2YVRA

Crystal structure of ms1043
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
45
structure length
45
Chain Sequence
b'GERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription intermediary factor 1-beta
publication title Crystal structure of MS1043
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 12
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2yvrA00
2DJAA 2JUNA 3DDTA 3Q1DA 5K3QA 2YVRA 2D8UA 2EGMA 2CSVA
chains in the Genus database with same CATH superfamily
5DKAA 2DX8A 4YATA 2Y1NA 3FAOA 1MBMA 3DWDA 3O35A 2YURA 5LKZA 3ASLA 2E61A 2L5UA 4ZDTA 2KGIA 1MM2A 5LKUA 4ZUXU 1N87A 4CCGX 3MHHA 2MD7B 5SVIB 4R7EA 2K1JA 3HCSA 2MT5A 2YHNA 1E4UA 4AVXA 2LDRA 2RR4A 2CKLB 3M63A 4LLBA 4YBSA 5H1UA 4Q6FA 1X4JA 4BBQA 5D1KB 5H1TA 1Z2QA 1Z6UA 2PNXA 4V3LC 3FANA 2XOZA 5I3LA 5TDRA 3M7KA 3O33A 3QZVA 5SVIA 2ECVA 1X4UA 2JRJA 4O62A 2KKYA 1WEMA 4W4UA 3LDYA 2CKLA 2JUNA 1RMDA 3KQIA 2ZETC 5B77A 2Y1MA 2KREA 4XI1A 4H9DA 3U5OA 2JMJA 3MHSA 3N9OA 1ZBDB 3SOUA 2CRRA 5H9MA 1XWHA 1BORA 5AITA 3DDTA 4YADA 1WE9A 4L58A 4IC3A 4N3WA 2RSDA 4LK9A 4N4FA 4NN2A 4YBMA 3SHBA 2ECWA 2LQ6A 2K4DA 2EGPA 2KYUA 3KDEC 5EYAF 2LV9A 3FEHA 4X3GA 2CSYA 3LVRE 2LGLA 1WILA 1IYMA 2L0BA 4LJNA 3RTRB 5LKXA 1FBVA 2RI7A 3T6RA 5LKTA 3LQJA 2C2VS 4I7DA 2KGGA 4I7CA 3KV5A 2CSVA 2EA6A 2OWAA 3SOXA 2FUUA 2LXPC 3SUBA 1T1HA 4P5OB 3N9NA 4OGCA 2LGGA 1VFYA 2FFWA 4A4BA 4GNEA 3HCUA 1DVPA 4FO9A 3L11A 3GL6A 5C13A 3O47A 2LGVA 2YSJA 2XEUA 2YW8A 4GNGA 5KH3A 4LKAA 2D8SA 2LRIC 3O37A 4A0CD 1WIMA 2BAYA 2E6RA 3N9LA 2KWNA 3M62A 1WEOA 3O34A 2MD8C 4A49A 2CONA 1VD4A 2YVRA 2VPEA 2XB1A 2XP0A 4B86C 2XOYA 1WENA 4MSXA 1WEPA 1HYJA 4AYCA 3ZNIA 2MA5A 5D1LB 2PUYA 4QQ4A 3PURA 4AUQB 2YREA 2G43A 5TDWA 2LAUA 1DCQA 1WEEA 4UP0A 2QIZA 2KE1A 3C6WA 4R8PK 1U6GB 2YHOA 1V87A 3NG2A 3IHPA 5G0FA 3LQHA 2L43A 4FIPA 3EB6A 4OGEA 3MDBC 5B75A 3ZPV1 5D1MB 4S3OB 2VPGA 3N9PA 3L1ZB 4C9ZA 5G04B 2M13A 4F52B 4Z0OA 2Y43A 3O36A 1VYXA 3ZVYA 5JG6A 1LDKC 2MIQA 4PTBA 3O70A 5AIUA 4YBTA 3ZVZB 2ECGA 2D8UA 2VJEA 3VK6A 5B8DA 2VJFA 2VPBA 3RPGC 4WZ2A 3O7AA 2G6QA 1WEUA 2KU3A 3T9KA 2MNYA 3GV4A 4FK5A 4GNDA 2LXHC 4GB0A 3U5MA 2F6NA 5B78A 2KR4A 4WZ0A 2I50A 2C2LA 3LJUX 3T7LA 2YYRA 3PHDA 