5H1UA

Complex structure of trim24 phd-bromodomain and inhibitor 2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
180
structure length
174
Chain Sequence
b'DWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 51
structure length 174
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1uA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1uA01
3EB5A 2YSMA 2KFTA 5E7DA 5B8DA 4I7CA 5F5ZA 3SVGA 3Q2EA 4IOOA 5FE3A 4LYSA 5FFVA 5F25A 5EYAF 4IORA 5G4SA 5TCMA 5F2PA 4CUSA 2OSSA 5LCWB 4B7YC 5KH7A 4HXOA 2F6NA 4IR4A 2K17A 2KGGA 5L8UA 3P1FA 3U5NA 4PPEA 4LR6A 4R2YA 4WZ3B 1JM7B 4A49A 4QSRA 3U5OA 4F3IA 3UV4A 5E9VA 1WUMA 5A5SA 5CQ6A 2YREA 5CZGA 4NRCA 5HQ5A 3MHHA 2DVRA 2E7NA 4N4HA 4LRGA 4UIXA 2KWKA 2KR4A 4UYHA 5D7XA 4PS5A 3MQMA 5I3LA 5B75A 5ENEA 4NYWA 3UVYA 2Y1NA 3EB6A 2QIZA 4PCIA 1VD4A 5IG6A 2RNXA 2OUOA 3MULA 2KREA 2L80A 4WA6A 4O74A 5I86A 3UV2A 4NRAA 2CT2A 4ZC9A 2L75A 3S92A 2XB1A 4PKLA 4J1PA 2BAYA 4QC3A 1RMDA 2ECWA 2MA5A 2HYED 3L11A 4CFLA 4NYVA 3ONIA 2EA6A 4LDFA 5F61A 5D3PA 5HM0A 4X3GA 3L1ZB 4NUEA 5FE7A 4ZDTA 3ZTGA 5LKUA 5DLZA 2G45A 5TRBA 5LVRA 5C85A 5CGPA 4B86C 4HXKA 4AP4A 2MNYA 4HBWA 5EM3A 4QSSA 4UIVA 5D1MB 2LV9A 4FO9A 4CUUA 2F6JA 5DBMA 2VP7A 4O7AA 5ENHA 4A9EA 3N9PA 4LADB 5K29A 1WESA 5G4RA 2KTBB 5DW1A 5B79A 4MEQA 2K4DA 4ZW1A 4IR3A 2YELA 3NXBA 5HRXA 1LDJB 4AYCB 5H9MA 4LZ2A 2RNWA 3LRQA 5BT3A 4LZRA 5HJCA 5HRWA 5FG6A 1Z60A 5AMEA 5HQ6A 3HCSA 4MEPA 5C4QA 2MJVB 4YY6A 3FKMX 4YH4A 5DFCA 5FE1A 2VPBA 3HCTA 4QSUA 4OUFA 5E9IA 5FFWA 2ECNA 4LZSA 4S3OB 2KWJA 5FB0A 4WZ0A 2ECVA 4QYLA 1WGMA 1XWHA 3SOXA 3ZVYA 4BBQA 2YQMA 2RO1A 4QSPA 4LLBA 5EPRA 2ECJA 2F42A 2N9GA 3M63A 5I40A 2E7OA 5EVAA 4A9JA 3P1CA 2CKLB 2MD8C 4IC2A 5E73A 4HXSA 4YK0A 5D3NA 2G4AA 4A9IA 5CQ7A 2RI7A 4BW4A 5COIA 4FK5A 4A4CA 3O7AA 5D1KB 5TDWA 5EWWA 2M6MA 2KE1A 2KU3A 4XUAA 2KWNA 4HXMA 5CUAA 5CUCA 5II1A 5LVQA 5B77A 3UV5A 2VJEA 4O7BA 4ZUXU 4LJNA 2L85A 5CUBA 3RPGC 4C9ZA 4UI9B 2YW8A 2M3HA 5CUDA 2RFJA 3VK6A 3DAIA 5CP5A 2C2VS 4Z1SA 4YABA 4O76A 2JMJA 3QZVA 5IGNA 3K2JA 4LYIA 4QEWA 3GV4A 5A5QA 4QC1A 5FH7A 5HEMA 2ECTA 2M1RA 5L98A 2VNFA 4GNGA 4MR3A 5DKHA 4Z6HA 4KV1A 4MSXA 2PUYA 5EQ1A 4NXJA 5A5RA 1JOCA 5FH8A 2C2LA 2Y43A 5I7XA 4TTEA 3ZNIA 5H1VA 2H0DB 1WUGA 4QSQA 3U5MA 4YBMA 5EK9A 1JSPB 2KGIA 4TU6A 5B78A 2MT5A 5DKDA 5HELA 4UYFB 1WENA 2ZETC 2WP2A 5I1QA 5IGLA 5C87A 4XI1A 4XYAA 5EP7A 4S3OC 2MD7B 3C6WA 5LJ2A 1FBVA 2NAAA 3O70A 5CQ8A 2Y1MA 5HFQA 5A5PA 4QUUA 2L5EA 4YC9A 4CURA 4YYNA 1WEPA 2VJFB 5FE5A 3KQIA 3L1XA 5HRVA 2YT5A 4QEUA 2EGPA 2L5UA 2IDAA 5ENIA 4HBYA 5DKAA 2WP1A 5L8TA 5A5NA 5C8GA 5G0FA 4NR9A 4QSWA 2JRJA 3N9LA 3MB3A 2NXBA 3MB4A 5AD3A 5KO4A 1X0JA 2L84A 5H1UA 4FLPA 5CQAA 2D8SA 2AN6A 1VFYA 4CUQA 2LDRA 5H85A 2LGVA 4Q0OA 4GNEA 2ECIA 3ZPVE 4NR4A 1N72A 4XUBA 5FB1A 1BORA 5DFDA 4O78A 5ENJA 5FE0A 1WEUA 1HYJA 3DPLR 4LYWA 3KV6A 4QY4A 5CY9A 5J0DA 5FE2A 4QNSA 2EODA 3PHDA 5HFRA 3N9MA 1IYMA 5CTLA 4GNDA 5ACYA 4J0SA 4X2IA 1T1HA 2YSJA 5AITA 1X4JA 5CU8A 5D3HA 4O70A 4TT4A 4A9LA 3I3JA 5LJ1A 4I7BA 3G0JA 4W4UA 1MM2A 2MIQA 4AKNA 5EV9A 4YY4A 4F52B 2DVVA 5CUGA 2OXQC 1N87A 2LQ6A 2RSDA 3GL6A 1WEEA 4R7EA 5AD2A 5G05B 5ENCA 5CFWA 2YYNA 3QZTA 5A81A 4N4GA 4UP0A 4A0CD 4BJXA 4Z93A 3U5KA 5L99A 5E3GA 4WHWA 4E96A 2I8NA 4YYMA 2FSAA 5F62A 5FDZA 5F3AA 1X4IA 5CS8A 5JI8A 4V3KC 1WILA 4TZ2A 4QF2A 4N3WA 4CA1A 2YHOA 1F62A 3MUKA 1VYXA 5I83A 2JMDA 1HYIA 2H60A 4HXLA 4NQMA 3KNVA 2YQDA 5A7CA 1Z6UA 4O64A 2CSYA 3U5LA 4O7CA 5F36A 4HXNA 3MXFA 4O72A 4MENA 5E74A 5DFBA 3ZYUA 2YW5A 4NQNA 4PCEA 5F60A 4CUTA 2LGKA 4O7FA 2GRCA 4BW3A 3KV5A 4HBVA 4QR5A 2DVSA 5JG6A 5I7YA 5EISA 5HCLA 2RS9B 4C67A 4Q0NA 3UW9A 5EPSA 3HMFA 4ZQLA 3NG2A 5L96A 5CQ4A 4QBMA 5E9YA 1WEQA 5D3TA 5FFYA 4CLBA 5HQ7A 5D24A 5BT4A 4OGJA 4PY6A 5EA1A 4ALGA 4LK9A 4PTBA 5D1LB 2E6RA 2YUCA 5D26A 3M99A 3IU5A 4A4BA 1E6IA 4NR6A 5KTWA 2YYRA 5A83A 3I2DA 2K16A 4Y03A 5CQ3A 4UYEA 5HENA 3HTKC 5FE8A 4FIPA 5FERA 5FE4A 5E9LA 4J0RA 5IGMA 5I89A 4A9MA 4YYKA 3QZSA 2VJEB 4WHUA 5F1HA 3T7LA 2VPGA 4QZSA 5DINA 4O75A 4YYGA 2MNZA 5KTXA 3U5PA 4YATA 4Q6FA 3UVDA 3T6RA 4R8PK 1G25A 2R0VA 4CCGX 5FE6A 3DQVR 4V3LC 4LKAA 3ASLA 2PNXA 4AUQB 3GG3A 2YU4A 3LQIA 3V43A 4CL9A 5CQ5A 1WEWA 5D25A 3IU6A 5ENFA 1U6GB 2DKWA 3Q2FA 2MA6A 5AIUA 2YHNA 4UIYA 4CUPA 2H0DA 2FUIA 2R10A 2DX8A 4AVXA 4QF3A 3O34A 5EWVA 1Z2QA 3MHSA 2LGLA 4Z1QA 5I80A 4O71A 3N9OA 4UYFA 4BW2A 3O33A 5C89A 2KWOA 3O36A 2K1JA 3PURA 5ENGA 4A9FA 4Z6IA 4LC2A 5HLSA 3HCUA 4WZ2A 2KIZA 5I88A 4NN2A 4TT2A 2VJFA 3SOWA 5TBNA 3ZYQA 3JVMA 4IR5A 4YBTA 1JM7A 2I50A 4ALHA 3JVKA 4QEVA 3P1EA 3P5OA 4BHWA 2D82A 4MEOA 1JM4B 2R0YA 2CSZA 5AMFA 5DKCA 2XEUA 4YAXA 3DWYA 5A85A 3RCWA 4A9KA 4TZ8A 5H1TA 5I29A 2KYUA 2LXHC 4FJCA 4O7EA 5CRZA 3JVJA 4NYXA 5DLXA 4YH3A 4TQNA 4L58A 4J3IA 5E3DA 1MM3A 4NR8A 1E4UA 4XY9A 2YURA 5E9MA 1WFKA 5F63A 4UP5A 5ETBA 3AADA 3IHPA 4I7DA 5KH9A 2ECGA 4N4FA 2FUUA 3PUQA 2R0SA 5D3JA 3RTRB 5ETDA 3LQHA 4QUTA 3C5KA 3N9QA 4XY8A 1FP0A 5KU3A 3ZPV1 4QR3A 5F1LA 5D3SA 4YYHA 3HMHA 3U5JA 4TU4A 2LSPB 4CFKA 4KV4A 5FH6A 4UIZA 1WIMA 4MR4A 5G04B 5CRMA 1WE9A 2D9EA 5LKZA 4IC3A 4QSVA 2M85A 5BT5A 2MUMA 5II2A 4MR5A 3S91A 5D0CA 5DX4A 4HXPA 5DYCA 4A9OA 4YYDA 2LGGA 2G43A 3HMEA 1EQFA 2RNYA 4GPJA 4NUCA 3SVFA 5J3XA 4A9HA 3UVWA 2E3KA 3RPGB 4UYGA 5CPEA 5DYAA 3ZVZB 2LN0A 3O35A 5EU1A 4HXRA 5C13A 4AYCA 4OGIA 4NRBA 1ZS5A 4KCXA 5DY7A 5E0RA 3TLPA 5ENBA 3FL2A 4QSTA 1WEMA 5A82A 5JWMA 1DVPA 4QYDA 4TKPB 4MR6A 4YYIA 4WIVA 3O37A 4YADA 2E6SA 3LQJA 2YEMA 5EPBA 5IBNA 4C66A 1WEOA 4P5OB 2YQLA 4GB0A 4IOQA 2I7KA 5FE9A 5IGKA 1CHCA 1V87A 2QICA 5A5OA 2QJ0A 3SHBA 5E9KA 2YDWA 2L43A 4RVRA 5EWHA 4A9NA 4UYDA 4TS8A 4GNFA 3G0LA 3P1DA 2CKLA 3N9NA 2HDPA 4NR5A 1F68A 3LXJA 5DYUA 1ZBDB 4IR6A 4NUDA 4L7XA 5FEYA 4QB3A 2UZGA 4UIUA 4DONA 2L0BA 3LJWA 5LUUA 4QSXA 5EI4A 5TB6A 2VPEA 5KH3A 2YEKA 5LKXA 5CUEA 5KTUA 4TT6A 1WEVA 5TDRA 4UITA 5C11A 5FG4A 4UIWA 2DATA 4HBXA 4N4IA 4O77A 5D3LA 4TYLA 5CQTA 5D3RA 2JMIA 1LDKC 5KHMA 3AQAA 3UVXA 3SVHA 4YYJA 2VPDA 5FG5A 3JVLA 5TABA 3D7CA 5EICA 5EWCA 5FBXA 5LKTA 2LRIC 4MVTA 4BW1A 5C7NA 1X4UA 5EGUA 4NS5A 5L97A 5DYXA 5LJ0A 3M62A 5EWDA 2DWWA 2OO1A 5DW2A 5IIDA 2G6QA 1K2FA 4YBSA 3SOUA 2DVQA 2LXPC 5B76A 4NR7A 4QR4A
