T1HA 2KFTA 5IBNA 2XEUA 5LVQA 2OSSA 2YYRA 5EA1A 4WZ3B 3MB3A 3KQIA 1JM7B 5LJ1A 3S91A 4MR6A 5G04B 4AYCA 5F3AA 3SVFA 4FJCA 3ZNIA 2RNXA 3JVLA 3HTKC 5TDWA 1WUGA 5I29A 5EWVA 2LDRA 4A9EA 3HCUA 5B8DA 4QBMA 4PS5A 2VPGA 2E7OA 2K1JA 5E73A 3LRQA 5D25A 4CUQA 2YQLA 2YELA 3K2JA 5DY7A 3EB6A 4CUSA 5HRXA 4ZW1A 2R0SA 4MR5A 1BORA 3D7CA 1X4UA 4J0SA 2DKWA 1N87A 4WZ2A 4LC2A 4UIXA 5B78A 2YREA 4C66A 2EGPA 4Z93A 2E7NA 1K2FA 2K4DA 3MXFA 3UVXA 5TRBA 5D1MB 4QZSA 5G05B 4A49A 3P1DA 3QZTA 2I7KA 2JMDA 5KTXA 3I3JA 2KGIA 4HXRA 5DFBA 4I7CA 5AIUA 4A9LA 4QSRA 2L75A 4NUCA 4NYXA 4BW2A 5I86A 5DW1A 4NN2A 5I80A 5FE9A 5HRWA 5FE0A 4YYMA 4QEVA 3LJWA 5C87A 3UVDA 4XI1A 5LJ0A 3PUQA 5G4RA 4WHWA 5I83A 5FE6A 5KTUA 2KIZA 4GNEA 5D1LB 4NYVA 3M62A 4OGIA 5EQ1A 2EA6A 1JM4B 4MEOA 3O36A 4NYWA 4OUFA 5C4QA 3DWYA 4CA1A 5D3PA 5ENJA 4Z1QA 5FE1A 3O37A 5DX4A 5HFRA 4Z6HA 4A9JA 5IGMA 3O35A 4O75A 4O76A 1WEMA 4S3OC 1E4UA 4J1PA 3JVKA 2R0YA 4YADA 4LR6A 5IGLA 3RTRB 4HXLA 4ZUXU 3RPGC 3SHBA 4LLBA 4NRCA 4QR5A 5CP5A 1ZBDB 4XUBA 3N9PA 2L5UA 2R10A 2KWNA 2Y43A 3T7LA 5H1VA 2RSDA 1WIMA 5L96A 4ZDTA 1WEPA 2Y1MA 4TS8A 1FBVA 5B77A 1WEEA 4QSWA 2H0DA 2JMIA 5JWMA 5CQ5A 4A9OA 4PTBA 2DWWA 4FK5A 5CRMA 5F61A 5H1UA 5I7XA 5FG6A 5JG6A 1WEWA 5CTLA 4QSQA 4YABA 4XUAA 2OUOA 4J0RA 5L8TA 4CLBA 2MIQA 2RS9B 2NAAA 3U5OA 4YYIA 2YT5A 4HBXA 4R7EA 4MEPA 2I50A 3SOXA 4NQNA 4PY6A 2VJEB 2LSPB 4O78A 5FBXA 4BW4A 2GRCA 4NUEA 3NG2A 4LJNA 2VJFB 5CUEA 3JVMA 3LXJA 2CKLB 4I7DA 5F1HA 4CUPA 4KV1A 5C11A 4KCXA 2YYNA 5D26A 4A9MA 4IR3A 5C7NA 2YQMA 4NUDA 4QSVA 3L11A 2CSYA 5KH9A 2E6RA 5D3SA 4LADB 3IU6A 2Y1NA 5H9MA 5CUBA 4YBSA 3SVGA 4ALGA 4YY4A 2KR4A 3LQIA 4GB0A 4IC2A 4QC1A 4LZSA 1VD4A 3DPLR 2ECJA 3L1XA 4XYAA 5F25A 4ZC9A 4YC9A 4QSTA 5DYAA 5A5NA 4RVRA 3U5PA 1WFKA 4W4UA 2XB1A 1WENA 2D82A 2LN0A 4PCEA 5FDZA 3U5JA 2UZGA 4TTEA 4IORA 1EQFA 5DFDA 4AVXA 5EU1A 5IGKA 2RNYA 4YBTA 5II2A 5I88A 5IIDA 3U5NA 4PKLA 4TU4A 5FE8A 2BAYA 4YYDA 4TKPB 1JM7A 5FH6A 4UP0A 2FUUA 2LGVA 5ENEA 2C2VS 2EODA 1F62A 3G0JA 4MENA 5EPRA 2YU4A 1JOCA 5A7CA 2DATA 3P5OA 4LYSA 5EISA 5HELA 5JI8A 2L0BA 5CY9A 2QIZA 5HM0A 5AMEA 5DKHA 2MNZA 2OXQC 2MA6A 2KREA 5A5RA 3O33A 5E9KA 2VNFA 3O34A 2RI7A 2F42A 3M99A 2D8SA 4LDFA 5EGUA 5BT5A 3C5KA 4P5OB 4TQNA 3Q2FA 3O7AA 5F62A 5KH3A 1MM3A 4UITA 3N9MA 2YW5A 2RO1A 5KH7A 3P1EA 5EWDA 2R0VA 5CQ8A 5F5ZA 5D1KB 5AD3A 4MR4A 2KWKA 3MB4A 2KWOA 5FFVA 4Q0OA 3IHPA 1N72A 1VFYA 2YURA 2L85A 4A9HA 2LXHC 2H60A 4N4IA 2PUYA 5CUDA 5LCWB 4NRBA 5CUCA 1HYIA 2M1RA 5LVRA 4IOQA 4A0CD 5IG6A 3DAIA 5E0RA 4NR6A 3V43A 2L80A 4V3LC 4O64A 5CQ4A 4NS5A 4CCGX 2CSZA 1F68A 4TT2A 4NR4A 4R2YA 4UIWA 4FLPA 3Q2EA 4O74A 5A5SA 4HBYA 2CT2A 4IR6A 4N4HA 5LKUA 5CFWA 5CS8A 4QF3A 2YSJA 5CGPA 5A83A 2HDPA 3QZVA 2MJVB 4LYWA 3LQHA 5CQ7A 4NQMA 2E3KA 3P1FA 2G43A 4A9NA 5EWHA 5E9VA 2MD8C 4UYHA 5HLSA 3U5MA 4YATA 3N9LA 5FERA 4MVTA 4IR5A 2KTBB 2KE1A 5A5PA 2ECIA 4UYDA 1V87A 3UV5A 5CUGA 4QR3A 5E9IA 4QY4A 4MR3A 2LGKA 2G6QA 4I7BA 4UP5A 5D0CA 2K16A 5E9YA 4YYHA 2WP2A 3HMEA 5G0FA 4N4GA 5EV9A 5HENA 2QICA 5AMFA 2FUIA 1CHCA 5DINA 5J0DA 3VK6A 4WIVA 2VPDA 4QUUA 2L84A 4TT6A 3GV4A 4MSXA 2LXPC 3UW9A 4PCIA 1X4IA 1Z6UA 2VJEA 4N3WA 4X2IA 5I40A 5CQTA 4OGJA 5LJ2A 5EYAF 5EP7A 2VJFA 4R8PK 2ECVA 2LGLA 2CKLA 5CPEA 5DBMA 2YEKA 2M85A 5FE2A 4HBVA 4QUTA 4UYEA 5ETBA 4LZRA 5FH7A 5HQ7A 2JMJA 4TZ2A 2YW8A 2VP7A 5LKXA 5D3HA 5ENHA 5TDRA 4FO9A 3T6RA 4YH3A 4TT4A 4A4BA 1WEVA 2VPEA 5F63A 4IOOA 2WP1A 3GG3A 3L1ZB 5D3NA 5FEYA 5I7YA 5EWWA 1MM2A 4ZQLA 5FH8A 1WEQA 5FB0A 2C2LA 4GPJA 4AP4A 3ZPVE 2QJ0A 5FG5A 2YUCA 3UVWA 4WA6A 3MHSA 4QEWA 4L7XA 5ENCA 3KV6A 4GNDA 2KWJA 4QSXA 2G4AA 3AQAA 5ENGA 5EWCA 4QF2A 5DW2A 4HXPA 4UIZA 5FFWA 2YHOA 4V3KC 4XY9A 1IYMA 5D3JA 3ZVZB 1G25A 4LZ2A 4YYKA 3MUKA 3KNVA 1WEOA
chains in the Genus database with same CATH superfamily
5E9MA 5HEMA 4YK0A 5DKDA 5A81A 4HBWA 3T9KA 3O70A 1Z2QA 2CRWA 5CQAA 4HXOA 2AN6A 2KYUA 5H1TA 1DVPA 4TU6A 5DFCA 4Z1SA 4QC3A 4UYFB 2ECNA 5KTWA 4Q0NA 4HXSA 2KU3A 4B7YC 3I2DA 5K3QA 2DVQA 4Z6IA 3N9QA 5HQ6A 3ZVYA 3N9NA 1WGMA 5FE4A 3UV2A 3SOUA 4B86C 2YSMA 4AYCB 4X3GA 2MA5A 1VYXA 5DYCA 4CL9A 4NR8A 4NR9A 5G4SA 4UYGA 5TB6A 2LQ6A 2DSMA 3M63A 2MKEA 2YHNA 5KO4A 4F52B 4NR5A 2RNWA 5F36A 3PHDA 2DVSA 5F2PA 2MNYA 4QR4A 4BJXA 4O70A 3AADA 4O72A 5I89A 1JSPB 5AD2A 4YY6A 4UIYA 3G0LA 4QEUA 3U5LA 5LKZA 4O71A 4WZ0A 5I3LA 5CUAA 4FIPA 3IU5A 3LQJA 4MEQA 4YYNA 5HQ5A 4S3OB 4QYDA 2ZETC 2F6NA 3HCSA 3EB5A 4BHWA 3FKMX 5BT3A 3O47A 2M3HA 5EPBA 3S92A 5FE7A 5LUUA 2ECWA 5J3XA 2HYED 3RPGB 5D24A 5D3RA 2KGGA 3PURA 5COIA 4QSUA 4AKNA 5E7DA 5C8GA 4GNGA 5HFQA 5H85A 1X0JA 3MULA 3HMFA 5EM3A 5A5QA 1HYJA 4LRGA 2RFJA 3ONIA 5ENIA 4QNSA 3SVHA 1ZS5A 5E3DA 3UV4A 4QQ4A 4A4CA 5E9LA 5B79A 1WEUA 2PNXA 4GNFA 5FFYA 4QB3A 4HXKA 5DYXA 2LRIC 3FAOA 4C9ZA 2IDAA 5TBNA 3N9OA 4XY8A 1WE9A 3ZPV1 4A9KA 3MHHA 4PPEA 5ETDA 3C6WA 3FL2A 5HRVA 5TABA 2DVVA 4Q6FA 3MQMA 3ZTGA 5CQ3A 5BT4A 2E6SA 2L43A 5EVAA 3UVYA 4BBQA 4IR4A 5D3LA 2YDWA 3JVJA 5L97A 5C85A 2G45A 3KV5A 3SOWA 5B75A 5DLZA 3HMHA 5KHMA 3U5KA 5EI4A 3P1CA 4BW1A 5E74A 4C67A 3ZYQA 5HJCA 3PLWA 5F60A 4CUUA 4CURA 5L98A 3D1BA 4UI9B 1WUMA 5D3TA 4UIUA 4O7BA 4O77A 4N4FA 5DYUA 4QSPA 2LAUA 2MD7B 4LYIA 3QZSA 4A9IA 5F1LA 3RCWA 5HCLA 4YAXA 3HCTA 2VPBA 2H0DB 4LK9A 4NR7A 4HXNA 5ENFA 5E3GA 3SUBA 1E6IA 4O7EA 4AUQB 4TZ8A 4NRAA 5K29A 1LDJB 4J3IA 4KV4A 2MT5A 4UIVA 5L8UA 5CZGA 5DKCA 4IC3A 5DLXA 2M6MA 4F3IA 