2CT2A 2KWJA 2VNFA 2M3HA 3PLWA 2EXUA 4V3KC 4LADB 5C11A 1WEQA 2DJAA 4GNFA 2JM3A 2FSAA 3U5PA 2JMDA 5FEYA 4YC9A 4UI9B 5J3XA 3RPGB 2M85A 4IC2A 4O64A 3Q1DA 4AP4A 5K3QA 2ECIA 4CA1A 1F62A 4BHWA 5SVYA 4AYCB 2VPDA 2P57A 2B0OE 1JOCA 3KV6A 5TABA 5FB0A 5G05B 3EB5A 2QJ0A 2F6JA 4F1PA 3M99A 1WFKA 1X4IA 2LN0A 2ECTA 3PUQA 2MKEA 2YT5A 3C5KA 4I7BA 2L80A 3DQVR 1Z60A 5SVXA 2K17A 2KWOA 2M1RA 3JUEA 2E6SA 2IQJA 4L7XA 4S3OC 4WA6A 1JM7A 2HYED 4Z0RA 3HCTA 2G45A 2EODA 4UP5A 5B79A 5H1VA 4B7YC 3HTKC 2EGMA 2YSMA 3LRQA 2YU4A 4TKPB 2IDAA 4YAXA 3KNVA 2K16A 1CHCA 4WZ3B 1WESA 1G25A 1WEVA 5KH7A 5DINA 2H0DB 3FJUB 4A4CA 2VJEB 5LCWB 2VJFB 1LDJB 3LQIA 1HYIA 2L75A 4MVTA 2JMIA 3SOWA 2AN6A 5FB1A 3FL2A 2YQMA 1FP0A 4ZQLA 5KH9A 2LGKA 3I2DA 2H0DA 2HDPA 3ZYQA 3ZPVE 4QF3A 5B76A 3LVQE 1WGMA 3N9QA 3L1XA 2MNZA 2KFTA 3V43A 2KWKA 2DSMA 3DPLR 2NAAA 2FUIA 1K2FA 2QICA 3U5NA 3E2DA 4PPEA 2M6MA 4QF2A 3H7HA 2KIZA 5TBNA 5FERA 4FJCA 3ZTGA 2KKXA 2F42A 2OXQC 2L7PA 2FD4A 4R2YA 2YQLA 3FM8C 1WEWA 1MM3A 5TRBA 2ECJA 3N9MA 2CSZA 2XOCA 2ECNA 2UZGA 4YABA 2MUMA 1JM7B 2CRWA 2VP7A 2MA6A 2YUCA
chains in the Genus database with same CATH topology
2DJAA 2YREA 2JUNA 2RR4A 3MDBC 2LAUA 1DCQA 2EGMA 3FM8C 3O47A 4F1PA 2CONA 2JM3A 3DWDA 3T9KA 2M13A 2YVRA 2MKEA 3LVQE 4H9DA 4Z0OA 2E61A 2XP0A 2XOZA 2CSVA 2OWAA 5SVXA 3E2DA 3M7KA 2XOYA 3SUBA 2XOCA 3Q1DA 3LJUX 5K3QA 3KDEC 2CRRA 3JUEA 2IQJA 5SVIA 3FEHA 3H7HA 5SVYA 3LVRE 5SVIB 2KKXA 3DDTA 4O62A 2KKYA 4OGCA 4Z0RA 4QQ4A 2D8UA 3FJUB 2EXUA 2CRWA 2FFWA 3PLWA 4OGEA 2L7PA 2FD4A 3LDYA 2P57A 2B0OE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJA A;  2JUN A;  3DDT A;  3Q1D A;  5K3Q A;  2YVR A;  2D8U A;  2EGM A;  2CSV A; 
#chains in the Genus database with same CATH topology
 5DKA A;  2DX8 A;  4YAT A;  2Y1N A;  3FAO A;  1MBM A;  3DWD A;  3O35 A;  2YUR A;  5LKZ A;  3ASL A;  2E61 A;  2L5U A;  4ZDT A;  2KGI A;  1MM2 A;  5LKU A;  4ZUX U;  1N87 A;  4CCG X;  3MHH A;  2MD7 B;  5SVI B;  4R7E A;  2K1J A;  3HCS A;  2MT5 A;  2YHN A;  1E4U A;  4AVX A;  2LDR A;  2RR4 A;  2CKL B;  3M63 A;  4LLB A;  4YBS A;  5H1U A;  4Q6F A;  1X4J A;  4BBQ A;  5D1K B;  5H1T A;  1Z2Q A;  1Z6U A;  2PNX A;  4V3L C;  3FAN A;  2XOZ A;  5I3L A;  