chains in the Genus database with same CATH superfamily
3EB5A 2YSMA 2KFTA 5E7DA 1MBMA 5B8DA 4I7CA 5F5ZA 3SVGA 3Q2EA 4IOOA 5FE3A 4LYSA 5FFVA 4AKIA 5F25A 2B0OE 5EYAF 4IORA 5G4SA 5TCMA 3MDBC 5F2PA 4CUSA 2OSSA 5LCWB 4B7YC 5KH7A 4HXOA 2F6NA 4IR4A 2K17A 2KGGA 5L8UA 3P1FA 3U5NA 4PPEA 4LR6A 4R2YA 4WZ3B 1JM7B 4A49A 4QSRA 3U5OA 4F3IA 3UV4A 5E9VA 1WUMA 5A5SA 5CQ6A 2YREA 5CZGA 4NRCA 5HQ5A 3DWDA 3MHHA 2JUNA 2DVRA 2E7NA 4N4HA 4LRGA 4UIXA 3JUEA 2KWKA 2KR4A 4UYHA 5D7XA 4PS5A 3MQMA 4Z0OA 5I3LA 5B75A 5ENEA 3M7KA 4NYWA 3UVYA 2Y1NA 3EB6A 2QIZA 4PCIA 1VD4A 5IG6A 2RNXA 2OUOA 3MULA 2KREA 2L80A 4WA6A 4O74A 5I86A 3UV2A 3H7HA 2IQJA 4NRAA 2CT2A 4ZC9A 2L75A 3S92A 2XB1A 4PKLA 4J1PA 2BAYA 4QC3A 1RMDA 2ECWA 2MA5A 2HYED 3L11A 4CFLA 4NYVA 3ONIA 2EA6A 4LDFA 5F61A 5D3PA 5HM0A 4X3GA 3L1ZB 4NUEA 5FE7A 4ZDTA 3ZTGA 5LKUA 5DLZA 2G45A 5TRBA 5LVRA 5C85A 5CGPA 4B86C 4HXKA 3T9KA 4AP4A 2MNYA 4HBWA 5EM3A 4QSSA 4UIVA 5D1MB 2LV9A 4FO9A 4CUUA 2F6JA 5DBMA 2VP7A 4O7AA 5ENHA 4A9EA 3N9PA 4LADB 5K29A 1WESA 5G4RA 2KTBB 5DW1A 5B79A 4MEQA 2K4DA 4ZW1A 4IR3A 2YELA 3NXBA 2CRWA 5HRXA 1LDJB 4AYCB 5H9MA 4LZ2A 2RNWA 3LRQA 5BT3A 4LZRA 5HJCA 5HRWA 5FG6A 1Z60A 5AMEA 5HQ6A 3HCSA 4MEPA 5C4QA 2MJVB 5SVIB 4YY6A 3FKMX 2DJAA 4YH4A 2EGMA 5DFCA 5FE1A 2VPBA 2P57A 3HCTA 4QSUA 4OUFA 5E9IA 5FFWA 2ECNA 4LZSA 2M13A 2KWJA 4S3OB 5FB0A 4WZ0A 2ECVA 4QYLA 1WGMA 1XWHA 3SOXA 3ZVYA 4BBQA 2YQMA 2RO1A 4QSPA 4LLBA 5EPRA 2ECJA 2F42A 2N9GA 3M63A 5I40A 4F1PA 2E7OA 5EVAA 4A9JA 3P1CA 2CKLB 2MD8C 4IC2A 5E73A 4HXSA 4YK0A 5D3NA 2G4AA 4A9IA 5CQ7A 2RI7A 4BW4A 5COIA 4FK5A 4A4CA 3O7AA 5D1KB 5TDWA 5EWWA 2M6MA 2KE1A 2KU3A 4XUAA 2KWNA 4HXMA 5CUAA 5CUCA 5II1A 5LVQA 2FD4A 5B77A 3UV5A 2VJEA 4O7BA 4ZUXU 4LJNA 2L85A 5CUBA 3RPGC 4C9ZA 4UI9B 2YW8A 2M3HA 5SVYA 5CUDA 2RFJA 3VK6A 3DAIA 5CP5A 2C2VS 4Z1SA 4YABA 4O76A 2JMJA 3QZVA 5IGNA 3K2JA 4LYIA 4QEWA 3GV4A 5A5QA 4QC1A 5FH7A 5HEMA 2ECTA 2M1RA 5L98A 2VNFA 4GNGA 4MR3A 5DKHA 1PUOA 4Z6HA 4KV1A 4MSXA 2PUYA 5EQ1A 4NXJA 5A5RA 1JOCA 5FH8A 2C2LA 2Y43A 5I7XA 4TTEA 5K3QA 3ZNIA 5H1VA 2H0DB 1WUGA 4QSQA 3U5MA 4YBMA 5EK9A 1JSPB 4AKGA 2KGIA 4TU6A 3LDYA 5B78A 2MT5A 5DKDA 5HELA 4UYFB 1WENA 2ZETC 2WP2A 5I1QA 2FFWA 5IGLA 5C87A 4XI1A 4XYAA 5EP7A 4S3OC 2MD7B 3C6WA 5LJ2A 1FBVA 2NAAA 3O70A 5CQ8A 2Y1MA 4OGEA 5HFQA 5A5PA 4QUUA 2L5EA 4YC9A 4CURA 4YYNA 1WEPA 2VJFB 5FE5A 3KQIA 3L1XA 5HRVA 2YT5A 4QEUA 2EGPA 2L5UA 2IDAA 5ENIA 4HBYA 5DKAA 2WP1A 5L8TA 5A5NA 5C8GA 3FEHA 5G0FA 4NR9A 4QSWA 2JRJA 3N9LA 3D1BA 3MB3A 2NXBA 3MB4A 5AD3A 5KO4A 1X0JA 2L84A 5H1UA 4FLPA 5CQAA 2D8SA 2AN6A 1VFYA 4CUQA 2LDRA 5H85A 2LGVA 4Q0OA 4GNEA 2RR4A 2ECIA 3ZPVE 4NR4A 1N72A 2OWAA 4XUBA 5FB1A 2XP0A 1BORA 5DFDA 4O78A 5ENJA 5FE0A 1WEUA 1HYJA 3DPLR 4LYWA 3KV6A 4QY4A 5CY9A 5J0DA 5FE2A 4QNSA 2EODA 3PHDA 5HFRA 3N9MA 1IYMA 5CTLA 4GNDA 4AI6A 5ACYA 4J0SA 4X2IA 1T1HA 3LVRE 3FJUB 2YSJA 5AITA 1X4JA 5CU8A 5D3HA 4O70A 4TT4A 4A9LA 3I3JA 5LJ1A 2D8UA 3G0JA 4I7BA 1MM2A 4O62A 2MIQA 4W4UA 4AKNA 4Z0RA 5EV9A 4YY4A 4F52B 2DVVA 5CUGA 2OXQC 1N87A 2LQ6A 2RSDA 3GL6A 1WEEA 4R7EA 5AD2A 5G05B 5ENCA 5CFWA 2YYNA 3QZTA 5A81A 4N4GA 4UP0A 4A0CD 4BJXA 4Z93A 3U5KA 5L99A 5E3GA 2JM3A 4WHWA 4E96A 2E61A 2I8NA 4YYMA 2FSAA 5F62A 5FDZA 5F3AA 4AKHA 1X4IA 5CS8A 5JI8A 3LVQE 4V3KC 1WILA 4TZ2A 4QF2A 4N3WA 4CA1A 2YHOA 1F62A 3MUKA 1VYXA 5I83A 2JMDA 1HYIA 2H60A 4HXLA 4NQMA 3KNVA 2YQDA 5A7CA 1Z6UA 4O64A 2CSYA 3E2DA 3U5LA 4O7CA 5F36A 4HXNA 3MXFA 4O72A 2KKYA 4MENA 5E74A 5DFBA 3ZYUA 2MKEA 2YW5A 4NQNA 4PCEA 5F60A 4CUTA 2LGKA 4O7FA 2GRCA 4BW3A 3KV5A 4HBVA 4QR5A 2DVSA 5JG6A 5I7YA 5EISA 5HCLA 2RS9B 4C67A 4Q0NA 3UW9A 5EPSA 3HMFA 4ZQLA 3NG2A 5L96A 5CQ4A 4QBMA 5E9YA 1WEQA 5D3TA 5FFYA 4CLBA 5HQ7A 5D24A 3FAOA 5BT4A 4OGJA 4PY6A 5EA1A 4ALGA 4LK9A 4PTBA 5D1LB 2E6RA 2YUCA 5D26A 3M99A 3IU5A 4A4BA 1E6IA 4NR6A 5KTWA 2YYRA 5A83A 3I2DA 2K16A 4Y03A 5CQ3A 4UYEA 5HENA 3HTKC 5FE8A 4FIPA 5FERA 5FE4A 5E9LA 4J0RA 5IGMA 5I89A 4A9MA 2EXUA 4YYKA 3FANA 3QZSA 2VJEB 4WHUA 5F1HA 3T7LA 2VPGA 4QZSA 5DINA 4O75A 4YYGA 2MNZA 5KTXA 3U5PA 4YATA 4Q6FA 3UVDA 3T6RA 4R8PK 2KKXA 1G25A 2R0VA 4CCGX 5FE6A 3DQVR 4V3LC 4LKAA 3ASLA 2PNXA 4AUQB 4QQ4A 3GG3A 2YU4A 3LQIA 3V43A 4CL9A 5CQ5A 1WEWA 5D25A 3IU6A 5ENFA 1U6GB 2DKWA 3Q2FA 3DDTA 2MA6A 5AIUA 2YHNA 4UIYA 4CUPA 2H0DA 2FUIA 2R10A 2DSMA 2DX8A 4AVXA 4QF3A 3O34A 5EWVA 1Z2QA 3MHSA 2LGLA 2L7PA 4Z1QA 5I80A 4O71A 3N9OA 4UYFA 4BW2A 3O33A 5C89A 2KWOA 3O36A 2K1JA 3PURA 5ENGA 4A9FA 4Z6IA 4LC2A 5HLSA 3HCUA 4WZ2A 2KIZA 5I88A 4NN2A 4TT2A 2VJFA 3SOWA 5TBNA 3ZYQA 3JVMA 4IR5A 4YBTA 1JM7A 2I50A 4ALHA 3JVKA 4QEVA 3P1EA 3P5OA 4BHWA 2D82A 4MEOA 1JM4B 2R0YA 2CSZA 5AMFA 5DKCA 2XEUA 4YAXA 3DWYA 5A85A 3RCWA 4A9KA 4TZ8A 5H1TA 5I29A 2KYUA 2LXHC 4FJCA 4O7EA 5CRZA 3JVJA 4NYXA 5DLXA 4YH3A 4TQNA 4L58A 4J3IA 5E3DA 1MM3A 4NR8A 1E4UA 4XY9A 2YURA 3LJUX 5E9MA 1WFKA 5F63A 4UP5A 5ETBA 3AADA 3IHPA 4I7DA 5KH9A 2XOYA 2ECGA 4N4FA 2FUUA 3PUQA 1ZKRA 2R0SA 5D3JA 3RTRB 5ETDA 3LQHA 4QUTA 3C5KA 3N9QA 2EJNA 4XY8A 1FP0A 2CONA 5KU3A 3ZPV1 4QR3A 5F1LA 5D3SA 4YYHA 3HMHA 3U5JA 4TU4A 2LSPB 4CFKA 4KV4A 2CRRA 5FH6A 4UIZA 1WIMA 4MR4A 1DCQA 5G04B 5CRMA 1WE9A 2D9EA 5LKZA 4IC3A 4QSVA 3SUBA 2M85A 5BT5A 2MUMA 3D1DA 4MR5A 