1WESA 4Y03A 4QSSA 5IGNA 2EJNA 3LVQE 2DVRA 5TCMA 3DQVR 1FP0A 2NXBA 5CU8A 2LV9A 2N9GA 5CRZA 4CFKA 5EPSA 5L99A 3ASLA 5A82A 1MBMA 3Q1DA 5D7XA 4NXJA 3NXBA 2YEMA 2YQDA 4CUTA 2ECGA 2RR4A 4L58A 4O7FA 5II1A 3ZYUA 4A9FA 5A85A 4CFLA 4YYJA 4ALHA 5I1QA 1WILA 4Z0OA 3TLPA 1X4JA 4YYGA 4O7CA 4LKAA 2MUMA 5ACYA 2F6JA 4YBMA 5FB1A 5FG4A 5ENBA 2DX8A 4E96A 4O7AA 1LDKC 3GL6A 2I8NA 5CQ6A 5KU3A 5B76A 5C13A 4BW3A 5FE3A 2CRRA 4YH4A 5C89A 5AITA 5FE5A 3KDEC 4TYLA 5A5OA 4HXMA 4QYLA 4DONA 1Z60A 1XWHA 1RMDA 5LKTA 2ECTA 5EK9A 2K17A 2L5EA 1U6GB 2LGGA 4UYFA 5SVYA 5DKAA 2FSAA 2D9EA 2JRJA 4WHUA 2OO1A 5EICA 1T1HA 2KFTA 5IBNA 2KKYA 2XEUA 5LVQA 2OSSA 2XOCA 2YYRA 5EA1A 4WZ3B 3MB3A 3KQIA 1JM7B 5LJ1A 3S91A 4MR6A 5G04B 4AYCA 5F3AA 3SVFA 4FJCA 3ZNIA 2RNXA 3JVLA 3HTKC 5TDWA 1WUGA 5I29A 5EWVA 3M7KA 2LDRA 4A9EA 3HCUA 5B8DA 4QBMA 4PS5A 2VPGA 2E7OA 2K1JA 5E73A 3LRQA 5D25A 4CUQA 2YQLA 2YELA 3K2JA 5DY7A 3EB6A 4CUSA 5HRXA 4ZW1A 2R0SA 4MR5A 1BORA 3D7CA 1X4UA 4J0SA 2DKWA 3DWDA 1N87A 4WZ2A 4LC2A 4UIXA 5B78A 2YREA 4C66A 2EGPA 4Z93A 2E7NA 1K2FA 2K4DA 3MXFA 3UVXA 5TRBA 2JUNA 5D1MB 4QZSA 5G05B 4A49A 2XOZA 3P1DA 3QZTA 2I7KA 2DJAA 5KTXA 2JMDA 3I3JA 2KGIA 2P57A 4HXRA 5DFBA 4I7CA 1DCQA 5AIUA 4A9LA 4QSRA 2L75A 4NUCA 4NYXA 4BW2A 5I86A 5DW1A 4NN2A 5I80A 2YVRA 5FE9A 5HRWA 5FE0A 4YYMA 4QEVA 3LDYA 3LJWA 5C87A 2E61A 3UVDA 4XI1A 5LJ0A 3PUQA 4O62A 5G4RA 4WHWA 5I83A 2CONA 5FE6A 5KTUA 2KIZA 4GNEA 5D1LB 4NYVA 3M62A 4OGIA 3FM8C 5EQ1A 2EA6A 1JM4B 4MEOA 3O36A 4NYWA 4OUFA 5C4QA 3DWYA 4CA1A 5D3PA 5ENJA 2B0OE 4Z1QA 5FE1A 3O37A 5DX4A 5HFRA 4Z6HA 4A9JA 5IGMA 3O35A 4O75A 4O76A 4AKGA 1WEMA 4S3OC 1E4UA 4J1PA 3JVKA 2R0YA 4YADA 4LR6A 5IGLA 2FD4A 5SVIB 4HXLA 3RTRB 4ZUXU 3RPGC 3SHBA 4LLBA 4NRCA 4QR5A 5CP5A 1ZBDB 4XUBA 3N9PA 3VKGA 2L5UA 2R10A 2KWNA 2Y43A 3T7LA 5H1VA 2RSDA 1WIMA 5L96A 4ZDTA 1WEPA 2Y1MA 4TS8A 1FBVA 5B77A 1WEEA 4QSWA 2D8UA 3VKHA 2H0DA 2JMIA 5JWMA 5CQ5A 4A9OA 3FANA 4PTBA 2DWWA 4AI6A 4FK5A 5CRMA 5F61A 5H1UA 5I7XA 5FG6A 5JG6A 1WEWA 5CTLA 4QSQA 4YABA 4XUAA 2OUOA 4J0RA 5L8TA 4CLBA 2MIQA 2RS9B 2NAAA 3U5OA 4YYIA 2YT5A 4HBXA 4R7EA 4MEPA 2I50A 3SOXA 4NQNA 4PY6A 2VJEB 4F1PA 2LSPB 4O78A 5FBXA 4BW4A 2GRCA 4NUEA 3NG2A 4LJNA 2VJFB 5CUEA 3JVMA 3LXJA 2CKLB 3DDTA 4I7DA 5F1HA 4CUPA 4KV1A 5C11A 4KCXA 2YYNA 5D26A 4A9MA 4IR3A 5C7NA 2YQMA 4NUDA 4QSVA 3L11A 2CSYA 4Z0RA 2E6RA 5KH9A 5D3SA 4LADB 3IU6A 2Y1NA 5H9MA 5CUBA 4YBSA 3SVGA 5SVXA 4ALGA 4YY4A 2KR4A 3LQIA 3H7HA 4GB0A 4QC1A 4IC2A 4LZSA 1VD4A 1ZKRA 3DPLR 2ECJA 3L1XA 4XYAA 4AKHA 5F25A 4ZC9A 4YC9A 4QSTA 5DYAA 5A5NA 4RVRA 3U5PA 1WFKA 2L7PA 4W4UA 2XB1A 1WENA 2D82A 2LN0A 4PCEA 5FDZA 3U5JA 2UZGA 4TTEA 4IORA 1EQFA 5DFDA 2EGMA 4AVXA 5EU1A 5IGKA 2RNYA 4YBTA 5II2A 5I88A 5IIDA 3U5NA 4PKLA 4TU4A 5FE8A 2BAYA 4YYDA 4TKPB 2CSVA 5FH6A 1JM7A 4UP0A 2FUUA 2LGVA 5ENEA 2C2VS 2EODA 1F62A 3G0JA 4MENA 5EPRA 2YU4A 1JOCA 5A7CA 2DATA 3ERRA 3FJUB 3P5OA 4LYSA 5EISA 5HELA 5JI8A 2L0BA 5CY9A 2QIZA 5HM0A 5AMEA 5DKHA 2MNZA 2OXQC 2MA6A 2KREA 5A5RA 3O33A 5E9KA 2VNFA 3O34A 2RI7A 2F42A 3M99A 2D8SA 4LDFA 5EGUA 5BT5A 3C5KA 4P5OB 4TQNA 3Q2FA 3O7AA 4AKIA 5F62A 5KH3A 1MM3A 4UITA 3N9MA 2YW5A 2RO1A 5KH7A 3P1EA 5EWDA 2R0VA 4OGEA 5CQ8A 5F5ZA 5D1KB 5AD3A 4MR4A 2KWKA 3MB4A 2KWOA 5FFVA 2M13A 4Q0OA 3IHPA 1N72A 1VFYA 2YURA 2L85A 4A9HA 2LXHC 2H60A 4N4IA 2PUYA 5CUDA 5LCWB 4NRBA 5CUCA 1HYIA 2M1RA 5LVRA 4IOQA 4A0CD 5IG6A 3DAIA 4H9DA 5E0RA 4NR6A 3V43A 2L80A 4V3LC 4O64A 5CQ4A 4NS5A 4CCGX 2CSZA 2JM3A 2XOYA 1F68A 4TT2A 4NR4A 4R2YA 4UIWA 4FLPA 3Q2EA 4O74A 5A5SA 4HBYA 2CT2A 3D1DA 4IR6A 4N4HA 5LKUA 5CFWA 5CS8A 4QF3A 2YSJA 1PUOA 5CGPA 5A83A 2HDPA 3QZVA 2MJVB 4LYWA 5SVIA 3LQHA 5CQ7A 4NQMA 2E3KA 3P1FA 2G43A 4A9NA 3E2DA 5EWHA 5E9VA 2MD8C 4UYHA 5HLSA 3MDBC 3U5MA 4YATA 3N9LA 5FERA 4MVTA 4IR5A 2KTBB 2KE1A 5A5PA 2ECIA 4UYDA 1V87A 3UV5A 5CUGA 4QR3A 5E9IA 4QY4A 4MR3A 2LGKA 2G6QA 4I7BA 4UP5A 5D0CA 2K16A 5E9YA 4YYHA 2IQJA 2WP2A 3HMEA 5G0FA 4N4GA 5EV9A 5HENA 2QICA 5AMFA 2FUIA 1CHCA 5DINA 5J0DA 3VK6A 4WIVA 2KKXA 2VPDA 4QUUA 2L84A 4TT6A 3GV4A 4MSXA 2LXPC 3UW9A 4PCIA 1X4IA 1Z6UA 2VJEA 4N3WA 4X2IA 5I40A 5CQTA 4OGJA 5LJ2A 5EYAF 5EP7A 2VJFA 4R8PK 2ECVA 2LGLA 2CKLA 5CPEA 5DBMA 2YEKA 3LVRE 2M85A 5FE2A 4HBVA 4QUTA 4UYEA 5ETBA 4LZRA 5FH7A 5HQ7A 2JMJA 4TZ2A 2YW8A 2VP7A 5LKXA 5D3HA 5ENHA 5TDRA 4FO9A 3T6RA 4YH3A 4TT4A 4A4BA 1WEVA 2VPEA 5F63A 4IOOA 2WP1A 3GG3A 2OWAA 5D3NA 3L1ZB 3FEHA 5FEYA 5I7YA 5EWWA 1MM2A 4ZQLA 5FH8A 1WEQA 5FB0A 2C2LA 4GPJA 4AP4A 3ZPVE 2QJ0A 5FG5A 2YUCA 3UVWA 4WA6A 3MHSA 4QEWA 4L7XA 5ENCA 2XP0A 3KV6A 3LJUX 2FFWA 4QSXA 2KWJA 4GNDA 2G4AA 3AQAA 5ENGA 5EWCA 4QF2A 5DW2A 4HXPA 4UIZA 5FFWA 2YHOA 4V3KC 4XY9A 1IYMA 5D3JA 4OGCA 2EXUA 3ZVZB 1G25A 4LZ2A 4YYKA 3MUKA 3JUEA 3KNVA 1WEOA
chains in the Genus database with same CATH topology