5TDR A;  3M7K A;  3O33 A;  3QZV A;  5SVI A;  2ECV A;  1X4U A;  2JRJ A;  4O62 A;  2KKY A;  1WEM A;  4W4U A;  3LDY A;  2CKL A;  2JUN A;  1RMD A;  3KQI A;  2ZET C;  5B77 A;  2Y1M A;  2KRE A;  4XI1 A;  4H9D A;  3U5O A;  2JMJ A;  3MHS A;  3N9O A;  1ZBD B;  3SOU A;  2CRR A;  5H9M A;  1XWH A;  1BOR A;  5AIT A;  3DDT A;  4YAD A;  1WE9 A;  4L58 A;  4IC3 A;  4N3W A;  2RSD A;  4LK9 A;  4N4F A;  4NN2 A;  4YBM A;  3SHB A;  2ECW A;  2LQ6 A;  2K4D A;  2EGP A;  2KYU A;  3KDE C;  5EYA F;  2LV9 A;  3FEH A;  4X3G A;  2CSY A;  3LVR E;  2LGL A;  1WIL A;  1IYM A;  2L0B A;  4LJN A;  3RTR B;  5LKX A;  1FBV A;  2RI7 A;  3T6R A;  5LKT A;  3LQJ A;  2C2V S;  4I7D A;  2KGG A;  4I7C A;  3KV5 A;  2CSV A;  2EA6 A;  2OWA A;  3SOX A;  2FUU A;  2LXP C;  3SUB A;  1T1H A;  4P5O B;  3N9N A;  4OGC A;  2LGG A;  1VFY A;  2FFW A;  4A4B A;  4GNE A;  3HCU A;  1DVP A;  4FO9 A;  3L11 A;  3GL6 A;  5C13 A;  3O47 A;  2LGV A;  2YSJ A;  2XEU A;  2YW8 A;  4GNG A;  5KH3 A;  4LKA A;  2D8S A;  2LRI C;  3O37 A;  4A0C D;  1WIM A;  2BAY A;  2E6R A;  3N9L A;  2KWN A;  3M62 A;  1WEO A;  3O34 A;  2MD8 C;  4A49 A;  2CON A;  1VD4 A;  2YVR A;  2VPE A;  2XB1 A;  2XP0 A;  4B86 C;  2XOY A;  1WEN A;  4MSX A;  1WEP A;  1HYJ A;  4AYC A;  3ZNI A;  2MA5 A;  5D1L B;  2PUY A;  4QQ4 A;  3PUR A;  4AUQ B;  2YRE A;  2G43 A;  5TDW A;  2LAU A;  1DCQ A;  1WEE A;  4UP0 A;  2QIZ A;  2KE1 A;  3C6W A;  4R8P K;  1U6G B;  2YHO A;  1V87 A;  3NG2 A;  3IHP A;  5G0F A;  3LQH A;  2L43 A;  4FIP A;  3EB6 A;  4OGE A;  3MDB C;  5B75 A;  3ZPV 1;  5D1M B;  4S3O B;  2VPG A;  3N9P A;  3L1Z B;  4C9Z A;  5G04 B;  2M13 A;  4F52 B;  4Z0O A;  2Y43 A;  3O36 A;  1VYX A;  3ZVY A;  5JG6 A;  1LDK C;  2MIQ A;  4PTB A;  3O70 A;  5AIU A;  4YBT A;  3ZVZ B;  2ECG A;  2D8U A;  2VJE A;  3VK6 A;  5B8D A;  2VJF A;  2VPB A;  3RPG C;  4WZ2 A;  3O7A A;  2G6Q A;  1WEU A;  2KU3 A;  3T9K A;  2MNY A;  3GV4 A;  4FK5 A;  4GND A;  2LXH C;  4GB0 A;  3U5M A;  2F6N A;  5B78 A;  2KR4 A;  4WZ0 A;  2I50 A;  2C2L A;  3LJU X;  3T7L A;  2YYR A;  3PHD A;  2CT2 A;  2KWJ A;  2VNF A;  2M3H A;  3PLW A;  2EXU A;  4V3K C;  4LAD B;  5C11 A;  1WEQ A;  2DJA A;  4GNF A;  2JM3 A;  2FSA A;  3U5P A;  2JMD