5II2A 3S91A 5D0CA 5DX4A 4HXPA 5DYCA 4A9OA 4YYDA 2LGGA 2G43A 3HMEA 1EQFA 2RNYA 4GPJA 4NUCA 3SVFA 5J3XA 4A9HA 4H9DA 3UVWA 2E3KA 3RPGB 4UYGA 2XOZA 5CPEA 5DYAA 3ZVZB 2LN0A 3O35A 5EU1A 4HXRA 3FM8C 4AYCA 5C13A 4OGIA 4NRBA 1ZS5A 4KCXA 5DY7A 5E0RA 3TLPA 5ENBA 3FL2A 4QSTA 1WEMA 5A82A 5JWMA 5SVIA 1DVPA 4QYDA 4TKPB 4MR6A 4YYIA 4WIVA 3O37A 2LAUA 4YADA 2E6SA 2XOCA 3LQJA 2YEMA 5EPBA 5IBNA 4C66A 1WEOA 4P5OB 2YQLA 4GB0A 4IOQA 2I7KA 5FE9A 5IGKA 1CHCA 1V87A 2CSVA 2QICA 5A5OA 2QJ0A 3SHBA 5E9KA 2YDWA 2L43A 4RVRA 3VKGA 5EWHA 4A9NA 4UYDA 3O47A 4TS8A 4GNFA 3G0LA 3P1DA 2CKLA 3N9NA 2HDPA 4NR5A 1F68A 3LXJA 5DYUA 3VKHA 1ZBDB 4IR6A 4NUDA 4L7XA 5FEYA 4QB3A 2UZGA 4UIUA 3PLWA 4DONA 2L0BA 3LJWA 5LUUA 4QSXA 3ERRA 5EI4A 5TB6A 2VPEA 5KH3A 2YEKA 5LKXA 5CUEA 5KTUA 4TT6A 1WEVA 5TDRA 4UITA 5C11A 5FG4A 4UIWA 5SVXA 2DATA 4HBXA 4N4IA 4O77A 5D3LA 4TYLA 5CQTA 5D3RA 2JMIA 1LDKC 5KHMA 3AQAA 3UVXA 3SVHA 4YYJA 2VPDA 5FG5A 3Q1DA 3JVLA 5TABA 3D7CA 5EICA 5EWCA 5FBXA 5LKTA 2LRIC 4MVTA 4BW1A 5C7NA 1X4UA 5EGUA 4NS5A 5L97A 5DYXA 5LJ0A 3M62A 4OGCA 5EWDA 2DWWA 2OO1A 5DW2A 5IIDA 2G6QA 1K2FA 2YVRA 3KDEC 4YBSA 3SOUA 2DVQA 2LXPC 5B76A 4NR7A 4QR4A
chains in the Genus database with same CATH topology
3EB5A 2YSMA 2KFTA 5E7DA 5B8DA 4I7CA 5F5ZA 3SVGA 3Q2EA 4IOOA 5FE3A 4LYSA 5FFVA 5F25A 5EYAF 4IORA 5G4SA 5TCMA 5F2PA 4CUSA 2OSSA 5LCWB 4B7YC 5KH7A 4HXOA 2F6NA 4IR4A 2K17A 2KGGA 5L8UA 3P1FA 3U5NA 4PPEA 4LR6A 4R2YA 4WZ3B 1JM7B 4A49A 4QSRA 3U5OA 4F3IA 3UV4A 5E9VA 1WUMA 5A5SA 5CQ6A 2YREA 5CZGA 4NRCA 5HQ5A 3MHHA 2DVRA 2E7NA 4N4HA 4LRGA 4UIXA 2KWKA 2KR4A 4UYHA 5D7XA 4PS5A 3MQMA 5I3LA 5B75A 5ENEA 4NYWA 3UVYA 2Y1NA 3EB6A 2QIZA 4PCIA 1VD4A 5IG6A 2RNXA 2OUOA 3MULA 2KREA 2L80A 4WA6A 4O74A 5I86A 3UV2A 4NRAA 2CT2A 4ZC9A 2L75A 3S92A 2XB1A 4PKLA 4J1PA 2BAYA 4QC3A 1RMDA 2ECWA 2MA5A 2HYED 3L11A 4CFLA 4NYVA 3ONIA 2EA6A 4LDFA 5F61A 5D3PA 5HM0A 4X3GA 3L1ZB 4NUEA 5FE7A 4ZDTA 3ZTGA 5LKUA 5DLZA 2G45A 5TRBA 5LVRA 5C85A 5CGPA 4B86C 4HXKA 4AP4A 2MNYA 4HBWA 5EM3A 4QSSA 4UIVA 5D1MB 2LV9A 4FO9A 4CUUA 2F6JA 5DBMA 2VP7A 4O7AA 5ENHA 4A9EA 3N9PA 4LADB 5K29A 1WESA 5G4RA 2KTBB 5DW1A 5B79A 4MEQA 2K4DA 4ZW1A 4IR3A 2YELA 3NXBA 5HRXA 1LDJB 4AYCB 5H9MA 4LZ2A 2RNWA 3LRQA 5BT3A 4LZRA 5HJCA 5HRWA 5FG6A 1Z60A 5AMEA 5HQ6A 3HCSA 4MEPA 5C4QA 2MJVB 4YY6A 3FKMX 4YH4A 5DFCA 5FE1A 2VPBA 3HCTA 4QSUA 4OUFA 5E9IA 5FFWA 2ECNA 4LZSA 4S3OB 2KWJA 5FB0A 4WZ0A 2ECVA 4QYLA 1WGMA 1XWHA 3SOXA 3ZVYA 4BBQA 2YQMA 2RO1A 4QSPA 4LLBA 5EPRA 2ECJA 2F42A 2N9GA 3M63A 5I40A 2E7OA 5EVAA 4A9JA 3P1CA 2CKLB 2MD8C 4IC2A 5E73A 4HXSA 4YK0A 5D3NA 2G4AA 4A9IA 5CQ7A 2RI7A 4BW4A 5COIA 4FK5A 4A4CA 3O7AA 5D1KB 5TDWA 5EWWA 2M6MA 2KE1A 2KU3A 4XUAA 2KWNA 4HXMA 5CUAA 5CUCA 5II1A 5LVQA 5B77A 3UV5A 2VJEA 4O7BA 4ZUXU 4LJNA 2L85A 5CUBA 3RPGC 4C9ZA 4UI9B 2YW8A 2M3HA 5CUDA 2RFJA 3VK6A 3DAIA 5CP5A 2C2VS 4Z1SA 4YABA 4O76A 2JMJA 3QZVA 5IGNA 3K2JA 4LYIA 4QEWA 3GV4A 5A5QA 4QC1A 5FH7A 5HEMA 2ECTA 2M1RA 5L98A 2VNFA 4GNGA 4MR3A 5DKHA 4Z6HA 4KV1A 4MSXA 2PUYA 5EQ1A 4NXJA 5A5RA 1JOCA 5FH8A 2C2LA 2Y43A 5I7XA 4TTEA 3ZNIA 5H1VA 2H0DB 1WUGA 4QSQA 3U5MA 4YBMA 5EK9A 1JSPB 2KGIA 4TU6A 5B78A 2MT5A 5DKDA 5HELA 4UYFB 1WENA 2ZETC 2WP2A 5I1QA 5IGLA 5C87A 4XI1A 4XYAA 5EP7A 4S3OC 2MD7B 3C6WA 5LJ2A 1FBVA 2NAAA 3O70A 5CQ8A 2Y1MA 5HFQA 5A5PA 4QUUA 2L5EA 4YC9A 4CURA 4YYNA 1WEPA 2VJFB 5FE5A 3KQIA 3L1XA 5HRVA 2YT5A 4QEUA 2EGPA 2L5UA 2IDAA 5ENIA 4HBYA 5DKAA 2WP1A 5L8TA 5A5NA 5C8GA 5G0FA 4NR9A 4QSWA 2JRJA 3N9LA 3MB3A 2NXBA 3MB4A 5AD3A 5KO4A 1X0JA 2L84A 5H1UA 4FLPA 5CQAA 2D8SA 2AN6A 1VFYA 4CUQA 2LDRA 5H85A 2LGVA 4Q0OA 4GNEA 2ECIA 3ZPVE 4NR4A 1N72A 4XUBA 5FB1A 1BORA 5DFDA 4O78A 5ENJA 5FE0A 1WEUA 1HYJA 3DPLR 4LYWA 3KV6A 4QY4A 5CY9A 5J0DA 5FE2A 4QNSA 2EODA 3PHDA 5HFRA 3N9MA 1IYMA 5CTLA 4GNDA 5ACYA 4J0SA 4X2IA 1T1HA 2YSJA 5AITA 1X4JA 5CU8A 5D3HA 4O70A 4TT4A 4A9LA 3I3JA 5LJ1A 4I7BA 3G0JA 4W4UA 1MM2A 2MIQA 4AKNA 5EV9A 4YY4A 4F52B 2DVVA 5CUGA 2OXQC 1N87A 2LQ6A 2RSDA 3GL6A 1WEEA 4R7EA 5AD2A 5G05B 5ENCA 5CFWA 2YYNA 3QZTA 5A81A 4N4GA 4UP0A 4A0CD 4BJXA 4Z93A 3U5KA 5L99A 5E3GA 4WHWA 4E96A 2I8NA 4YYMA 2FSAA 5F62A 5FDZA 5F3AA 1X4IA 5CS8A 5JI8A 4V3KC 1WILA 4TZ2A 4QF2A 4N3WA 4CA1A 2YHOA 1F62A 3MUKA 1VYXA 5I83A 2JMDA 1HYIA 2H60A 4HXLA 4NQMA 3KNVA 2YQDA 5A7CA 1Z6UA 4O64A 2CSYA 3U5LA 4O7CA 5F36A 4HXNA 3MXFA 4O72A 4MENA 5E74A 5DFBA 3ZYUA 2YW5A 4NQNA 4PCEA 5F60A 4CUTA 2LGKA 4O7FA 2GRCA 4BW3A 3KV5A 4HBVA 4QR5A 2DVSA 5JG6A 5I7YA 5EISA 5HCLA 2RS9B 4C67A 4Q0NA 3UW9A 5EPSA 3HMFA 4ZQLA 3NG2A 5L96A 5CQ4A 4QBMA 5E9YA 1WEQA 5D3TA 5FFYA 4CLBA 5HQ7A 5D24A 5BT4A 4OGJA 4PY6A 5EA1A 4ALGA 4LK9A 4PTBA 5D1LB 2E6RA 2YUCA 5D26A 3M99A 3IU5A 4A4BA 1E6IA 4NR6A 5KTWA 2YYRA 5A83A 3I2DA 2K16A 4Y03A 5CQ3A 4UYEA 5HENA 3HTKC 5FE8A 4FIPA 5FERA 5FE4A 5E9LA 4J0RA 5IGMA 5I89A 4A9MA 4YYKA 3QZSA 2VJEB 4WHUA 5F1HA 3T7LA 2VPGA 4QZSA 5DINA 4O75A 4YYGA 2MNZA 5KTXA 3U5PA 4YATA 4Q6FA 3UVDA 3T6RA 4R8PK 1G25A 2R0VA 4CCGX 5FE6A 3DQVR 4V3LC 4LKAA 3ASLA 2PNXA 4AUQB 3GG3A 2YU4A 3LQIA 3V43A 4CL9A 5CQ5A 1WEWA 5D25A 3IU6A 5ENFA 1U6GB 2DKWA 3Q2FA 2MA6A 5AIUA 2YHNA 4UIYA 4CUPA 2H0DA 2FUIA 2R10A 2DX8A 4AVXA 4QF3A 3O34A 5EWVA 1Z2QA 3MHSA 2LGLA 4Z1QA 5I80A 4O71A 3N9OA 4UYFA 4BW2A 3O33A 5C89A 2KWOA 3O36A 2K1JA 3PURA 5ENGA 4A9FA 4Z6IA 4LC2A 5HLSA 3HCUA 4WZ2A 2KIZA 5I88A 4NN2A 4TT2A 2VJFA 3SOWA 5TBNA 3ZYQA 3JVMA 4IR5A 4YBTA 1JM7A 2I50A 4ALHA 3JVKA 4QEVA 3P1EA 3P5OA 4BHWA 2D82A 4MEOA 1JM4B 2R0YA 2CSZA 5AMFA 5DKCA 2XEUA 4YAXA 3DWYA 5A85A 3RCWA 4A9KA 4TZ8A 5H1TA 5I29A 2KYUA 2LXHC 4FJCA 4O7EA 5CRZA 3JVJA 4NYXA 5DLXA 4YH3A 4TQNA 4L58A 4J3IA 5E3DA 1MM3A 4NR8A 1E4UA 4XY9A 2YURA 5E9MA 1WFKA 5F63A 4UP5A 5ETBA 3AADA 3IHPA 