5E9MA 5HEMA 4YK0A 5DKDA 5A81A 4HBWA 3O70A 1Z2QA 5CQAA 4HXOA 2AN6A 2KYUA 5H1TA 1DVPA 4TU6A 5DFCA 4Z1SA 4QC3A 4UYFB 2ECNA 5KTWA 4Q0NA 4HXSA 2KU3A 4B7YC 3I2DA 2DVQA 4Z6IA 3N9QA 5HQ6A 3ZVYA 3N9NA 1WGMA 5FE4A 3UV2A 3SOUA 4B86C 2YSMA 4AYCB 4X3GA 2MA5A 1VYXA 5DYCA 4CL9A 4NR8A 4NR9A 5G4SA 4UYGA 5TB6A 2LQ6A 3M63A 2YHNA 5KO4A 4F52B 4NR5A 2RNWA 5F36A 3PHDA 2DVSA 5F2PA 2MNYA 4QR4A 4BJXA 4O70A 3AADA 4O72A 5I89A 1JSPB 5AD2A 4YY6A 4UIYA 3G0LA 4QEUA 3U5LA 5LKZA 4O71A 4WZ0A 5I3LA 5CUAA 4FIPA 3IU5A 3LQJA 4MEQA 4YYNA 5HQ5A 4S3OB 4QYDA 2ZETC 2F6NA 3HCSA 3EB5A 4BHWA 3FKMX 5BT3A 2M3HA 5EPBA 3S92A 5FE7A 5LUUA 2ECWA 5J3XA 2HYED 3RPGB 5D24A 5D3RA 2KGGA 3PURA 5COIA 4QSUA 4AKNA 5E7DA 5C8GA 4GNGA 5HFQA 5H85A 1X0JA 3MULA 3HMFA 5EM3A 5A5QA 1HYJA 4LRGA 2RFJA 3ONIA 5ENIA 4QNSA 3SVHA 1ZS5A 5E3DA 3UV4A 5B79A 4A4CA 5E9LA 1WEUA 2PNXA 4GNFA 5FFYA 4QB3A 4HXKA 5DYXA 2LRIC 4C9ZA 5TBNA 2IDAA 3N9OA 4XY8A 1WE9A 3ZPV1 4A9KA 3MHHA 4PPEA 5ETDA 3C6WA 3FL2A 5HRVA 5TABA 2DVVA 4Q6FA 3MQMA 3ZTGA 5CQ3A 5BT4A 2E6SA 2L43A 5EVAA 3UVYA 4BBQA 4IR4A 5D3LA 2YDWA 3JVJA 5L97A 5C85A 2G45A 3KV5A 3SOWA 5B75A 5DLZA 3HMHA 5KHMA 3U5KA 5EI4A 3P1CA 4BW1A 5E74A 4C67A 3ZYQA 5HJCA 5F60A 4CUUA 4CURA 5L98A 4UI9B 1WUMA 5D3TA 4UIUA 4O7BA 4O77A 4N4FA 5DYUA 4QSPA 2MD7B 4LYIA 3QZSA 4A9IA 5F1LA 3RCWA 5HCLA 4YAXA 3HCTA 2VPBA 2H0DB 4LK9A 4NR7A 4HXNA 5ENFA 5E3GA 1E6IA 4O7EA 4AUQB 4TZ8A 4NRAA 5K29A 1LDJB 4J3IA 4KV4A 2MT5A 4UIVA 5L8UA 5CZGA 5DKCA 4IC3A 5DLXA 2M6MA 4F3IA 1WESA 4Y03A 4QSSA 5IGNA 2DVRA 5TCMA 3DQVR 1FP0A 2NXBA 5CU8A 2LV9A 2N9GA 5CRZA 4CFKA 5EPSA 5L99A 3ASLA 5A82A 5D7XA 4NXJA 3NXBA 2YEMA 2YQDA 4CUTA 2ECGA 4L58A 4O7FA 5II1A 3ZYUA 4A9FA 5A85A 4CFLA 4YYJA 4ALHA 5I1QA 1WILA 3TLPA 1X4JA 4YYGA 4O7CA 4LKAA 2MUMA 5ACYA 2F6JA 4YBMA 5FB1A 5FG4A 5ENBA 2DX8A 4E96A 4O7AA 1LDKC 3GL6A 2I8NA 5CQ6A 5KU3A 5B76A 5C13A 4BW3A 5FE3A 5AITA 4YH4A 5C89A 5FE5A 4TYLA 5A5OA 4HXMA 4QYLA 4DONA 1Z60A 1XWHA 1RMDA 5LKTA 2ECTA 5EK9A 2K17A 2L5EA 1U6GB 2LGGA 4UYFA 5DKAA 2FSAA 2D9EA 2JRJA 4WHUA 2OO1A 5EICA 1T1HA 2KFTA 5IBNA 2XEUA 5LVQA 2OSSA 2YYRA 5EA1A 4WZ3B 3MB3A 3KQIA 1JM7B 5LJ1A 3S91A 4MR6A 5G04B 4AYCA 5F3AA 3SVFA 4FJCA 3ZNIA 2RNXA 3JVLA 3HTKC 5TDWA 1WUGA 5I29A 5EWVA 2LDRA 4A9EA 3HCUA 5B8DA 4QBMA 4PS5A 2VPGA 2E7OA 2K1JA 5E73A 3LRQA 5D25A 4CUQA 2YQLA 2YELA 3K2JA 5DY7A 3EB6A 4CUSA 5HRXA 4ZW1A 2R0SA 4MR5A 1BORA 3D7CA 1X4UA 4J0SA 2DKWA 1N87A 4WZ2A 4LC2A 4UIXA 5B78A 2YREA 4C66A 2EGPA 4Z93A 2E7NA 1K2FA 2K4DA 3MXFA 3UVXA 5TRBA 5D1MB 4QZSA 5G05B 4A49A 3P1DA 3QZTA 2I7KA 2JMDA 5KTXA 3I3JA 2KGIA 4HXRA 5DFBA 4I7CA 5AIUA 4A9LA 4QSRA 2L75A 4NUCA 4NYXA 4BW2A 5I86A 5DW1A 4NN2A 5I80A 5FE9A 5HRWA 5FE0A 4YYMA 4QEVA 3LJWA 5C87A 3UVDA 4XI1A 5LJ0A 3PUQA 5G4RA 4WHWA 5I83A 5FE6A 5KTUA 2KIZA 4GNEA 5D1LB 4NYVA 3M62A 4OGIA 5EQ1A 2EA6A 1JM4B 4MEOA 3O36A 4NYWA 4OUFA 5C4QA 3DWYA 4CA1A 5D3PA 5ENJA 4Z1QA 5FE1A 3O37A 5DX4A 5HFRA 4Z6HA 4A9JA 5IGMA 3O35A 4O75A 4O76A 1WEMA 4S3OC 1E4UA 4J1PA 3JVKA 2R0YA 4YADA 4LR6A 5IGLA 3RTRB 4HXLA 4ZUXU 3RPGC 3SHBA 4LLBA 4NRCA 4QR5A 5CP5A 1ZBDB 4XUBA 3N9PA 2L5UA 2R10A 2KWNA 2Y43A 3T7LA 5H1VA 2RSDA 1WIMA 5L96A 4ZDTA 1WEPA 2Y1MA 4TS8A 1FBVA 5B77A 1WEEA 4QSWA 2H0DA 2JMIA 5JWMA 5CQ5A 4A9OA 4PTBA 2DWWA 4FK5A 5CRMA 5F61A 5H1UA 5I7XA 5FG6A 5JG6A 1WEWA 5CTLA 4QSQA 4YABA 4XUAA 2OUOA 4J0RA 5L8TA 4CLBA 2MIQA 2RS9B 2NAAA 3U5OA 4YYIA 2YT5A 4HBXA 4R7EA 4MEPA 2I50A 3SOXA 4NQNA 4PY6A 2VJEB 2LSPB 4O78A 5FBXA 4BW4A 2GRCA 4NUEA 3NG2A 4LJNA 2VJFB 5CUEA 3JVMA 3LXJA 2CKLB 4I7DA 5F1HA 4CUPA 4KV1A 5C11A 4KCXA 2YYNA 5D26A 4A9MA 4IR3A 5C7NA 2YQMA 4NUDA 4QSVA 3L11A 2CSYA 5KH9A 2E6RA 5D3SA 4LADB 3IU6A 2Y1NA 5H9MA 5CUBA 4YBSA 3SVGA 4ALGA 4YY4A 2KR4A 3LQIA 4GB0A 4IC2A 4QC1A 4LZSA 1VD4A 3DPLR 2ECJA 3L1XA 4XYAA 5F25A 4ZC9A 4YC9A 4QSTA 5DYAA 5A5NA 4RVRA 3U5PA 1WFKA 4W4UA 2XB1A 1WENA 2D82A 2LN0A 4PCEA 5FDZA 3U5JA 2UZGA 4TTEA 4IORA 1EQFA 5DFDA 4AVXA 5EU1A 5IGKA 2RNYA 4YBTA 5II2A 5I88A 5IIDA 3U5NA 4PKLA 4TU4A 5FE8A 2BAYA 4YYDA 4TKPB 1JM7A 5FH6A 4UP0A 2FUUA 2LGVA 5ENEA 2C2VS 2EODA 1F62A 3G0JA 4MENA 5EPRA 2YU4A 1JOCA 5A7CA 2DATA 3P5OA 4LYSA 5EISA 5HELA 5JI8A 2L0BA 5CY9A 2QIZA 5HM0A 5AMEA 5DKHA 2MNZA 2OXQC 2MA6A 2KREA 5A5RA 3O33A 5E9KA 2VNFA 3O34A 2RI7A 2F42A 3M99A 2D8SA 4LDFA 5EGUA 5BT5A 3C5KA 4P5OB 4TQNA 3Q2FA 3O7AA 5F62A 5KH3A 1MM3A 4UITA 3N9MA 2YW5A 2RO1A 5KH7A 3P1EA 5EWDA 2R0VA 5CQ8A 5F5ZA 5D1KB 5AD3A 4MR4A 2KWKA 3MB4A 2KWOA 5FFVA 4Q0OA 3IHPA 1N72A 1VFYA 2YURA 2L85A 4A9HA 2LXHC 2H60A 4N4IA 2PUYA 5CUDA 5LCWB 4NRBA 5CUCA 1HYIA 2M1RA 5LVRA 4IOQA 4A0CD 5IG6A 3DAIA 5E0RA 4NR6A 3V43A 2L80A 4V3LC 4O64A 5CQ4A 4NS5A 4CCGX 2CSZA 1F68A 4TT2A 4NR4A 4R2YA 4UIWA 4FLPA 3Q2EA 4O74A 5A5SA 4HBYA 2CT2A 4IR6A 4N4HA 5LKUA 5CFWA 5CS8A 4QF3A 2YSJA 5CGPA 5A83A 2HDPA 3QZVA 2MJVB 4LYWA 3LQHA 5CQ7A 4NQMA 2E3KA 3P1FA 2G43A 4A9NA 5EWHA 5E9VA 2MD8C 4UYHA 5HLSA 3U5MA 4YATA 3N9LA 5FERA 4MVTA 4IR5A 2KTBB 2KE1A 5A5PA 2ECIA 4UYDA 1V87A 3UV5A 5CUGA 4QR3A 5E9IA 4QY4A 4MR3A 2LGKA 2G6QA 4I7BA 4UP5A 5D0CA 2K16A 5E9YA 4YYHA 2WP2A 3HMEA 5G0FA 4N4GA 5EV9A 5HENA 2QICA 5AMFA 2FUIA 1CHCA 5DINA 5J0DA 3VK6A 4WIVA 2VPDA 4QUUA 2L84A 4TT6A 3GV4A 4MSXA 2LXPC 3UW9A 4PCIA 1X4IA 1Z6UA 2VJEA 4N3WA 4X2IA 5I40A 5CQTA 4OGJA 5LJ2A 5EYAF 5EP7A 2VJFA 4R8PK 2ECVA 2LGLA 2CKLA 5CPEA 5DBMA 2YEKA 2M85A 5FE2A 4HBVA 4QUTA 4UYEA 5ETBA 4LZRA 5FH7A 5HQ7A 2JMJA 4TZ2A 2YW8A 2VP7A 5LKXA 5D3HA 5ENHA 5TDRA 4FO9A 3T6RA 4YH3A 4TT4A 4A4BA 1WEVA 2VPEA 5F63A 4IOOA 2WP1A 3GG3A 3L1ZB 5D3NA 5FEYA 5I7YA 5EWWA 1MM2A 4ZQLA 5FH8A 1WEQA 5FB0A 2C2LA 4GPJA 4AP4A 3ZPVE 2QJ0A 5FG5A 2YUCA 3UVWA 4WA6A 3MHSA 4QEWA 4L7XA 5ENCA 3KV6A 4GNDA 2KWJA 4QSXA 2G4AA 3AQAA 5ENGA 5EWCA 4QF2A 5DW2A 4HXPA 4UIZA 5FFWA 2YHOA 4V3KC 4XY9A 1IYMA 5D3JA 3ZVZB 1G25A 4LZ2A 4YYKA 3MUKA 3KNVA 1WEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E9M A;  5HEM A;  4YK0 A;  5DKD A;  5A81 A;  4HBW A;  3O70 A;  1Z2Q A;  5CQA A;  4HXO A;  2AN6 A;  2KYU A;  5H1T A;  