A;  5FEY A;  4YC9 A;  4UI9 B;  5J3X A;  3RPG B;  2M85 A;  4IC2 A;  4O64 A;  3Q1D A;  4AP4 A;  5K3Q A;  2ECI A;  4CA1 A;  1F62 A;  4BHW A;  5SVY A;  4AYC B;  2VPD A;  2P57 A;  2B0O E;  1JOC A;  3KV6 A;  5TAB A;  5FB0 A;  5G05 B;  3EB5 A;  2QJ0 A;  2F6J A;  4F1P A;  3M99 A;  1WFK A;  1X4I A;  2LN0 A;  2ECT A;  3PUQ A;  2MKE A;  2YT5 A;  3C5K A;  4I7B A;  2L80 A;  3DQV R;  1Z60 A;  5SVX A;  2K17 A;  2KWO A;  2M1R A;  3JUE A;  2E6S A;  2IQJ A;  4L7X A;  4S3O C;  4WA6 A;  1JM7 A;  2HYE D;  4Z0R A;  3HCT A;  2G45 A;  2EOD A;  4UP5 A;  5B79 A;  5H1V A;  4B7Y C;  3HTK C;  2EGM A;  2YSM A;  3LRQ A;  2YU4 A;  4TKP B;  2IDA A;  4YAX A;  3KNV A;  2K16 A;  1CHC A;  4WZ3 B;  1WES A;  1G25 A;  1WEV A;  5KH7 A;  5DIN A;  2H0D B;  3FJU B;  4A4C A;  2VJE B;  5LCW B;  2VJF B;  1LDJ B;  3LQI A;  1HYI A;  2L75 A;  4MVT A;  2JMI A;  3SOW A;  2AN6 A;  5FB1 A;  3FL2 A;  2YQM A;  1FP0 A;  4ZQL A;  5KH9 A;  2LGK A;  3I2D A;  2H0D A;  2HDP A;  3ZYQ A;  3ZPV E;  4QF3 A;  5B76 A;  3LVQ E;  1WGM A;  3N9Q A;  3L1X A;  2MNZ A;  2KFT A;  3V43 A;  2KWK A;  2DSM A;  3DPL R;  2NAA A;  2FUI A;  1K2F A;  2QIC A;  3U5N A;  3E2D A;  4PPE A;  2M6M A;  4QF2 A;  3H7H A;  2KIZ A;  5TBN A;  5FER A;  4FJC A;  3ZTG A;  2KKX A;  2F42 A;  2OXQ C;  2L7P A;  2FD4 A;  4R2Y A;  2YQL A;  3FM8 C;  1WEW A;  1MM3 A;  5TRB A;  2ECJ A;  3N9M A;  2CSZ A;  2XOC A;  2ECN A;  2UZG A;  4YAB A;  2MUM A;  1JM7 B;  2CRW A;  2VP7 A;  2MA6 A;  2YUC A; 
#chains in the Genus database with same CATH homology
 2DJA A;  2YRE A;  2JUN A;  2RR4 A;  3MDB C;  2LAU A;  1DCQ A;  2EGM A;  3FM8 C;  3O47 A;  4F1P A;  2CON A;  2JM3 A;  3DWD A;  3T9K A;  2M13 A;  2YVR A;  2MKE A;  3LVQ E;  4H9D A;  4Z0O A;  2E61 A;  2XP0 A;  2XOZ A;  2CSV A;  2OWA A;  5SVX A;  3E2D A;  3M7K A;  2XOY A;  3SUB A;  2XOC A;  3Q1D A;  3LJU X;  5K3Q A;  3KDE C;  2CRR A;  3JUE A;  2IQJ A;  5SVI A;  3FEH A;  3H7H A;  5SVY A;  3LVR E;  5SVI B;  2KKX A;  3DDT A;  4O62 A;  2KKY A;  4OGC A;  4Z0R A;  4QQ4 A;  2D8U A;  3FJU B;  2EXU A;  2CRW A;  2FFW A;  3PLW A;  4OGE A;  2L7P A;  2FD4 A;  3LDY A;  2P57 A;  2B0O E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...