4I7DA 5KH9A 2ECGA 4N4FA 2FUUA 3PUQA 2R0SA 5D3JA 3RTRB 5ETDA 3LQHA 4QUTA 3C5KA 3N9QA 4XY8A 1FP0A 5KU3A 3ZPV1 4QR3A 5F1LA 5D3SA 4YYHA 3HMHA 3U5JA 4TU4A 2LSPB 4CFKA 4KV4A 5FH6A 4UIZA 1WIMA 4MR4A 5G04B 5CRMA 1WE9A 2D9EA 5LKZA 4IC3A 4QSVA 2M85A 5BT5A 2MUMA 5II2A 4MR5A 3S91A 5D0CA 5DX4A 4HXPA 5DYCA 4A9OA 4YYDA 2LGGA 2G43A 3HMEA 1EQFA 2RNYA 4GPJA 4NUCA 3SVFA 5J3XA 4A9HA 3UVWA 2E3KA 3RPGB 4UYGA 5CPEA 5DYAA 3ZVZB 2LN0A 3O35A 5EU1A 4HXRA 5C13A 4AYCA 4OGIA 4NRBA 1ZS5A 4KCXA 5DY7A 5E0RA 3TLPA 5ENBA 3FL2A 4QSTA 1WEMA 5A82A 5JWMA 1DVPA 4QYDA 4TKPB 4MR6A 4YYIA 4WIVA 3O37A 4YADA 2E6SA 3LQJA 2YEMA 5EPBA 5IBNA 4C66A 1WEOA 4P5OB 2YQLA 4GB0A 4IOQA 2I7KA 5FE9A 5IGKA 1CHCA 1V87A 2QICA 5A5OA 2QJ0A 3SHBA 5E9KA 2YDWA 2L43A 4RVRA 5EWHA 4A9NA 4UYDA 4TS8A 4GNFA 3G0LA 3P1DA 2CKLA 3N9NA 2HDPA 4NR5A 1F68A 3LXJA 5DYUA 1ZBDB 4IR6A 4NUDA 4L7XA 5FEYA 4QB3A 2UZGA 4UIUA 4DONA 2L0BA 3LJWA 5LUUA 4QSXA 5EI4A 5TB6A 2VPEA 5KH3A 2YEKA 5LKXA 5CUEA 5KTUA 4TT6A 1WEVA 5TDRA 4UITA 5C11A 5FG4A 4UIWA 2DATA 4HBXA 4N4IA 4O77A 5D3LA 4TYLA 5CQTA 5D3RA 2JMIA 1LDKC 5KHMA 3AQAA 3UVXA 3SVHA 4YYJA 2VPDA 5FG5A 3JVLA 5TABA 3D7CA 5EICA 5EWCA 5FBXA 5LKTA 2LRIC 4MVTA 4BW1A 5C7NA 1X4UA 5EGUA 4NS5A 5L97A 5DYXA 5LJ0A 3M62A 5EWDA 2DWWA 2OO1A 5DW2A 5IIDA 2G6QA 1K2FA 4YBSA 3SOUA 2DVQA 2LXPC 5B76A 4NR7A 4QR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EB5 A;  2YSM A;  2KFT A;  5E7D A;  5B8D A;  4I7C A;  5F5Z A;  3SVG A;  3Q2E A;  4IOO A;  5FE3 A;  4LYS A;  5FFV A;  5F25 A;  5EYA F;  4IOR A;  5G4S A;  5TCM A;  5F2P A;  4CUS A;  2OSS A;  5LCW B;  4B7Y C;  5KH7 A;  4HXO A;  2F6N A;  4IR4 A;  2K17 A;  2KGG A;  5L8U A;  3P1F A;  3U5N A;  4PPE A;  4LR6 A;  4R2Y A;  4WZ3 B;  1JM7 B;  4A49 A;  4QSR A;  3U5O A;  4F3I A;  3UV4 A;  5E9V A;  1WUM A;  5A5S A;  5CQ6 A;  2YRE A;  5CZG A;  4NRC A;  5HQ5 A;  3MHH A;  2DVR A;  2E7N A;  4N4H A;  4LRG A;  4UIX A;  2KWK A;  2KR4 A;  4UYH A;  5D7X A;  4PS5 A;  3MQM A;  5I3L A;  5B75 A;  5ENE A;  4NYW A;  3UVY A;  2Y1N A;  3EB6 A;  2QIZ A;  4PCI A;  1VD4 A;  5IG6 A;  2RNX A;  2OUO A;  3MUL A;  2KRE A;  2L80 A;  4WA6 A;  4O74 A;  5I86 A;  3UV2 A;  4NRA A;  2CT2 A;  4ZC9 A;  2L75 A;  3S92 A;  2XB1 A;  4PKL A;  4J1P A;  2BAY A;  4QC3 A;  1RMD A;  2ECW A;  2MA5 A;  2HYE D;  3L11 A;  4CFL A;  4NYV A;  3ONI A;  2EA6 A;  4LDF A;  5F61 A;  5D3P A;  5HM0 A;  4X3G A;  3L1Z B;  4NUE A;  5FE7 A;  4ZDT A;  3ZTG A;  5LKU A;  5DLZ A;  2G45 A;  5TRB A;  5LVR A;  5C85 A;  5CGP A;  4B86 C;  4HXK A;  4AP4 A;  2MNY A;  4HBW A;  5EM3 A;  4QSS A;  4UIV A;  5D1M B;  2LV9 A;  4FO9 A;  4CUU A;  2F6J A;  5DBM A;  2VP7 A;  4O7A A;  5ENH A;  4A9E A;  3N9P A;  4LAD B;  5K29 A;  1WES A;  5G4R A;  2KTB B;  5DW1 A;  5B79 A;  4MEQ A;  2K4D A;  4ZW1 A;  4IR3 A;  2YEL A;  3NXB A;  5HRX A;  1LDJ B;  4AYC B;  5H9M A;  4LZ2 A;  2RNW A;  3LRQ A;  5BT3 A;  4LZR A;  5HJC A;  5HRW A;  5FG6 A;  1Z60 A;  5AME A;  5HQ6 A;  3HCS A;  4MEP A;  5C4Q A;  2MJV B;  4YY6 A;  3FKM X;  4YH4 A;  5DFC A;  5FE1 A;  2VPB A;  3HCT A;  4QSU A;  4OUF A;  5E9I A;  5FFW A;  2ECN A;  4LZS A;  4S3O B;  2KWJ A;  5FB0 A;  4WZ0 A;  2ECV A;  4QYL A;  1WGM A;  1XWH A;  3SOX A;  3ZVY A;  4BBQ A;  2YQM A;  2RO1 A;  4QSP A;  4LLB A;  5EPR A;  2ECJ A;  2F42 A;  2N9G A;  3M63 A;  5I40 A;  2E7O A;  5EVA A;  4A9J A;  3P1C A;  2CKL B;  2MD8 C;  4IC2 A;  5E73 A;  4HXS A;  4YK0 A;  5D3N A;  2G4A A;  4A9I A;  5CQ7 A;  2RI7 A;  4BW4 A;  5COI A;  4FK5 A;  4A4C A;  3O7A A;  5D1K B;  5TDW A;  5EWW A;  2M6M A;  2KE1 A;  2KU3 A;  4XUA A;  2KWN A;  4HXM A;  5CUA A;  5CUC A;  5II1 A;  5LVQ A;  5B77 A;  3UV5 A;  2VJE A;  4O7B A;  4ZUX U;  4LJN A;  2L85 A;  5CUB A;  3RPG C;  4C9Z A;  4UI9 B;  2YW8 A;  2M3H A;  5CUD A;  2RFJ A;  3VK6 A;  3DAI A;  5CP5 A;  2C2V S;  4Z1S A;  4YAB A;  4O76 A;  2JMJ A;  3QZV A;  5IGN A;  3K2J A;  4LYI A;  4QEW A;  3GV4 A;  5A5Q A;  4QC1 A;  5FH7 A;  5HEM A;  2ECT A;  2M1R A;  5L98 A;  2VNF A;  4GNG A;  4MR3 A;  5DKH A;  4Z6H A;  4KV1 A;  4MSX A;  2PUY A;  5EQ1 A;  4NXJ A;  5A5R A;  1JOC A;  5FH8 A;  2C2L A;  2Y43 A;  5I7X A;  4TTE A;  3ZNI A;  5H1V A;  2H0D B;  1WUG A;  4QSQ A;  3U5M A;  4YBM A;  5EK9 A;  1JSP B;  2KGI A;  4TU6 A;  5B78 A;  2MT5 A;  5DKD A;  5HEL A;  4UYF B;  1WEN A;  2ZET C;  2WP2 A;  5I1Q A;  5IGL A;  5C87 A;  4XI1 A;  4XYA A;  5EP7 A;  4S3O C;  2MD7 B;  3C6W A;  5LJ2 A;  1FBV A;  2NAA A;  3O70 A;  5CQ8 A;  2Y1M A;  5HFQ A;  5A5P A;  4QUU A;  2L5E A;  4YC9 A;  4CUR A;  4YYN A;  1WEP A;  2VJF B;  5FE5 A;  3KQI A;  3L1X A;  5HRV A;  2YT5 A;  4QEU A;  2EGP A;  2L5U A;  2IDA A;  5ENI A;  4HBY A;  5DKA A;  2WP1 A;  5L8T A;  5A5N A;  5C8G A;  5G0F A;  4NR9 A;  4QSW A;  2JRJ A;  3N9L A;  3MB3 A;  2NXB A;  3MB4 A;  5AD3 A;  5KO4 A;  1X0J A;  2L84 A;  5H1U A;  4FLP A;  5CQA A;  2D8S A;  2AN6 A;  1VFY A;  4CUQ A;  2LDR A;  5H85 A;  2LGV A;  4Q0O A;  4GNE A;  2ECI A;  3ZPV E;  4NR4 A;  1N72 A;  4XUB A;  5FB1 A;  1BOR A;  5DFD A;  4O78 A;  5ENJ A;  5FE0 A;  1WEU A;  1HYJ A;  3DPL R;  4LYW A;  3KV6 A;  4QY4 A;  5CY9 A;  5J0D A;  5FE2 A;  4QNS A;  2EOD A;  3PHD A;  5HFR A;  3N9M A;  1IYM A;  5CTL A;  4GND A;  5ACY A;  4J0S A;  4X2I A;  1T1H A;  2YSJ A;  5AIT A;  1X4J A;  5CU8 A;  5D3H A;  4O70 A;  4TT4 A;  4A9L A;  3I3J A;  5LJ1 A;  4I7B A;  3G0J A;  4W4U A;  1MM2 A;  2MIQ A;  4AKN A;  5EV9 A;  4YY4 A;  4F52 B;  2DVV A;  5CUG A;  2OXQ C;  1N87 A;  2LQ6 A;  2RSD A;  3GL6 A;  1WEE A;  4R7E A;  5AD2 A;  5G05 B;  5ENC A;  5CFW A;  2YYN A;  3QZT A;  5A81 A;  4N4G A;  4UP0 A;  4A0C D;  4BJX A;  4Z93 A;  3U5K A;  5L99 A;  5E3G A;  