1DVP A;  4TU6 A;  5DFC A;  4Z1S A;  4QC3 A;  4UYF B;  2ECN A;  5KTW A;  4Q0N A;  4HXS A;  2KU3 A;  4B7Y C;  3I2D A;  2DVQ A;  4Z6I A;  3N9Q A;  5HQ6 A;  3ZVY A;  3N9N A;  1WGM A;  5FE4 A;  3UV2 A;  3SOU A;  4B86 C;  2YSM A;  4AYC B;  4X3G A;  2MA5 A;  1VYX A;  5DYC A;  4CL9 A;  4NR8 A;  4NR9 A;  5G4S A;  4UYG A;  5TB6 A;  2LQ6 A;  3M63 A;  2YHN A;  5KO4 A;  4F52 B;  4NR5 A;  2RNW A;  5F36 A;  3PHD A;  2DVS A;  5F2P A;  2MNY A;  4QR4 A;  4BJX A;  4O70 A;  3AAD A;  4O72 A;  5I89 A;  1JSP B;  5AD2 A;  4YY6 A;  4UIY A;  3G0L A;  4QEU A;  3U5L A;  5LKZ A;  4O71 A;  4WZ0 A;  5I3L A;  5CUA A;  4FIP A;  3IU5 A;  3LQJ A;  4MEQ A;  4YYN A;  5HQ5 A;  4S3O B;  4QYD A;  2ZET C;  2F6N A;  3HCS A;  3EB5 A;  4BHW A;  3FKM X;  5BT3 A;  2M3H A;  5EPB A;  3S92 A;  5FE7 A;  5LUU A;  2ECW A;  5J3X A;  2HYE D;  3RPG B;  5D24 A;  5D3R A;  2KGG A;  3PUR A;  5COI A;  4QSU A;  4AKN A;  5E7D A;  5C8G A;  4GNG A;  5HFQ A;  5H85 A;  1X0J A;  3MUL A;  3HMF A;  5EM3 A;  5A5Q A;  1HYJ A;  4LRG A;  2RFJ A;  3ONI A;  5ENI A;  4QNS A;  3SVH A;  1ZS5 A;  5E3D A;  3UV4 A;  5B79 A;  4A4C A;  5E9L A;  1WEU A;  2PNX A;  4GNF A;  5FFY A;  4QB3 A;  4HXK A;  5DYX A;  2LRI C;  4C9Z A;  5TBN A;  2IDA A;  3N9O A;  4XY8 A;  1WE9 A;  3ZPV 1;  4A9K A;  3MHH A;  4PPE A;  5ETD A;  3C6W A;  3FL2 A;  5HRV A;  5TAB A;  2DVV A;  4Q6F A;  3MQM A;  3ZTG A;  5CQ3 A;  5BT4 A;  2E6S A;  2L43 A;  5EVA A;  3UVY A;  4BBQ A;  4IR4 A;  5D3L A;  2YDW A;  3JVJ A;  5L97 A;  5C85 A;  2G45 A;  3KV5 A;  3SOW A;  5B75 A;  5DLZ A;  3HMH A;  5KHM A;  3U5K A;  5EI4 A;  3P1C A;  4BW1 A;  5E74 A;  4C67 A;  3ZYQ A;  5HJC A;  5F60 A;  4CUU A;  4CUR A;  5L98 A;  4UI9 B;  1WUM A;  5D3T A;  4UIU A;  4O7B A;  4O77 A;  4N4F A;  5DYU A;  4QSP A;  2MD7 B;  4LYI A;  3QZS A;  4A9I A;  5F1L A;  3RCW A;  5HCL A;  4YAX A;  3HCT A;  2VPB A;  2H0D B;  4LK9 A;  4NR7 A;  4HXN A;  5ENF A;  5E3G A;  1E6I A;  4O7E A;  4AUQ B;  4TZ8 A;  4NRA A;  5K29 A;  1LDJ B;  4J3I A;  4KV4 A;  2MT5 A;  4UIV A;  5L8U A;  5CZG A;  5DKC A;  4IC3 A;  5DLX A;  2M6M A;  4F3I A;  1WES A;  4Y03 A;  4QSS A;  5IGN A;  2DVR A;  5TCM A;  3DQV R;  1FP0 A;  2NXB A;  5CU8 A;  2LV9 A;  2N9G A;  5CRZ A;  4CFK A;  5EPS A;  5L99 A;  3ASL A;  5A82 A;  5D7X A;  4NXJ A;  3NXB A;  2YEM A;  2YQD A;  4CUT A;  2ECG A;  4L58 A;  4O7F A;  5II1 A;  3ZYU A;  4A9F A;  5A85 A;  4CFL A;  4YYJ A;  4ALH A;  5I1Q A;  1WIL A;  3TLP A;  1X4J A;  4YYG A;  4O7C A;  4LKA A;  2MUM A;  5ACY A;  2F6J A;  4YBM A;  5FB1 A;  5FG4 A;  5ENB A;  2DX8 A;  4E96 A;  4O7A A;  1LDK C;  3GL6 A;  2I8N A;  5CQ6 A;  5KU3 A;  5B76 A;  5C13 A;  4BW3 A;  5FE3 A;  5AIT A;  4YH4 A;  5C89 A;  5FE5 A;  4TYL A;  5A5O A;  4HXM A;  4QYL A;  4DON A;  1Z60 A;  1XWH A;  1RMD A;  5LKT A;  2ECT A;  5EK9 A;  2K17 A;  2L5E A;  1U6G B;  2LGG A;  4UYF A;  5DKA A;  2FSA A;  2D9E A;  2JRJ A;  4WHU A;  2OO1 A;  5EIC A;  1T1H A;  2KFT A;  5IBN A;  2XEU A;  5LVQ A;  2OSS A;  2YYR A;  5EA1 A;  4WZ3 B;  3MB3 A;  3KQI A;  1JM7 B;  5LJ1 A;  3S91 A;  4MR6 A;  5G04 B;  4AYC A;  5F3A A;  3SVF A;  4FJC A;  3ZNI A;  2RNX A;  3JVL A;  3HTK C;  5TDW A;  1WUG A;  5I29 A;  5EWV A;  2LDR A;  4A9E A;  3HCU A;  5B8D A;  4QBM A;  4PS5 A;  2VPG A;  2E7O A;  2K1J A;  5E73 A;  3LRQ A;  5D25 A;  4CUQ A;  2YQL A;  2YEL A;  3K2J A;  5DY7 A;  3EB6 A;  4CUS A;  5HRX A;  4ZW1 A;  2R0S A;  4MR5 A;  1BOR A;  3D7C A;  1X4U A;  4J0S A;  2DKW A;  1N87 A;  4WZ2 A;  4LC2 A;  4UIX A;  5B78 A;  2YRE A;  4C66 A;  2EGP A;  4Z93 A;  2E7N A;  1K2F A;  2K4D A;  3MXF A;  3UVX A;  5TRB A;  5D1M B;  4QZS A;  5G05 B;  4A49 A;  3P1D A;  3QZT A;  2I7K A;  2JMD A;  5KTX A;  3I3J A;  2KGI A;  4HXR A;  5DFB A;  4I7C A;  5AIU A;  4A9L A;  4QSR A;  2L75 A;  4NUC A;  4NYX A;  4BW2 A;  5I86 A;  5DW1 A;  4NN2 A;  5I80 A;  5FE9 A;  5HRW A;  5FE0 A;  4YYM A;  4QEV A;  3LJW A;  5C87 A;  3UVD A;  4XI1 A;  5LJ0 A;  3PUQ A;  5G4R A;  4WHW A;  5I83 A;  5FE6 A;  5KTU A;  2KIZ A;  4GNE A;  5D1L B;  4NYV A;  3M62 A;  4OGI A;  5EQ1 A;  2EA6 A;  1JM4 B;  4MEO A;  3O36 A;  4NYW A;  4OUF A;  5C4Q A;  3DWY A;  4CA1 A;  5D3P A;  5ENJ A;  4Z1Q A;  5FE1 A;  3O37 A;  5DX4 A;  5HFR A;  4Z6H A;  4A9J A;  5IGM A;  3O35 A;  4O75 A;  4O76 A;  1WEM A;  4S3O C;  1E4U A;  4J1P A;  3JVK A;  2R0Y A;  4YAD A;  4LR6 A;  5IGL A;  3RTR B;  4HXL A;  4ZUX U;  3RPG C;  3SHB A;  4LLB A;  4NRC A;  4QR5 A;  5CP5 A;  1ZBD B;  4XUB A;  3N9P A;  2L5U A;  2R10 A;  2KWN A;  2Y43 A;  3T7L A;  5H1V A;  2RSD A;  1WIM A;  5L96 A;  4ZDT A;  1WEP A;  2Y1M A;  4TS8 A;  1FBV A;  5B77 A;  1WEE A;  4QSW A;  2H0D A;  2JMI A;  5JWM A;  5CQ5 A;  4A9O A;  4PTB A;  2DWW A;  4FK5 A;  5CRM A;  5F61 A;  5H1U A;  5I7X A;  5FG6 A;  5JG6 A;  1WEW A;  5CTL A;  4QSQ A;  4YAB A;  4XUA A;  2OUO A;  4J0R A;  5L8T A;  4CLB A;  2MIQ A;  2RS9 B;  2NAA A;  3U5O A;  4YYI A;  2YT5 A;  4HBX A;  4R7E A;  4MEP A;  2I50 A;  3SOX A;  4NQN A;  4PY6 A;  2VJE B;  2LSP B;  4O78 A;  5FBX A;  4BW4 A;  2GRC A;  4NUE A;  3NG2 A;  4LJN A;  2VJF B;  5CUE A;  3JVM A;  3LXJ A;  2CKL B;  4I7D A;  5F1H A;  4CUP A;  4KV1 A;  5C11 A;  4KCX A;  2YYN A;  5D26 A;  4A9M A;  4IR3 A;  5C7N A;  2YQM A;  4NUD A;  4QSV A;  3L11 A;  2CSY A;  5KH9 A;  2E6R A;  5D3S A;  4LAD B;  3IU6 A;  2Y1N A;  5H9M A;  