4WHW A;  4E96 A;  2I8N A;  4YYM A;  2FSA A;  5F62 A;  5FDZ A;  5F3A A;  1X4I A;  5CS8 A;  5JI8 A;  4V3K C;  1WIL A;  4TZ2 A;  4QF2 A;  4N3W A;  4CA1 A;  2YHO A;  1F62 A;  3MUK A;  1VYX A;  5I83 A;  2JMD A;  1HYI A;  2H60 A;  4HXL A;  4NQM A;  3KNV A;  2YQD A;  5A7C A;  1Z6U A;  4O64 A;  2CSY A;  3U5L A;  4O7C A;  5F36 A;  4HXN A;  3MXF A;  4O72 A;  4MEN A;  5E74 A;  5DFB A;  3ZYU A;  2YW5 A;  4NQN A;  4PCE A;  5F60 A;  4CUT A;  2LGK A;  4O7F A;  2GRC A;  4BW3 A;  3KV5 A;  4HBV A;  4QR5 A;  2DVS A;  5JG6 A;  5I7Y A;  5EIS A;  5HCL A;  2RS9 B;  4C67 A;  4Q0N A;  3UW9 A;  5EPS A;  3HMF A;  4ZQL A;  3NG2 A;  5L96 A;  5CQ4 A;  4QBM A;  5E9Y A;  1WEQ A;  5D3T A;  5FFY A;  4CLB A;  5HQ7 A;  5D24 A;  5BT4 A;  4OGJ A;  4PY6 A;  5EA1 A;  4ALG A;  4LK9 A;  4PTB A;  5D1L B;  2E6R A;  2YUC A;  5D26 A;  3M99 A;  3IU5 A;  4A4B A;  1E6I A;  4NR6 A;  5KTW A;  2YYR A;  5A83 A;  3I2D A;  2K16 A;  4Y03 A;  5CQ3 A;  4UYE A;  5HEN A;  3HTK C;  5FE8 A;  4FIP A;  5FER A;  5FE4 A;  5E9L A;  4J0R A;  5IGM A;  5I89 A;  4A9M A;  4YYK A;  3QZS A;  2VJE B;  4WHU A;  5F1H A;  3T7L A;  2VPG A;  4QZS A;  5DIN A;  4O75 A;  4YYG A;  2MNZ A;  5KTX A;  3U5P A;  4YAT A;  4Q6F A;  3UVD A;  3T6R A;  4R8P K;  1G25 A;  2R0V A;  4CCG X;  5FE6 A;  3DQV R;  4V3L C;  4LKA A;  3ASL A;  2PNX A;  4AUQ B;  3GG3 A;  2YU4 A;  3LQI A;  3V43 A;  4CL9 A;  5CQ5 A;  1WEW A;  5D25 A;  3IU6 A;  5ENF A;  1U6G B;  2DKW A;  3Q2F A;  2MA6 A;  5AIU A;  2YHN A;  4UIY A;  4CUP A;  2H0D A;  2FUI A;  2R10 A;  2DX8 A;  4AVX A;  4QF3 A;  3O34 A;  5EWV A;  1Z2Q A;  3MHS A;  2LGL A;  4Z1Q A;  5I80 A;  4O71 A;  3N9O A;  4UYF A;  4BW2 A;  3O33 A;  5C89 A;  2KWO A;  3O36 A;  2K1J A;  3PUR A;  5ENG A;  4A9F A;  4Z6I A;  4LC2 A;  5HLS A;  3HCU A;  4WZ2 A;  2KIZ A;  5I88 A;  4NN2 A;  4TT2 A;  2VJF A;  3SOW A;  5TBN A;  3ZYQ A;  3JVM A;  4IR5 A;  4YBT A;  1JM7 A;  2I50 A;  4ALH A;  3JVK A;  4QEV A;  3P1E A;  3P5O A;  4BHW A;  2D82 A;  4MEO A;  1JM4 B;  2R0Y A;  2CSZ A;  5AMF A;  5DKC A;  2XEU A;  4YAX A;  3DWY A;  5A85 A;  3RCW A;  4A9K A;  4TZ8 A;  5H1T A;  5I29 A;  2KYU A;  2LXH C;  4FJC A;  4O7E A;  5CRZ A;  3JVJ A;  4NYX A;  5DLX A;  4YH3 A;  4TQN A;  4L58 A;  4J3I A;  5E3D A;  1MM3 A;  4NR8 A;  1E4U A;  4XY9 A;  2YUR A;  5E9M A;  1WFK A;  5F63 A;  4UP5 A;  5ETB A;  3AAD A;  3IHP A;  4I7D A;  5KH9 A;  2ECG A;  4N4F A;  2FUU A;  3PUQ A;  2R0S A;  5D3J A;  3RTR B;  5ETD A;  3LQH A;  4QUT A;  3C5K A;  3N9Q A;  4XY8 A;  1FP0 A;  5KU3 A;  3ZPV 1;  4QR3 A;  5F1L A;  5D3S A;  4YYH A;  3HMH A;  3U5J A;  4TU4 A;  2LSP B;  4CFK A;  4KV4 A;  5FH6 A;  4UIZ A;  1WIM A;  4MR4 A;  5G04 B;  5CRM A;  1WE9 A;  2D9E A;  5LKZ A;  4IC3 A;  4QSV A;  2M85 A;  5BT5 A;  2MUM A;  5II2 A;  4MR5 A;  3S91 A;  5D0C A;  5DX4 A;  4HXP A;  5DYC A;  4A9O A;  4YYD A;  2LGG A;  2G43 A;  3HME A;  1EQF A;  2RNY A;  4GPJ A;  4NUC A;  3SVF A;  5J3X A;  4A9H A;  3UVW A;  2E3K A;  3RPG B;  4UYG A;  5CPE A;  5DYA A;  3ZVZ B;  2LN0 A;  3O35 A;  5EU1 A;  4HXR A;  5C13 A;  4AYC A;  4OGI A;  4NRB A;  1ZS5 A;  4KCX A;  5DY7 A;  5E0R A;  3TLP A;  5ENB A;  3FL2 A;  4QST A;  1WEM A;  5A82 A;  5JWM A;  1DVP A;  4QYD A;  4TKP B;  4MR6 A;  4YYI A;  4WIV A;  3O37 A;  4YAD A;  2E6S A;  3LQJ A;  2YEM A;  5EPB A;  5IBN A;  4C66 A;  1WEO A;  4P5O B;  2YQL A;  4GB0 A;  4IOQ A;  2I7K A;  5FE9 A;  5IGK A;  1CHC A;  1V87 A;  2QIC A;  5A5O A;  2QJ0 A;  3SHB A;  5E9K A;  2YDW A;  2L43 A;  4RVR A;  5EWH A;  4A9N A;  4UYD A;  4TS8 A;  4GNF A;  3G0L A;  3P1D A;  2CKL A;  3N9N A;  2HDP A;  4NR5 A;  1F68 A;  3LXJ A;  5DYU A;  1ZBD B;  4IR6 A;  4NUD A;  4L7X A;  5FEY A;  4QB3 A;  2UZG A;  4UIU A;  4DON A;  2L0B A;  3LJW A;  5LUU A;  4QSX A;  5EI4 A;  5TB6 A;  2VPE A;  5KH3 A;  2YEK A;  5LKX A;  5CUE A;  5KTU A;  4TT6 A;  1WEV A;  5TDR A;  4UIT A;  5C11 A;  5FG4 A;  4UIW A;  2DAT A;  4HBX A;  4N4I A;  4O77 A;  5D3L A;  4TYL A;  5CQT A;  5D3R A;  2JMI A;  1LDK C;  5KHM A;  3AQA A;  3UVX A;  3SVH A;  4YYJ A;  2VPD A;  5FG5 A;  3JVL A;  5TAB A;  3D7C A;  5EIC A;  5EWC A;  5FBX A;  5LKT A;  2LRI C;  4MVT A;  4BW1 A;  5C7N A;  1X4U A;  5EGU A;  4NS5 A;  5L97 A;  5DYX A;  5LJ0 A;  3M62 A;  5EWD A;  2DWW A;  2OO1 A;  5DW2 A;  5IID A;  2G6Q A;  1K2F A;  4YBS A;  3SOU A;  2DVQ A;  2LXP C;  5B76 A;  4NR7 A;  4QR4 A; 
#chains in the Genus database with same CATH topology
 3EB5 A;  2YSM A;  2KFT A;  5E7D A;  1MBM A;  5B8D A;  4I7C A;  5F5Z A;  3SVG A;  3Q2E A;  4IOO A;  5FE3 A;  4LYS A;  5FFV A;  4AKI A;  5F25 A;  2B0O E;  5EYA F;  4IOR A;  5G4S A;  5TCM A;  3MDB C;  5F2P A;  4CUS A;  2OSS A;  5LCW B;  4B7Y C;  5KH7 A;  4HXO A;  2F6N A;  4IR4 A;  2K17 A;  2KGG A;  5L8U A;  3P1F A;  3U5N A;  4PPE A;  4LR6 A;  4R2Y A;  4WZ3 B;  1JM7 B;  4A49 A;  4QSR A;  3U5O A;  4F3I A;  3UV4 A;  5E9V A;  1WUM A;  5A5S A;  5CQ6 A;  2YRE A;  5CZG A;  4NRC A;  5HQ5 A;  3DWD A;  3MHH A;  2JUN A;  2DVR A;  2E7N A;  4N4H A;  4LRG A;  4UIX A;  3JUE A;  2KWK A;  2KR4 A;  4UYH A;  5D7X A;  4PS5 A;  3MQM A;  4Z0O A;  5I3L A;  5B75 A;  5ENE A;  3M7K A;  4NYW A;  3UVY A;  2Y1N A;  3EB6 A;  2QIZ A;  4PCI A;  1VD4 A;  5IG6 A;  2RNX A;  2OUO A;  3MUL A;  2KRE A;  2L80 A;  4WA6 A;  4O74 A;  5I86 A;  3UV2 A;  3H7H A;  2IQJ A;  4NRA A;  2CT2 A;  4ZC9 A;  2L75 A;  3S92 A;  2XB1 A;  4PKL A;  4J1P A;  2BAY A;  4QC3 A;  1RMD A;  2ECW A;  2MA5 A;  2HYE D;  3L11 A;  4CFL A;  4NYV A;  3ONI A;  2EA6 A;  4LDF A;  5F61 A;  5D3P A;  5HM0 A;  4X3G A;  3L1Z B;  4NUE A;  5FE7 A;  4ZDT A;  3ZTG A;  5LKU A;  5DLZ A;  2G45 A;  5TRB A;  5LVR