5CUB A;  4YBS A;  3SVG A;  4ALG A;  4YY4 A;  2KR4 A;  3LQI A;  4GB0 A;  4IC2 A;  4QC1 A;  4LZS A;  1VD4 A;  3DPL R;  2ECJ A;  3L1X A;  4XYA A;  5F25 A;  4ZC9 A;  4YC9 A;  4QST A;  5DYA A;  5A5N A;  4RVR A;  3U5P A;  1WFK A;  4W4U A;  2XB1 A;  1WEN A;  2D82 A;  2LN0 A;  4PCE A;  5FDZ A;  3U5J A;  2UZG A;  4TTE A;  4IOR A;  1EQF A;  5DFD A;  4AVX A;  5EU1 A;  5IGK A;  2RNY A;  4YBT A;  5II2 A;  5I88 A;  5IID A;  3U5N A;  4PKL A;  4TU4 A;  5FE8 A;  2BAY A;  4YYD A;  4TKP B;  1JM7 A;  5FH6 A;  4UP0 A;  2FUU A;  2LGV A;  5ENE A;  2C2V S;  2EOD A;  1F62 A;  3G0J A;  4MEN A;  5EPR A;  2YU4 A;  1JOC A;  5A7C A;  2DAT A;  3P5O A;  4LYS A;  5EIS A;  5HEL A;  5JI8 A;  2L0B A;  5CY9 A;  2QIZ A;  5HM0 A;  5AME A;  5DKH A;  2MNZ A;  2OXQ C;  2MA6 A;  2KRE A;  5A5R A;  3O33 A;  5E9K A;  2VNF A;  3O34 A;  2RI7 A;  2F42 A;  3M99 A;  2D8S A;  4LDF A;  5EGU A;  5BT5 A;  3C5K A;  4P5O B;  4TQN A;  3Q2F A;  3O7A A;  5F62 A;  5KH3 A;  1MM3 A;  4UIT A;  3N9M A;  2YW5 A;  2RO1 A;  5KH7 A;  3P1E A;  5EWD A;  2R0V A;  5CQ8 A;  5F5Z A;  5D1K B;  5AD3 A;  4MR4 A;  2KWK A;  3MB4 A;  2KWO A;  5FFV A;  4Q0O A;  3IHP A;  1N72 A;  1VFY A;  2YUR A;  2L85 A;  4A9H A;  2LXH C;  2H60 A;  4N4I A;  2PUY A;  5CUD A;  5LCW B;  4NRB A;  5CUC A;  1HYI A;  2M1R A;  5LVR A;  4IOQ A;  4A0C D;  5IG6 A;  3DAI A;  5E0R A;  4NR6 A;  3V43 A;  2L80 A;  4V3L C;  4O64 A;  5CQ4 A;  4NS5 A;  4CCG X;  2CSZ A;  1F68 A;  4TT2 A;  4NR4 A;  4R2Y A;  4UIW A;  4FLP A;  3Q2E A;  4O74 A;  5A5S A;  4HBY A;  2CT2 A;  4IR6 A;  4N4H A;  5LKU A;  5CFW A;  5CS8 A;  4QF3 A;  2YSJ A;  5CGP A;  5A83 A;  2HDP A;  3QZV A;  2MJV B;  4LYW A;  3LQH A;  5CQ7 A;  4NQM A;  2E3K A;  3P1F A;  2G43 A;  4A9N A;  5EWH A;  5E9V A;  2MD8 C;  4UYH A;  5HLS A;  3U5M A;  4YAT A;  3N9L A;  5FER A;  4MVT A;  4IR5 A;  2KTB B;  2KE1 A;  5A5P A;  2ECI A;  4UYD A;  1V87 A;  3UV5 A;  5CUG A;  4QR3 A;  5E9I A;  4QY4 A;  4MR3 A;  2LGK A;  2G6Q A;  4I7B A;  4UP5 A;  5D0C A;  2K16 A;  5E9Y A;  4YYH A;  2WP2 A;  3HME A;  5G0F A;  4N4G A;  5EV9 A;  5HEN A;  2QIC A;  5AMF A;  2FUI A;  1CHC A;  5DIN A;  5J0D A;  3VK6 A;  4WIV A;  2VPD A;  4QUU A;  2L84 A;  4TT6 A;  3GV4 A;  4MSX A;  2LXP C;  3UW9 A;  4PCI A;  1X4I A;  1Z6U A;  2VJE A;  4N3W A;  4X2I A;  5I40 A;  5CQT A;  4OGJ A;  5LJ2 A;  5EYA F;  5EP7 A;  2VJF A;  4R8P K;  2ECV A;  2LGL A;  2CKL A;  5CPE A;  5DBM A;  2YEK A;  2M85 A;  5FE2 A;  4HBV A;  4QUT A;  4UYE A;  5ETB A;  4LZR A;  5FH7 A;  5HQ7 A;  2JMJ A;  4TZ2 A;  2YW8 A;  2VP7 A;  5LKX A;  5D3H A;  5ENH A;  5TDR A;  4FO9 A;  3T6R A;  4YH3 A;  4TT4 A;  4A4B A;  1WEV A;  2VPE A;  5F63 A;  4IOO A;  2WP1 A;  3GG3 A;  3L1Z B;  5D3N A;  5FEY A;  5I7Y A;  5EWW A;  1MM2 A;  4ZQL A;  5FH8 A;  1WEQ A;  5FB0 A;  2C2L A;  4GPJ A;  4AP4 A;  3ZPV E;  2QJ0 A;  5FG5 A;  2YUC A;  3UVW A;  4WA6 A;  3MHS A;  4QEW A;  4L7X A;  5ENC A;  3KV6 A;  4GND A;  2KWJ A;  4QSX A;  2G4A A;  3AQA A;  5ENG A;  5EWC A;  4QF2 A;  5DW2 A;  4HXP A;  4UIZ A;  5FFW A;  2YHO A;  4V3K C;  4XY9 A;  1IYM A;  5D3J A;  3ZVZ B;  1G25 A;  4LZ2 A;  4YYK A;  3MUK A;  3KNV A;  1WEO A; 
#chains in the Genus database with same CATH topology
 5E9M A;  5HEM A;  4YK0 A;  5DKD A;  5A81 A;  4HBW A;  3T9K A;  3O70 A;  1Z2Q A;  2CRW A;  5CQA A;  4HXO A;  2AN6 A;  2KYU A;  5H1T A;  1DVP A;  4TU6 A;  5DFC A;  4Z1S A;  4QC3 A;  4UYF B;  2ECN A;  5KTW A;  4Q0N A;  4HXS A;  2KU3 A;  4B7Y C;  3I2D A;  5K3Q A;  2DVQ A;  4Z6I A;  3N9Q A;  5HQ6 A;  3ZVY A;  3N9N A;  1WGM A;  5FE4 A;  3UV2 A;  3SOU A;  4B86 C;  2YSM A;  4AYC B;  4X3G A;  2MA5 A;  1VYX A;  5DYC A;  4CL9 A;  4NR8 A;  4NR9 A;  5G4S A;  4UYG A;  5TB6 A;  2LQ6 A;  2DSM A;  3M63 A;  2MKE A;  2YHN A;  5KO4 A;  4F52 B;  4NR5 A;  2RNW A;  5F36 A;  3PHD A;  2DVS A;  5F2P A;  2MNY A;  4QR4 A;  4BJX A;  4O70 A;  3AAD A;  4O72 A;  5I89 A;  1JSP B;  5AD2 A;  4YY6 A;  4UIY A;  3G0L A;  4QEU A;  3U5L A;  5LKZ A;  4O71 A;  4WZ0 A;  5I3L A;  5CUA A;  4FIP A;  3IU5 A;  3LQJ A;  4MEQ A;  4YYN A;  5HQ5 A;  4S3O B;  4QYD A;  2ZET C;  2F6N A;  3HCS A;  3EB5 A;  4BHW A;  3FKM X;  5BT3 A;  3O47 A;  2M3H A;  5EPB A;  3S92 A;  5FE7 A;  5LUU A;  2ECW A;  5J3X A;  2HYE D;  3RPG B;  5D24 A;  5D3R A;  2KGG A;  3PUR A;  5COI A;  4QSU A;  4AKN A;  5E7D A;  5C8G A;  4GNG A;  5HFQ A;  5H85 A;  1X0J A;  3MUL A;  3HMF A;  5EM3 A;  5A5Q A;  1HYJ A;  4LRG A;  2RFJ A;  3ONI A;  5ENI A;  4QNS A;  3SVH A;  1ZS5 A;  5E3D A;  3UV4 A;  4QQ4 A;  4A4C A;  5E9L A;  5B79 A;  1WEU A;  2PNX A;  4GNF A;  5FFY A;  4QB3 A;  4HXK A;  5DYX A;  2LRI C;  3FAO A;  4C9Z A;  2IDA A;  5TBN A;  3N9O A;  4XY8 A;  1WE9 A;  3ZPV 1;  4A9K A;  3MHH A;  4PPE A;  5ETD A;  3C6W A;  3FL2 A;  5HRV A;  5TAB A;  2DVV A;  4Q6F A;  3MQM A;  3ZTG A;  5CQ3 A;  5BT4 A;  2E6S A;  2L43 A;  5EVA A;  3UVY A;  4BBQ A;  4IR4 A;  5D3L A;  2YDW A;  3JVJ A;  5L97 A;  5C85 A;  2G45 A;  3KV5 A;  3SOW A;  5B75 A;  5DLZ A;  3HMH A;  5KHM A;  3U5K A;  5EI4 A;  3P1C A;  4BW1 A;  5E74 A;  4C67 A;  3ZYQ A;  5HJC A;  3PLW A;  5F60 A;  4CUU A;  4CUR A;  5L98 A;  3D1B A;  4UI9 B;  1WUM A;  5D3T A;  4UIU A;  4O7B A;  4O77 A;  4N4F A;  5DYU A;  4QSP A;  2LAU A;  2MD7 B;  4LYI A;  3QZS A;  4A9I A;  5F1L A;  3RCW A;  5HCL A;  4YAX A;  3HCT A;  2VPB A;  2H0D B;  4LK9 A;  4NR7 A;  4HXN A;  5ENF A;  5E3G A;  3SUB A;  1E6I A;  4O7E A;  4AUQ B;  4TZ8 A;  4NRA A;  5K29 A;  1LDJ B;  4J3I A;  4KV4 A;  2MT5 A;  4UIV A;  5L8U A;  5CZG A;  5DKC A;  4IC3 A;  5DLX A;  2M6M A;  4F3I A;  1WES A;  4Y03 A;  4QSS A;  5IGN A;  2EJN A;  3LVQ E;  2DVR A;  5TCM A;  3DQV R;  1FP0 A;  2NXB A;  5CU8 A;  2LV9 A;  2N9G A;  5CRZ A;  4CFK A;  5EPS A;  5L99 A;  3ASL A;  5A82 A;  1MBM A;  3Q1D A;  5D7X A;  4NXJ A;  3NXB A;  2YEM A;  2YQD A;  4CUT A;  2ECG A;  2RR4 A;  4L58 A;  4O7F A;  5II1 A;  3ZYU A;  4A9F A;  5A85 A;  4CFL A;  4YYJ A;  4ALH A;  5I1Q A;  1WIL A;  4Z0O A;  3TLP A;  1X4J A;  4YYG A;  4O7C A;  4LKA A;  2MUM A;  5ACY A;  2F6J A;  4YBM A;  5FB1 A;  5FG4 A;  5ENB A;  2DX8 A;  4E96 A;  4O7A A;  1LDK C;  3GL6 A;  2I8N A;  5CQ6 A;  5KU3 A;  5B76 A;  5C13 A;  4BW3 A;  5FE3 A;  2CRR A;  4YH4 A;  5C89 A;  5AIT A;  5FE5 A;  3KDE C;  4TYL A;  5A5O A;  4HXM A;  4QYL A;  4DON A;  1Z60 A;  1XWH A;  1RMD A;  5LKT A;  2ECT A;  5EK9 A;  2K17 A;  2L5E A;  1U6G B;  2LGG A;  4UYF A;  5SVY A;  5DKA A;  2FSA A;  2D9E A;  2JRJ A;  4WHU A;  2OO1 A;  5EIC A;  1T1H A;  2KFT A;  5IBN A;  2KKY A;  2XEU A;  5LVQ A;  2OSS A;  2XOC A;  2YYR A;  5EA1 A;  4WZ3 B;  3MB3 A;  3KQI A;  1JM7 B;  5LJ1 A;  3S91 A;  4MR6 A;  5G04 B;  4AYC A;  5F3A A;  3SVF A;  4FJC A;  3ZNI A;  2RNX A;  3JVL A;  3HTK C;  5TDW A;  1WUG A;  5I29 A;  5EWV A;  3M7K A;  2LDR A;  4A9E A;  3HCU A;  5B8D A;  4QBM A;  4PS5 A;  2VPG A;  2E7O A;  2K1J A;  5E73 A;  3LRQ A;  5D25 A;  4CUQ A;  2YQL A;  2YEL A;  3K2J A;  5DY7 A;  3EB6 A;  4CUS A;  5HRX A;  4ZW1 A;  2R0S A;  4MR5 A;  1BOR A;  3D7C A;  1X4U A;  4J0S A;  2DKW A;  3DWD A;  1N87 A;  4WZ2 A;  4LC2 A;  4UIX A;  5B78 A;  2YRE A;  4C66 A;  2EGP A;  4Z93 A;  2E7N A;  1K2F A;  2K4D A;  3MXF A;  3UVX A;  5TRB A;  2JUN A;  5D1M B;  4QZS A;  5G05 B;  4A49 A;  2XOZ A;  3P1D A;  3QZT A;  2I7K A;  2DJA A;  5KTX A;  2JMD A;  3I3J A;  2KGI A;  2P57 A;  4HXR A;  5DFB A;  4I7C A;  1DCQ A;  5AIU A;  4A9L A;  4QSR A;  2L75 A;  4NUC A;  4NYX A;  4BW2 A;  5I86 A;  5DW1 A;  4NN2 A;  5I80 A;  2YVR A;  5FE9 A;  5HRW A;  5FE0 A;  4YYM A;  4QEV A;  3LDY A;  3LJW A;  5C87 A;  2E61 A;  3UVD A;  4XI1 A;  5LJ0 A;  3PUQ A;  4O62 A;  5G4R A;  4WHW A;  5I83 A;  2CON A;  5FE6 A;  5KTU A;  2KIZ A;  4GNE A;  5D1L B;  4NYV A;  3M62 A;  4OGI A;  3FM8 C;  5EQ1 A;  2EA6 A;  1JM4 B;  4MEO A;  3O36 A;  4NYW A;  4OUF A;  5C4Q A;  3DWY A;  4CA1 A;  5D3P A;  5ENJ A;  2B0O E;  4Z1Q A;  5FE1 A;  3O37 A;  5DX4 A;  5HFR A;  4Z6H A;  4A9J A;  5IGM A;  3O35 A;  4O75 A;  4O76 A;  4AKG A;  1WEM A;  4S3O C;  1E4U A;  4J1P A;  3JVK A;  2R0Y A;  4YAD A;  4LR6 A;  5IGL A;  2FD4 A;  5SVI B;  4HXL A;  3RTR B;  4ZUX U;  3RPG C;  3SHB A;  4LLB A;  4NRC A;  4QR5 A;  5CP5 A;  1ZBD B;  4XUB A;  3N9P A;  3VKG A;  2L5U A;  2R10 A;  2KWN A;  2Y43 A;  3T7L A;  5H1V A;  2RSD A;  1WIM A;  5L96 A;  4ZDT A;  1WEP A;  2Y1M A;  4TS8 A;  1FBV A;  5B77 A;  1WEE A;  4QSW A;  2D8U A;  3VKH A;  2H0D A;  2JMI A;  5JWM A;  5CQ5 A;  4A9O A;  3FAN A;  4PTB A;  2DWW A;  4AI6 A;  4FK5 A;  5CRM A;  5F61 A;  5H1U A;  5I7X A;  5FG6 A;  5JG6 A;  1WEW A;  5CTL A;  4QSQ A;  4YAB A;  4XUA A;  2OUO A;  4J0R A;  5L8T A;  4CLB A;  2MIQ A;  2RS9 B;  2NAA A;  3U5O A;  4YYI A;  2YT5 A;  4HBX A;  4R7E A;  4MEP A;  2I50 A;  3SOX A;  4NQN A;  4PY6 A;  2VJE B;  4F1P A;  2LSP B;  4O78 A;  5FBX A;  4BW4 A;  2GRC A;  4NUE A;  3NG2 A;  4LJN A;  2VJF B;  5CUE A;  3JVM A;  3LXJ A;  2CKL B;  3DDT A;  4I7D A;  5F1H A;  4CUP A;  4KV1 A;  5C11 A;  4KCX A;  2YYN A;  5D26 A;  4A9M A;  4IR3 A;  5C7N A;  2YQM A;  4NUD A;  4QSV A;  3L11 A;  2CSY A;  4Z0R A;  2E6R A;  5KH9 A;  5D3S A;  4LAD B;  3IU6 A;  2Y1N A;  5H9M A;  5CUB A;  4YBS A;  3SVG A;  5SVX A;  4ALG A;  4YY4 A;  2KR4 A;  3LQI A;  3H7H A;  4GB0 A;  4QC1 A;  4IC2 A;  4LZS A;  1VD4 A;  1ZKR A;  3DPL R;  2ECJ A;  3L1X A;  4XYA A;  4AKH A;  5F25 A;  4ZC9 A;  4YC9 A;  4QST A;  5DYA A;  5A5N A;  4RVR A;  3U5P A;  1WFK A;  2L7P A;  4W4U A;  2XB1 A;  1WEN A;  2D82 A;  2LN0 A;  4PCE A;  5FDZ A;  3U5J A;  2UZG A;  4TTE A;  4IOR A;  1EQF A;  5DFD A;  2EGM A;  4AVX A;  5EU1 A;  5IGK A;  2RNY A;  4YBT A;  5II2 A;  5I88 A;  5IID A;  3U5N A;  4PKL A;  4TU4 A;  5FE8 A;  2BAY A;  4YYD A;  4TKP B;  2CSV A;  5FH6 A;  1JM7 A;  4UP0 A;  2FUU A;  2LGV A;  5ENE A;  2C2V S;  2EOD A;  1F62 A;  3G0J A;  4MEN A;  5EPR A;  2YU4 A;  1JOC A;  5A7C A;  2DAT A;  3ERR A;  3FJU B;  3P5O A;  4LYS A;  5EIS A;  5HEL A;  5JI8 A;  2L0B A;  5CY9 A;  2QIZ A;  5HM0 A;  5AME A;  5DKH A;  2MNZ A;  2OXQ C;  2MA6 A;  2KRE A;  5A5R A;  3O33 A;  5E9K A;  2VNF A;  3O34 A;  2RI7 A;  2F42 A;  3M99 A;  2D8S A;  4LDF A;  5EGU A;  5BT5 A;  3C5K A;  4P5O B;  4TQN A;  3Q2F A;  3O7A A;  4AKI A;  5F62 A;  5KH3 A;  1MM3 A;  4UIT A;  3N9M A;  2YW5 A;  2RO1 A;  5KH7 A;  3P1E A;  5EWD A;  2R0V A;  4OGE A;  5CQ8 A;  5F5Z A;  5D1K B;  5AD3 A;  4MR4 A;  2KWK A;  3MB4 A;  2KWO A;  5FFV A;  2M13 A;  4Q0O A;  3IHP A;  1N72 A;  1VFY A;  2YUR A;  2L85 A;  4A9H A;  2LXH C;  2H60 A;  4N4I A;  2PUY A;  5CUD A;  5LCW B;  4NRB A;  5CUC A;  1HYI A;  2M1R A;  5LVR A;  4IOQ A;  4A0C D;  5IG6 A;  3DAI A;  4H9D A;  5E0R A;  4NR6 A;  3V43 A;  2L80 A;  4V3L C;  