A;  5C85 A;  5CGP A;  4B86 C;  4HXK A;  3T9K A;  4AP4 A;  2MNY A;  4HBW A;  5EM3 A;  4QSS A;  4UIV A;  5D1M B;  2LV9 A;  4FO9 A;  4CUU A;  2F6J A;  5DBM A;  2VP7 A;  4O7A A;  5ENH A;  4A9E A;  3N9P A;  4LAD B;  5K29 A;  1WES A;  5G4R A;  2KTB B;  5DW1 A;  5B79 A;  4MEQ A;  2K4D A;  4ZW1 A;  4IR3 A;  2YEL A;  3NXB A;  2CRW A;  5HRX A;  1LDJ B;  4AYC B;  5H9M A;  4LZ2 A;  2RNW A;  3LRQ A;  5BT3 A;  4LZR A;  5HJC A;  5HRW A;  5FG6 A;  1Z60 A;  5AME A;  5HQ6 A;  3HCS A;  4MEP A;  5C4Q A;  2MJV B;  5SVI B;  4YY6 A;  3FKM X;  2DJA A;  4YH4 A;  2EGM A;  5DFC A;  5FE1 A;  2VPB A;  2P57 A;  3HCT A;  4QSU A;  4OUF A;  5E9I A;  5FFW A;  2ECN A;  4LZS A;  2M13 A;  2KWJ A;  4S3O B;  5FB0 A;  4WZ0 A;  2ECV A;  4QYL A;  1WGM A;  1XWH A;  3SOX A;  3ZVY A;  4BBQ A;  2YQM A;  2RO1 A;  4QSP A;  4LLB A;  5EPR A;  2ECJ A;  2F42 A;  2N9G A;  3M63 A;  5I40 A;  4F1P A;  2E7O A;  5EVA A;  4A9J A;  3P1C A;  2CKL B;  2MD8 C;  4IC2 A;  5E73 A;  4HXS A;  4YK0 A;  5D3N A;  2G4A A;  4A9I A;  5CQ7 A;  2RI7 A;  4BW4 A;  5COI A;  4FK5 A;  4A4C A;  3O7A A;  5D1K B;  5TDW A;  5EWW A;  2M6M A;  2KE1 A;  2KU3 A;  4XUA A;  2KWN A;  4HXM A;  5CUA A;  5CUC A;  5II1 A;  5LVQ A;  2FD4 A;  5B77 A;  3UV5 A;  2VJE A;  4O7B A;  4ZUX U;  4LJN A;  2L85 A;  5CUB A;  3RPG C;  4C9Z A;  4UI9 B;  2YW8 A;  2M3H A;  5SVY A;  5CUD A;  2RFJ A;  3VK6 A;  3DAI A;  5CP5 A;  2C2V S;  4Z1S A;  4YAB A;  4O76 A;  2JMJ A;  3QZV A;  5IGN A;  3K2J A;  4LYI A;  4QEW A;  3GV4 A;  5A5Q A;  4QC1 A;  5FH7 A;  5HEM A;  2ECT A;  2M1R A;  5L98 A;  2VNF A;  4GNG A;  4MR3 A;  5DKH A;  1PUO A;  4Z6H A;  4KV1 A;  4MSX A;  2PUY A;  5EQ1 A;  4NXJ A;  5A5R A;  1JOC A;  5FH8 A;  2C2L A;  2Y43 A;  5I7X A;  4TTE A;  5K3Q A;  3ZNI A;  5H1V A;  2H0D B;  1WUG A;  4QSQ A;  3U5M A;  4YBM A;  5EK9 A;  1JSP B;  4AKG A;  2KGI A;  4TU6 A;  3LDY A;  5B78 A;  2MT5 A;  5DKD A;  5HEL A;  4UYF B;  1WEN A;  2ZET C;  2WP2 A;  5I1Q A;  2FFW A;  5IGL A;  5C87 A;  4XI1 A;  4XYA A;  5EP7 A;  4S3O C;  2MD7 B;  3C6W A;  5LJ2 A;  1FBV A;  2NAA A;  3O70 A;  5CQ8 A;  2Y1M A;  4OGE A;  5HFQ A;  5A5P A;  4QUU A;  2L5E A;  4YC9 A;  4CUR A;  4YYN A;  1WEP A;  2VJF B;  5FE5 A;  3KQI A;  3L1X A;  5HRV A;  2YT5 A;  4QEU A;  2EGP A;  2L5U A;  2IDA A;  5ENI A;  4HBY A;  5DKA A;  2WP1 A;  5L8T A;  5A5N A;  5C8G A;  3FEH A;  5G0F A;  4NR9 A;  4QSW A;  2JRJ A;  3N9L A;  3D1B A;  3MB3 A;  2NXB A;  3MB4 A;  5AD3 A;  5KO4 A;  1X0J A;  2L84 A;  5H1U A;  4FLP A;  5CQA A;  2D8S A;  2AN6 A;  1VFY A;  4CUQ A;  2LDR A;  5H85 A;  2LGV A;  4Q0O A;  4GNE A;  2RR4 A;  2ECI A;  3ZPV E;  4NR4 A;  1N72 A;  2OWA A;  4XUB A;  5FB1 A;  2XP0 A;  1BOR A;  5DFD A;  4O78 A;  5ENJ A;  5FE0 A;  1WEU A;  1HYJ A;  3DPL R;  4LYW A;  3KV6 A;  4QY4 A;  5CY9 A;  5J0D A;  5FE2 A;  4QNS A;  2EOD A;  3PHD A;  5HFR A;  3N9M A;  1IYM A;  5CTL A;  4GND A;  4AI6 A;  5ACY A;  4J0S A;  4X2I A;  1T1H A;  3LVR E;  3FJU B;  2YSJ A;  5AIT A;  1X4J A;  5CU8 A;  5D3H A;  4O70 A;  4TT4 A;  4A9L A;  3I3J A;  5LJ1 A;  2D8U A;  3G0J A;  4I7B A;  1MM2 A;  4O62 A;  2MIQ A;  4W4U A;  4AKN A;  4Z0R A;  5EV9 A;  4YY4 A;  4F52 B;  2DVV A;  5CUG A;  2OXQ C;  1N87 A;  2LQ6 A;  2RSD A;  3GL6 A;  1WEE A;  4R7E A;  5AD2 A;  5G05 B;  5ENC A;  5CFW A;  2YYN A;  3QZT A;  5A81 A;  4N4G A;  4UP0 A;  4A0C D;  4BJX A;  4Z93 A;  3U5K A;  5L99 A;  5E3G A;  2JM3 A;  4WHW A;  4E96 A;  2E61 A;  2I8N A;  4YYM A;  2FSA A;  5F62 A;  5FDZ A;  5F3A A;  4AKH A;  1X4I A;  5CS8 A;  5JI8 A;  3LVQ E;  4V3K C;  1WIL A;  4TZ2 A;  4QF2 A;  4N3W A;  4CA1 A;  2YHO A;  1F62 A;  3MUK A;  1VYX A;  5I83 A;  2JMD A;  1HYI A;  2H60 A;  4HXL A;  4NQM A;  3KNV A;  2YQD A;  5A7C A;  1Z6U A;  4O64 A;  2CSY A;  3E2D A;  3U5L A;  4O7C A;  5F36 A;  4HXN A;  3MXF A;  4O72 A;  2KKY A;  4MEN A;  5E74 A;  5DFB A;  3ZYU A;  2MKE A;  2YW5 A;  4NQN A;  4PCE A;  5F60 A;  4CUT A;  2LGK A;  4O7F A;  2GRC A;  4BW3 A;  3KV5 A;  4HBV A;  4QR5 A;  2DVS A;  5JG6 A;  5I7Y A;  5EIS A;  5HCL A;  2RS9 B;  4C67 A;  4Q0N A;  3UW9 A;  5EPS A;  3HMF A;  4ZQL A;  3NG2 A;  5L96 A;  5CQ4 A;  4QBM A;  5E9Y A;  1WEQ A;  5D3T A;  5FFY A;  4CLB A;  5HQ7 A;  5D24 A;  3FAO A;  5BT4 A;  4OGJ A;  4PY6 A;  5EA1 A;  4ALG A;  4LK9 A;  4PTB A;  5D1L B;  2E6R A;  2YUC A;  5D26 A;  3M99 A;  3IU5 A;  4A4B A;  1E6I A;  4NR6 A;  5KTW A;  2YYR A;  5A83 A;  3I2D A;  2K16 A;  4Y03 A;  5CQ3 A;  4UYE A;  5HEN A;  3HTK C;  5FE8 A;  4FIP A;  5FER A;  5FE4 A;  5E9L A;  4J0R A;  5IGM A;  5I89 A;  4A9M A;  2EXU A;  4YYK A;  3FAN A;  3QZS A;  2VJE B;  4WHU A;  5F1H A;  3T7L A;  2VPG A;  4QZS A;  5DIN A;  4O75 A;  4YYG A;  2MNZ A;  5KTX A;  3U5P A;  4YAT A;  4Q6F A;  3UVD A;  3T6R A;  4R8P K;  2KKX A;  1G25 A;  2R0V A;  4CCG X;  5FE6 A;  3DQV R;  4V3L C;  4LKA A;  3ASL A;  2PNX A;  4AUQ B;  4QQ4 A;  3GG3 A;  2YU4 A;  3LQI A;  3V43 A;  4CL9 A;  5CQ5 A;  1WEW A;  5D25 A;  3IU6 A;  5ENF A;  1U6G B;  2DKW A;  3Q2F A;  3DDT A;  2MA6 A;  5AIU A;  2YHN A;  4UIY A;  4CUP A;  2H0D A;  2FUI A;  2R10 A;  2DSM A;  2DX8 A;  4AVX A;  4QF3 A;  3O34 A;  5EWV A;  1Z2Q A;  3MHS A;  2LGL A;  2L7P A;  4Z1Q A;  5I80 A;  4O71 A;  3N9O A;  4UYF A;  4BW2 A;  3O33 A;  5C89 A;  2KWO A;  3O36 A;  2K1J A;  3PUR A;  5ENG A;  4A9F A;  4Z6I A;  4LC2 A;  5HLS A;  3HCU A;  4WZ2 A;  2KIZ A;  5I88 A;  4NN2 A;  4TT2 A;  2VJF A;  3SOW A;  5TBN A;  3ZYQ A;  3JVM A;  4IR5 A;  4YBT A;  1JM7 A;  2I50 A;  4ALH A;  3JVK A;  4QEV A;  3P1E A;  3P5O A;  4BHW A;  2D82 A;  4MEO A;  1JM4 B;  2R0Y A;  2CSZ A;  5AMF A;  5DKC A;  2XEU A;  4YAX A;  3DWY A;  