4O64 A;  5CQ4 A;  4NS5 A;  4CCG X;  2CSZ A;  2JM3 A;  2XOY A;  1F68 A;  4TT2 A;  4NR4 A;  4R2Y A;  4UIW A;  4FLP A;  3Q2E A;  4O74 A;  5A5S A;  4HBY A;  2CT2 A;  3D1D A;  4IR6 A;  4N4H A;  5LKU A;  5CFW A;  5CS8 A;  4QF3 A;  2YSJ A;  1PUO A;  5CGP A;  5A83 A;  2HDP A;  3QZV A;  2MJV B;  4LYW A;  5SVI A;  3LQH A;  5CQ7 A;  4NQM A;  2E3K A;  3P1F A;  2G43 A;  4A9N A;  3E2D A;  5EWH A;  5E9V A;  2MD8 C;  4UYH A;  5HLS A;  3MDB C;  3U5M A;  4YAT A;  3N9L A;  5FER A;  4MVT A;  4IR5 A;  2KTB B;  2KE1 A;  5A5P A;  2ECI A;  4UYD A;  1V87 A;  3UV5 A;  5CUG A;  4QR3 A;  5E9I A;  4QY4 A;  4MR3 A;  2LGK A;  2G6Q A;  4I7B A;  4UP5 A;  5D0C A;  2K16 A;  5E9Y A;  4YYH A;  2IQJ A;  2WP2 A;  3HME A;  5G0F A;  4N4G A;  5EV9 A;  5HEN A;  2QIC A;  5AMF A;  2FUI A;  1CHC A;  5DIN A;  5J0D A;  3VK6 A;  4WIV A;  2KKX A;  2VPD A;  4QUU A;  2L84 A;  4TT6 A;  3GV4 A;  4MSX A;  2LXP C;  3UW9 A;  4PCI A;  1X4I A;  1Z6U A;  2VJE A;  4N3W A;  4X2I A;  5I40 A;  5CQT A;  4OGJ A;  5LJ2 A;  5EYA F;  5EP7 A;  2VJF A;  4R8P K;  2ECV A;  2LGL A;  2CKL A;  5CPE A;  5DBM A;  2YEK A;  3LVR E;  2M85 A;  5FE2 A;  4HBV A;  4QUT A;  4UYE A;  5ETB A;  4LZR A;  5FH7 A;  5HQ7 A;  2JMJ A;  4TZ2 A;  2YW8 A;  2VP7 A;  5LKX A;  5D3H A;  5ENH A;  5TDR A;  4FO9 A;  3T6R A;  4YH3 A;  4TT4 A;  4A4B A;  1WEV A;  2VPE A;  5F63 A;  4IOO A;  2WP1 A;  3GG3 A;  2OWA A;  5D3N A;  3L1Z B;  3FEH A;  5FEY A;  5I7Y A;  5EWW A;  1MM2 A;  4ZQL A;  5FH8 A;  1WEQ A;  5FB0 A;  2C2L A;  4GPJ A;  4AP4 A;  3ZPV E;  2QJ0 A;  5FG5 A;  2YUC A;  3UVW A;  4WA6 A;  3MHS A;  4QEW A;  4L7X A;  5ENC A;  2XP0 A;  3KV6 A;  3LJU X;  2FFW A;  4QSX A;  2KWJ A;  4GND A;  2G4A A;  3AQA A;  5ENG A;  5EWC A;  4QF2 A;  5DW2 A;  4HXP A;  4UIZ A;  5FFW A;  2YHO A;  4V3K C;  4XY9 A;  1IYM A;  5D3J A;  4OGC A;  2EXU A;  3ZVZ B;  1G25 A;  4LZ2 A;  4YYK A;  3MUK A;  3JUE A;  3KNV A;  1WEO A; 
#chains in the Genus database with same CATH homology
 5E9M A;  5HEM A;  4YK0 A;  5DKD A;  5A81 A;  4HBW A;  3O70 A;  1Z2Q A;  5CQA A;  4HXO A;  2AN6 A;  2KYU A;  5H1T A;  1DVP A;  4TU6 A;  5DFC A;  4Z1S A;  4QC3 A;  4UYF B;  2ECN A;  5KTW A;  4Q0N A;  4HXS A;  2KU3 A;  4B7Y C;  3I2D A;  2DVQ A;  4Z6I A;  3N9Q A;  5HQ6 A;  3ZVY A;  3N9N A;  1WGM A;  5FE4 A;  3UV2 A;  3SOU A;  4B86 C;  2YSM A;  4AYC B;  4X3G A;  2MA5 A;  1VYX A;  5DYC A;  4CL9 A;  4NR8 A;  4NR9 A;  5G4S A;  4UYG A;  5TB6 A;  2LQ6 A;  3M63 A;  2YHN A;  5KO4 A;  4F52 B;  4NR5 A;  2RNW A;  5F36 A;  3PHD A;  2DVS A;  5F2P A;  2MNY A;  4QR4 A;  4BJX A;  4O70 A;  3AAD A;  4O72 A;  5I89 A;  1JSP B;  5AD2 A;  4YY6 A;  4UIY A;  3G0L A;  4QEU A;  3U5L A;  5LKZ A;  4O71 A;  4WZ0 A;  5I3L A;  5CUA A;  4FIP A;  3IU5 A;  3LQJ A;  4MEQ A;  4YYN A;  5HQ5 A;  4S3O B;  4QYD A;  2ZET C;  2F6N A;  3HCS A;  3EB5 A;  4BHW A;  3FKM X;  5BT3 A;  2M3H A;  5EPB A;  3S92 A;  5FE7 A;  5LUU A;  2ECW A;  5J3X A;  2HYE D;  3RPG B;  5D24 A;  5D3R A;  2KGG A;  3PUR A;  5COI A;  4QSU A;  4AKN A;  5E7D A;  5C8G A;  4GNG A;  5HFQ A;  5H85 A;  1X0J A;  3MUL A;  3HMF A;  5EM3 A;  5A5Q A;  1HYJ A;  4LRG A;  2RFJ A;  3ONI A;  5ENI A;  4QNS A;  3SVH A;  1ZS5 A;  5E3D A;  3UV4 A;  5B79 A;  4A4C A;  5E9L A;  1WEU A;  2PNX A;  4GNF A;  5FFY A;  4QB3 A;  4HXK A;  5DYX A;  2LRI C;  4C9Z A;  5TBN A;  2IDA A;  3N9O A;  4XY8 A;  1WE9 A;  3ZPV 1;  4A9K A;  3MHH A;  4PPE A;  5ETD A;  3C6W A;  3FL2 A;  5HRV A;  5TAB A;  2DVV A;  4Q6F A;  3MQM A;  3ZTG A;  5CQ3 A;  5BT4 A;  2E6S A;  2L43 A;  5EVA A;  3UVY A;  4BBQ A;  4IR4 A;  5D3L A;  2YDW A;  3JVJ A;  5L97 A;  5C85 A;  2G45 A;  3KV5 A;  3SOW A;  5B75 A;  5DLZ A;  3HMH A;  5KHM A;  3U5K A;  5EI4 A;  3P1C A;  4BW1 A;  5E74 A;  4C67 A;  3ZYQ A;  5HJC A;  5F60 A;  4CUU A;  4CUR A;  5L98 A;  4UI9 B;  1WUM A;  5D3T A;  4UIU A;  4O7B A;  4O77 A;  4N4F A;  5DYU A;  4QSP A;  2MD7 B;  4LYI A;  3QZS A;  4A9I A;  5F1L A;  3RCW A;  5HCL A;  4YAX A;  3HCT A;  2VPB A;  2H0D B;  4LK9 A;  4NR7 A;  4HXN A;  5ENF A;  5E3G A;  1E6I A;  4O7E A;  4AUQ B;  4TZ8 A;  4NRA A;  5K29 A;  1LDJ B;  4J3I A;  4KV4 A;  2MT5 A;  4UIV A;  5L8U A;  5CZG A;  5DKC A;  4IC3 A;  5DLX A;  2M6M A;  4F3I A;  1WES A;  4Y03 A;  4QSS A;  5IGN A;  2DVR A;  5TCM A;  3DQV R;  1FP0 A;  2NXB A;  5CU8 A;  2LV9 A;  2N9G A;  5CRZ A;  4CFK A;  5EPS A;  5L99 A;  3ASL A;  5A82 A;  5D7X A;  4NXJ A;  3NXB A;  2YEM A;  2YQD A;  4CUT A;  2ECG A;  4L58 A;  4O7F A;  5II1 A;  3ZYU A;  4A9F A;  5A85 A;  4CFL A;  4YYJ A;  4ALH A;  5I1Q A;  1WIL A;  3TLP A;  1X4J A;  4YYG A;  4O7C A;  4LKA A;  2MUM A;  5ACY A;  2F6J A;  4YBM A;  5FB1 A;  5FG4 A;  5ENB A;  2DX8 A;  4E96 A;  4O7A A;  1LDK C;  3GL6 A;  2I8N A;  5CQ6 A;  5KU3 A;  5B76 A;  5C13 A;  4BW3 A;  5FE3 A;  5AIT A;  4YH4 A;  5C89 A;  5FE5 A;  4TYL A;  5A5O A;  4HXM A;  4QYL A;  4DON A;  1Z60 A;  1XWH A;  1RMD A;  5LKT A;  2ECT A;  5EK9 A;  2K17 A;  2L5E A;  1U6G B;  2LGG A;  4UYF A;  5DKA A;  2FSA A;  2D9E A;  2JRJ A;  4WHU A;  2OO1 A;  5EIC A;  1T1H A;  2KFT A;  5IBN A;  2XEU A;  5LVQ A;  2OSS A;  2YYR A;  5EA1 A;  4WZ3 B;  3MB3 A;  3KQI A;  1JM7 B;  5LJ1 A;  3S91 A;  4MR6 A;  5G04 B;  4AYC A;  5F3A A;  3SVF A;  4FJC A;  3ZNI A;  2RNX A;  3JVL A;  3HTK C;  5TDW A;  1WUG A;  5I29 A;  5EWV A;  2LDR A;  4A9E A;  3HCU A;  5B8D A;  4QBM A;  4PS5 A;  2VPG A;  2E7O A;  2K1J A;  5E73 A;  3LRQ A;  5D25 A;  4CUQ A;  2YQL A;  2YEL A;  3K2J A;  5DY7 A;  3EB6 A;  4CUS A;  5HRX A;  4ZW1 A;  2R0S A;  4MR5 A;  1BOR A;  3D7C A;  1X4U A;  4J0S A;  2DKW A;  1N87 A;  4WZ2 A;  4LC2 A;  4UIX A;  5B78 A;  2YRE A;  4C66 A;  2EGP A;  4Z93 A;  2E7N A;  1K2F A;  2K4D A;  3MXF A;  3UVX A;  5TRB A;  5D1M B;  4QZS A;  5G05 B;  4A49 A;  3P1D A;  3QZT A;  2I7K A;  2JMD A;  5KTX A;  3I3J A;  2KGI A;  4HXR A;  5DFB A;  4I7C A;  5AIU A;  4A9L A;  4QSR A;  2L75 A;  4NUC A;  4NYX A;  4BW2 A;  5I86 A;  5DW1 A;  4NN2 A;  5I80 A;  5FE9 A;  5HRW A;  5FE0 A;  4YYM A;  4QEV A;  3LJW A;  5C87 A;  3UVD A;  4XI1 A;  5LJ0 A;  3PUQ A;  5G4R A;  4WHW A;  5I83 A;  5FE6 A;  5KTU A;  2KIZ A;  4GNE A;  5D1L B;  4NYV A;  3M62 A;  4OGI A;  5EQ1 A;  2EA6 A;  1JM4 B;  4MEO A;  3O36 A;  4NYW A;  4OUF A;  5C4Q A;  3DWY A;  4CA1 A;  5D3P A;  5ENJ A;  4Z1Q A;  5FE1 A;  3O37 A;  5DX4 A;  5HFR A;  4Z6H A;  4A9J A;  5IGM A;  3O35 A;  4O75 A;  4O76 A;  1WEM A;  4S3O C;  1E4U A;  4J1P A;  3JVK A;  2R0Y A;  4YAD A;  4LR6 A;  5IGL A;  3RTR B;  4HXL A;  4ZUX U;  3RPG C;  3SHB A;  4LLB A;  4NRC A;  4QR5 A;  5CP5 A;  1ZBD B;  4XUB A;  3N9P A;  2L5U A;  2R10 A;  2KWN A;  2Y43 A;  3T7L A;  5H1V A;  2RSD A;  1WIM A;  5L96 A;  4ZDT A;  1WEP A;  2Y1M A;  4TS8 A;  1FBV A;  5B77 A;  1WEE A;  4QSW A;  2H0D A;  2JMI A;  5JWM A;  5CQ5 A;  4A9O A;  4PTB A;  2DWW A;  4FK5 A;  5CRM A;  5F61 A;  5H1U A;  5I7X A;  5FG6 A;  5JG6 A;  1WEW A;  5CTL A;  4QSQ A;  4YAB A;  4XUA A;  2OUO A;  4J0R A;  5L8T A;  4CLB A;  2MIQ A;  2RS9 B;  2NAA A;  3U5O A;  4YYI A;  2YT5 A;  4HBX A;  4R7E A;  4MEP A;  2I50 A;  3SOX A;  4NQN A;  4PY6 A;  2VJE B;  2LSP B;  4O78 A;  5FBX A;  4BW4 A;  2GRC A;  4NUE A;  3NG2 A;  4LJN A;  2VJF B;  5CUE A;  3JVM A;  3LXJ A;  2CKL B;  4I7D A;  5F1H A;  4CUP A;  4KV1 A;  5C11 A;  4KCX A;  2YYN A;  5D26 A;  4A9M A;  4IR3 A;  5C7N A;  2YQM A;  4NUD A;  4QSV A;  3L11 A;  2CSY A;  5KH9 A;  2E6R A;  5D3S A;  4LAD B;  3IU6 A;  2Y1N A;  5H9M A;  5CUB A;  4YBS A;  3SVG A;  4ALG A;  4YY4 A;  2KR4 A;  3LQI A;  4GB0 A;  4IC2 A;  4QC1 A;  4LZS A;  1VD4 A;  3DPL R;  2ECJ A;  3L1X A;  4XYA A;  5F25 A;  4ZC9 A;  4YC9 A;  4QST A;  5DYA A;  5A5N A;  4RVR A;  3U5P A;  1WFK A;  4W4U A;  2XB1 A;  1WEN A;  2D82 A;  2LN0 A;  4PCE A;  5FDZ A;  3U5J A;  2UZG A;  4TTE A;  4IOR A;  1EQF A;  5DFD A;  4AVX A;  5EU1 A;  5IGK A;  2RNY A;  4YBT A;  5II2 A;  5I88 A;  5IID A;  3U5N A;  4PKL A;  4TU4 A;  5FE8 A;  2BAY A;  4YYD A;  4TKP B;  1JM7 A;  5FH6 A;  4UP0 A;  2FUU A;  2LGV A;  5ENE A;  2C2V S;  2EOD A;  1F62 A;  3G0J A;  4MEN A;  5EPR A;  2YU4 A;  1JOC A;  5A7C A;  2DAT A;  3P5O A;  4LYS A;  5EIS A;  5HEL A;  5JI8 A;  2L0B A;  5CY9 A;  2QIZ A;  5HM0 A;  5AME A;  5DKH A;  2MNZ A;  2OXQ C;  2MA6 A;  2KRE A;  5A5R A;  3O33 A;  5E9K A;  2VNF A;  3O34 A;  2RI7 A;  2F42 A;  3M99 A;  2D8S A;  4LDF A;  5EGU A;  5BT5 A;  3C5K A;  4P5O B;  4TQN A;  3Q2F A;  3O7A A;  5F62 A;  5KH3 A;  1MM3 A;  4UIT A;  3N9M A;  2YW5 A;  2RO1 A;  5KH7 A;  3P1E A;  5EWD A;  2R0V A;  5CQ8 A;  5F5Z A;  5D1K B;  5AD3 A;  4MR4 A;  2KWK A;  3MB4 A;  2KWO A;  5FFV A;  4Q0O A;  3IHP A;  1N72 A;  1VFY A;  2YUR A;  2L85 A;  4A9H A;  2LXH C;  2H60 A;  4N4I A;  2PUY A;  5CUD A;  5LCW B;  4NRB A;  5CUC A;  1HYI A;  2M1R A;  5LVR A;  4IOQ A;  4A0C D;  5IG6 A;  3DAI A;  5E0R A;  4NR6 A;  3V43 A;  2L80 A;  4V3L C;  4O64 A;  5CQ4 A;  4NS5 A;  4CCG X;  2CSZ A;  1F68 A;  4TT2 A;  4NR4 A;  4R2Y A;  4UIW A;  4FLP A;  3Q2E A;  4O74 A;  5A5S A;  4HBY A;  2CT2 A;  4IR6 A;  4N4H A;  5LKU A;  5CFW A;  5CS8 A;  4QF3 A;  2YSJ A;  5CGP A;  5A83 A;  2HDP A;  3QZV A;  2MJV B;  4LYW A;  3LQH A;  5CQ7 A;  4NQM A;  2E3K A;  3P1F A;  2G43 A;  4A9N A;  5EWH A;  5E9V A;  2MD8 C;  4UYH A;  5HLS A;  3U5M A;  4YAT A;  3N9L A;  5FER A;  4MVT A;  4IR5 A;  2KTB B;  2KE1 A;  5A5P A;  2ECI A;  4UYD A;  1V87 A;  3UV5 A;  5CUG A;  4QR3 A;  5E9I A;  4QY4 A;  4MR3 A;  2LGK A;  2G6Q A;  4I7B A;  4UP5 A;  5D0C A;  2K16 A;  5E9Y A;  4YYH A;  2WP2 A;  3HME A;  5G0F A;  4N4G A;  5EV9 A;  5HEN A;  2QIC A;  5AMF A;  2FUI A;  1CHC A;  5DIN A;  5J0D A;  3VK6 A;  4WIV A;  2VPD A;  4QUU A;  2L84 A;  4TT6 A;  3GV4 A;  4MSX A;  2LXP C;  3UW9 A;  4PCI A;  1X4I A;  1Z6U A;  2VJE A;  4N3W A;  4X2I A;  5I40 A;  5CQT A;  4OGJ A;  5LJ2 A;  5EYA F;  5EP7 A;  2VJF A;  4R8P K;  2ECV A;  2LGL A;  2CKL A;  5CPE A;  5DBM A;  2YEK A;  2M85 A;  5FE2 A;  4HBV A;  4QUT A;  4UYE A;  5ETB A;  4LZR A;  5FH7 A;  5HQ7 A;  2JMJ A;  4TZ2 A;  2YW8 A;  2VP7 A;  5LKX A;  5D3H A;  5ENH A;  5TDR A;  4FO9 A;  3T6R A;  4YH3 A;  4TT4 A;  4A4B A;  1WEV A;  2VPE A;  5F63 A;  4IOO A;  2WP1 A;  3GG3 A;  3L1Z B;  5D3N A;  5FEY A;  5I7Y A;  5EWW A;  1MM2 A;  4ZQL A;  5FH8 A;  1WEQ A;  5FB0 A;  2C2L A;  4GPJ A;  4AP4 A;  3ZPV E;  2QJ0 A;  5FG5 A;  2YUC A;  3UVW A;  4WA6 A;  3MHS A;  4QEW A;  4L7X A;  5ENC A;  3KV6 A;  4GND A;  2KWJ A;  4QSX A;  2G4A A;  3AQA A;  5ENG A;  5EWC A;  4QF2 A;  5DW2 A;  4HXP A;  4UIZ A;  5FFW A;  2YHO A;  4V3K C;  4XY9 A;  1IYM A;  5D3J A;  3ZVZ B;  1G25 A;  4LZ2 A;  4YYK A;  3MUK A;  3KNV A;  1WEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...