5A85 A;  3RCW A;  4A9K A;  4TZ8 A;  5H1T A;  5I29 A;  2KYU A;  2LXH C;  4FJC A;  4O7E A;  5CRZ A;  3JVJ A;  4NYX A;  5DLX A;  4YH3 A;  4TQN A;  4L58 A;  4J3I A;  5E3D A;  1MM3 A;  4NR8 A;  1E4U A;  4XY9 A;  2YUR A;  3LJU X;  5E9M A;  1WFK A;  5F63 A;  4UP5 A;  5ETB A;  3AAD A;  3IHP A;  4I7D A;  5KH9 A;  2XOY A;  2ECG A;  4N4F A;  2FUU A;  3PUQ A;  1ZKR A;  2R0S A;  5D3J A;  3RTR B;  5ETD A;  3LQH A;  4QUT A;  3C5K A;  3N9Q A;  2EJN A;  4XY8 A;  1FP0 A;  2CON A;  5KU3 A;  3ZPV 1;  4QR3 A;  5F1L A;  5D3S A;  4YYH A;  3HMH A;  3U5J A;  4TU4 A;  2LSP B;  4CFK A;  4KV4 A;  2CRR A;  5FH6 A;  4UIZ A;  1WIM A;  4MR4 A;  1DCQ A;  5G04 B;  5CRM A;  1WE9 A;  2D9E A;  5LKZ A;  4IC3 A;  4QSV A;  3SUB A;  2M85 A;  5BT5 A;  2MUM A;  3D1D A;  4MR5 A;  5II2 A;  3S91 A;  5D0C A;  5DX4 A;  4HXP A;  5DYC A;  4A9O A;  4YYD A;  2LGG A;  2G43 A;  3HME A;  1EQF A;  2RNY A;  4GPJ A;  4NUC A;  3SVF A;  5J3X A;  4A9H A;  4H9D A;  3UVW A;  2E3K A;  3RPG B;  4UYG A;  2XOZ A;  5CPE A;  5DYA A;  3ZVZ B;  2LN0 A;  3O35 A;  5EU1 A;  4HXR A;  3FM8 C;  4AYC A;  5C13 A;  4OGI A;  4NRB A;  1ZS5 A;  4KCX A;  5DY7 A;  5E0R A;  3TLP A;  5ENB A;  3FL2 A;  4QST A;  1WEM A;  5A82 A;  5JWM A;  5SVI A;  1DVP A;  4QYD A;  4TKP B;  4MR6 A;  4YYI A;  4WIV A;  3O37 A;  2LAU A;  4YAD A;  2E6S A;  2XOC A;  3LQJ A;  2YEM A;  5EPB A;  5IBN A;  4C66 A;  1WEO A;  4P5O B;  2YQL A;  4GB0 A;  4IOQ A;  2I7K A;  5FE9 A;  5IGK A;  1CHC A;  1V87 A;  2CSV A;  2QIC A;  5A5O A;  2QJ0 A;  3SHB A;  5E9K A;  2YDW A;  2L43 A;  4RVR A;  3VKG A;  5EWH A;  4A9N A;  4UYD A;  3O47 A;  4TS8 A;  4GNF A;  3G0L A;  3P1D A;  2CKL A;  3N9N A;  2HDP A;  4NR5 A;  1F68 A;  3LXJ A;  5DYU A;  3VKH A;  1ZBD B;  4IR6 A;  4NUD A;  4L7X A;  5FEY A;  4QB3 A;  2UZG A;  4UIU A;  3PLW A;  4DON A;  2L0B A;  3LJW A;  5LUU A;  4QSX A;  3ERR A;  5EI4 A;  5TB6 A;  2VPE A;  5KH3 A;  2YEK A;  5LKX A;  5CUE A;  5KTU A;  4TT6 A;  1WEV A;  5TDR A;  4UIT A;  5C11 A;  5FG4 A;  4UIW A;  5SVX A;  2DAT A;  4HBX A;  4N4I A;  4O77 A;  5D3L A;  4TYL A;  5CQT A;  5D3R A;  2JMI A;  1LDK C;  5KHM A;  3AQA A;  3UVX A;  3SVH A;  4YYJ A;  2VPD A;  5FG5 A;  3Q1D A;  3JVL A;  5TAB A;  3D7C A;  5EIC A;  5EWC A;  5FBX A;  5LKT A;  2LRI C;  4MVT A;  4BW1 A;  5C7N A;  1X4U A;  5EGU A;  4NS5 A;  5L97 A;  5DYX A;  5LJ0 A;  3M62 A;  4OGC A;  5EWD A;  2DWW A;  2OO1 A;  5DW2 A;  5IID A;  2G6Q A;  1K2F A;  2YVR A;  3KDE C;  4YBS A;  3SOU A;  2DVQ A;  2LXP C;  5B76 A;  4NR7 A;  4QR4 A; 
#chains in the Genus database with same CATH homology
 3EB5 A;  2YSM A;  2KFT A;  5E7D A;  5B8D A;  4I7C A;  5F5Z A;  3SVG A;  3Q2E A;  4IOO A;  5FE3 A;  4LYS A;  5FFV A;  5F25 A;  5EYA F;  4IOR A;  5G4S A;  5TCM A;  5F2P A;  4CUS A;  2OSS A;  5LCW B;  4B7Y C;  5KH7 A;  4HXO A;  2F6N A;  4IR4 A;  2K17 A;  2KGG A;  5L8U A;  3P1F A;  3U5N A;  4PPE A;  4LR6 A;  4R2Y A;  4WZ3 B;  1JM7 B;  4A49 A;  4QSR A;  3U5O A;  4F3I A;  3UV4 A;  5E9V A;  1WUM A;  5A5S A;  5CQ6 A;  2YRE A;  5CZG A;  4NRC A;  5HQ5 A;  3MHH A;  2DVR A;  2E7N A;  4N4H A;  4LRG A;  4UIX A;  2KWK A;  2KR4 A;  4UYH A;  5D7X A;  4PS5 A;  3MQM A;  5I3L A;  5B75 A;  5ENE A;  4NYW A;  3UVY A;  2Y1N A;  3EB6 A;  2QIZ A;  4PCI A;  1VD4 A;  5IG6 A;  2RNX A;  2OUO A;  3MUL A;  2KRE A;  2L80 A;  4WA6 A;  4O74 A;  5I86 A;  3UV2 A;  4NRA A;  2CT2 A;  4ZC9 A;  2L75 A;  3S92 A;  2XB1 A;  4PKL A;  4J1P A;  2BAY A;  4QC3 A;  1RMD A;  2ECW A;  2MA5 A;  2HYE D;  3L11 A;  4CFL A;  4NYV A;  3ONI A;  2EA6 A;  4LDF A;  5F61 A;  5D3P A;  5HM0 A;  4X3G A;  3L1Z B;  4NUE A;  5FE7 A;  4ZDT A;  3ZTG A;  5LKU A;  5DLZ A;  2G45 A;  5TRB A;  5LVR A;  5C85 A;  5CGP A;  4B86 C;  4HXK A;  4AP4 A;  2MNY A;  4HBW A;  5EM3 A;  4QSS A;  4UIV A;  5D1M B;  2LV9 A;  4FO9 A;  4CUU A;  2F6J A;  5DBM A;  2VP7 A;  4O7A A;  5ENH A;  4A9E A;  3N9P A;  4LAD B;  5K29 A;  1WES A;  5G4R A;  2KTB B;  5DW1 A;  5B79 A;  4MEQ A;  2K4D A;  4ZW1 A;  4IR3 A;  2YEL A;  3NXB A;  5HRX A;  1LDJ B;  4AYC B;  5H9M A;  4LZ2 A;  2RNW A;  3LRQ A;  5BT3 A;  4LZR A;  5HJC A;  5HRW A;  5FG6 A;  1Z60 A;  5AME A;  5HQ6 A;  3HCS A;  4MEP A;  5C4Q A;  2MJV B;  4YY6 A;  3FKM X;  4YH4 A;  5DFC A;  5FE1 A;  2VPB A;  3HCT A;  4QSU A;  4OUF A;  5E9I A;  5FFW A;  2ECN A;  4LZS A;  4S3O B;  2KWJ A;  5FB0 A;  4WZ0 A;  2ECV A;  4QYL A;  1WGM A;  1XWH A;  3SOX A;  3ZVY A;  4BBQ A;  2YQM A;  2RO1 A;  4QSP A;  4LLB A;  5EPR A;  2ECJ A;  2F42 A;  2N9G A;  3M63 A;  5I40 A;  2E7O A;  5EVA A;  4A9J A;  3P1C A;  2CKL B;  2MD8 C;  4IC2 A;  5E73 A;  4HXS A;  4YK0 A;  5D3N A;  2G4A A;  4A9I A;  5CQ7 A;  2RI7 A;  4BW4 A;  5COI A;  4FK5 A;  4A4C A;  3O7A A;  5D1K B;  5TDW A;  5EWW A;  2M6M A;  2KE1 A;  2KU3 A;  4XUA A;  2KWN A;  4HXM A;  5CUA A;  5CUC A;  5II1 A;  5LVQ A;  5B77 A;  3UV5 A;  2VJE A;  4O7B A;  4ZUX U;  4LJN A;  2L85 A;  5CUB A;  3RPG C;  4C9Z A;  4UI9 B;  2YW8 A;  2M3H A;  5CUD A;  2RFJ A;  3VK6 A;  3DAI A;  5CP5 A;  2C2V S;  4Z1S A;  4YAB A;  4O76 A;  2JMJ A;  3QZV A;  5IGN A;  3K2J A;  4LYI A;  4QEW A;  3GV4 A;  5A5Q A;  4QC1 A;  5FH7 A;  5HEM A;  2ECT A;  2M1R A;  5L98 A;  2VNF A;  4GNG A;  4MR3 A;  5DKH A;  4Z6H A;  4KV1 A;  4MSX A;  2PUY A;  5EQ1 A;  4NXJ A;  5A5R A;  1JOC A;  5FH8 A;  2C2L A;  2Y43 A;  5I7X A;  4TTE A;  3ZNI A;  5H1V A;  2H0D B;  1WUG A;  4QSQ A;  3U5M A;  4YBM A;  5EK9 A;  1JSP B;  2KGI A;  4TU6 A;  5B78 A;  2MT5 A;  5DKD A;  5HEL A;  4UYF B;  1WEN A;  2ZET C;  2WP2 A;  5I1Q A;  5IGL A;  5C87 A;  4XI1 A;  4XYA A;  5EP7 A;  4S3O C;  2MD7 B;  3C6W A;  5LJ2 A;  1FBV A;  2NAA A;  3O70 A;  5CQ8 A;  2Y1M A;  5HFQ A;  5A5P A;  4QUU A;  2L5E A;  4YC9 A;  4CUR A;  4YYN A;  1WEP A;  2VJF B;  5FE5 A;  3KQI A;  3L1X A;  5HRV A;  2YT5 A;  4QEU A;  2EGP A;  2L5U A;  2IDA A;  5ENI A;  4HBY A;  5DKA A;  2WP1 A;  5L8T A;  5A5N A;  5C8G A;  5G0F A;  4NR9 A;  4QSW A;  2JRJ A;  3N9L A;  3MB3 A;  2NXB A;  3MB4 A;  5AD3 A;  5KO4 A;  1X0J A;  2L84 A;  5H1U A;  4FLP A;  5CQA A;  2D8S A;  2AN6 A;  1VFY A;  4CUQ A;  2LDR A;  5H85 A;  2LGV A;  4Q0O A;  4GNE A;  2ECI A;  3ZPV E;  4NR4 A;  1N72 A;  4XUB A;  5FB1 A;  1BOR A;  5DFD A;  4O78 A;  5ENJ A;  5FE0 A;  1WEU A;  1HYJ A;  3DPL R;  4LYW A;  3KV6 A;  4QY4 A;  5CY9 A;  5J0D A;  5FE2 A;  4QNS A;  2EOD A;  3PHD A;  5HFR A;  3N9M A;  1IYM A;  5CTL A;  4GND A;  5ACY A;  4J0S A;  4X2I A;  1T1H A;  2YSJ A;  5AIT A;  1X4J A;  5CU8 A;  5D3H A;  4O70 A;  4TT4 A;  4A9L A;  3I3J A;  5LJ1 A;  4I7B A;  3G0J A;  4W4U A;  1MM2 A;  2MIQ A;  4AKN A;  5EV9 A;  4YY4 A;  4F52 B;  2DVV A;  5CUG A;  2OXQ C;  1N87 A;  2LQ6 A;  2RSD A;  3GL6 A;  1WEE A;  4R7E A;  5AD2 A;  5G05 B;  5ENC A;  5CFW A;  2YYN A;  3QZT A;  5A81 A;  4N4G A;  4UP0 A;  4A0C D;  4BJX A;  4Z93 A;  3U5K A;  5L99 A;  5E3G A;  4WHW A;  4E96 A;  2I8N A;  4YYM A;  2FSA A;  5F62 A;  5FDZ A;  5F3A A;  1X4I A;  5CS8 A;  5JI8 A;  4V3K C;  1WIL A;  4TZ2 A;  4QF2 A;  4N3W A;  4CA1 A;  2YHO A;  1F62 A;  3MUK A;  1VYX A;  5I83 A;  2JMD A;  1HYI A;  2H60 A;  4HXL A;  4NQM A;  3KNV A;  2YQD A;  5A7C A;  1Z6U A;  4O64 A;  2CSY A;  3U5L A;  4O7C A;  5F36 A;  4HXN A;  3MXF A;  4O72 A;  4MEN A;  5E74 A;  5DFB A;  3ZYU A;  2YW5 A;  4NQN A;  4PCE A;  5F60 A;  4CUT A;  2LGK A;  4O7F A;  2GRC A;  4BW3 A;  3KV5 A;  4HBV A;  4QR5 A;  2DVS A;  5JG6 A;  5I7Y A;  5EIS A;  5HCL A;  2RS9 B;  4C67 A;  4Q0N A;  3UW9 A;  5EPS A;  3HMF A;  4ZQL A;  3NG2 A;  5L96 A;  5CQ4 A;  4QBM A;  5E9Y A;  1WEQ A;  5D3T A;  5FFY A;  4CLB A;  5HQ7 A;  5D24 A;  5BT4 A;  4OGJ A;  4PY6 A;  5EA1 A;  4ALG A;  4LK9 A;  4PTB A;  5D1L B;  2E6R A;  2YUC A;  5D26 A;  3M99 A;  3IU5 A;  4A4B A;  1E6I A;  4NR6 A;  5KTW A;  2YYR A;  5A83 A;  3I2D A;  2K16 A;  4Y03 A;  5CQ3 A;  4UYE A;  5HEN A;  3HTK C;  5FE8 A;  4FIP A;  5FER A;  5FE4 A;  5E9L A;  4J0R A;  5IGM A;  5I89 A;  4A9M A;  4YYK A;  3QZS A;  2VJE B;  4WHU A;  5F1H A;  3T7L A;  2VPG A;  4QZS A;  5DIN A;  4O75 A;  4YYG A;  2MNZ A;  5KTX A;  3U5P A;  4YAT A;  4Q6F A;  3UVD A;  3T6R A;  4R8P K;  1G25 A;  2R0V A;  4CCG X;  5FE6 A;  3DQV R;  4V3L C;  4LKA A;  3ASL A;  2PNX A;  4AUQ B;  3GG3 A;  2YU4 A;  3LQI A;  3V43 A;  4CL9 A;  5CQ5 A;  1WEW A;  5D25 A;  3IU6 A;  5ENF A;  1U6G B;  2DKW A;  3Q2F A;  2MA6 A;  5AIU A;  2YHN A;  4UIY A;  4CUP A;  2H0D A;  2FUI A;  2R10 A;  2DX8 A;  4AVX A;  4QF3 A;  3O34 A;  5EWV A;  1Z2Q A;  3MHS A;  2LGL A;  4Z1Q A;  5I80 A;  4O71 A;  3N9O A;  4UYF A;  4BW2 A;  3O33 A;  5C89 A;  2KWO A;  3O36 A;  2K1J A;  3PUR A;  5ENG A;  4A9F A;  4Z6I A;  4LC2 A;  5HLS A;  3HCU A;  4WZ2 A;  2KIZ A;  5I88 A;  4NN2 A;  4TT2 A;  2VJF A;  3SOW A;  5TBN A;  3ZYQ A;  3JVM A;  4IR5 A;  4YBT A;  1JM7 A;  2I50 A;  4ALH A;  3JVK A;  4QEV A;  3P1E A;  3P5O A;  4BHW A;  2D82 A;  4MEO A;  1JM4 B;  2R0Y A;  2CSZ A;  5AMF A;  5DKC A;  2XEU A;  4YAX A;  3DWY A;  5A85 A;  3RCW A;  4A9K A;  4TZ8 A;  5H1T A;  5I29 A;  2KYU A;  2LXH C;  4FJC A;  4O7E A;  5CRZ A;  3JVJ A;  4NYX A;  5DLX A;  4YH3 A;  4TQN A;  4L58 A;  4J3I A;  5E3D A;  1MM3 A;  4NR8 A;  1E4U A;  4XY9 A;  2YUR A;  5E9M A;  1WFK A;  5F63 A;  4UP5 A;  5ETB A;  3AAD A;  3IHP A;  4I7D A;  5KH9 A;  2ECG A;  4N4F A;  2FUU A;  3PUQ A;  2R0S A;  5D3J A;  3RTR B;  5ETD A;  3LQH A;  4QUT A;  3C5K A;  3N9Q A;  4XY8 A;  1FP0 A;  5KU3 A;  3ZPV 1;  4QR3 A;  5F1L A;  5D3S A;  4YYH A;  3HMH A;  3U5J A;  4TU4 A;  2LSP B;  4CFK A;  4KV4 A;  5FH6 A;  4UIZ A;  1WIM A;  4MR4 A;  5G04 B;  5CRM A;  1WE9 A;  2D9E A;  5LKZ A;  4IC3 A;  4QSV A;  2M85 A;  5BT5 A;  2MUM A;  5II2 A;  4MR5 A;  3S91 A;  5D0C A;  5DX4 A;  4HXP A;  5DYC A;  4A9O A;  4YYD A;  2LGG A;  2G43 A;  3HME A;  1EQF A;  2RNY A;  4GPJ A;  4NUC A;  3SVF A;  5J3X A;  4A9H A;  3UVW A;  2E3K A;  3RPG B;  4UYG A;  5CPE A;  5DYA A;  3ZVZ B;  2LN0 A;  3O35 A;  5EU1 A;  4HXR A;  5C13 A;  4AYC A;  4OGI A;  4NRB A;  1ZS5 A;  4KCX A;  5DY7 A;  5E0R A;  3TLP A;  5ENB A;  3FL2 A;  4QST A;  1WEM A;  5A82 A;  5JWM A;  1DVP A;  4QYD A;  4TKP B;  4MR6 A;  4YYI A;  4WIV A;  3O37 A;  4YAD A;  2E6S A;  3LQJ A;  2YEM A;  5EPB A;  5IBN A;  4C66 A;  1WEO A;  4P5O B;  2YQL A;  4GB0 A;  4IOQ A;  2I7K A;  5FE9 A;  5IGK A;  1CHC A;  1V87 A;  2QIC A;  5A5O A;  2QJ0 A;  3SHB A;  5E9K A;  2YDW A;  2L43 A;  4RVR A;  5EWH A;  4A9N A;  4UYD A;  4TS8 A;  4GNF A;  3G0L A;  3P1D A;  2CKL A;  3N9N A;  2HDP A;  4NR5 A;  1F68 A;  3LXJ A;  5DYU A;  1ZBD B;  4IR6 A;  4NUD A;  4L7X A;  5FEY A;  4QB3 A;  2UZG A;  4UIU A;  4DON A;  2L0B A;  3LJW A;  5LUU A;  4QSX A;  5EI4 A;  5TB6 A;  2VPE A;  5KH3 A;  2YEK A;  5LKX A;  5CUE A;  5KTU A;  4TT6 A;  1WEV A;  5TDR A;  4UIT A;  5C11 A;  5FG4 A;  4UIW A;  2DAT A;  4HBX A;  4N4I A;  4O77 A;  5D3L A;  4TYL A;  5CQT A;  5D3R A;  2JMI A;  1LDK C;  5KHM A;  3AQA A;  3UVX A;  3SVH A;  4YYJ A;  2VPD A;  5FG5 A;  3JVL A;  5TAB A;  3D7C A;  5EIC A;  5EWC A;  5FBX A;  5LKT A;  2LRI C;  4MVT A;  4BW1 A;  5C7N A;  1X4U A;  5EGU A;  4NS5 A;  5L97 A;  5DYX A;  5LJ0 A;  3M62 A;  5EWD A;  2DWW A;  2OO1 A;  5DW2 A;  5IID A;  2G6Q A;  1K2F A;  4YBS A;  3SOU A;  2DVQ A;  2LXP C;  5B76 A;  4NR7 A;  4QR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...