2YVRA

Crystal structure of ms1043
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
45
structure length
45
Chain Sequence
GERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MS1043
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Transcription intermediary factor 1-beta
total genus 12
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2yvrA00
2D8UA 2JUNA 2CSVA 3DDTA 2DJAA 3Q1DA 5K3QA 2YVRA 2EGMA
chains in the Genus database with same CATH superfamily
2QJ0A 1N87A 5C13A 2YHNA 2K4DA 4YAXA 2EXUA 5LKTA 1WEQA 2Y1MA 2YYRA 2EGMA 4S3OB 2L43A 2CSZA 1Z60A 2RI7A 2KU3A 2KIZA 2ECJA 3EB6A 4XI1A 3SOXA 4Z0OA 5AIUA 5SVYA 2RR4A 1T1HA 2M3HA 5TRBA 1X4IA 2KR4A 2LGVA 2YHOA 3RTRB 5LKZA 3SOWA 1X4UA 1HYJA 1WGMA 4GNFA 2F6NA 2QICA 3O47A 4YBMA 1WILA 4YBSA 2IQJA 3T9KA 4B7YC 4UP0A 2FFWA 4LK9A 5B79A 2KKYA 4BHWA 4O64A 4LADB 4A49A 5B75A 3KDEC 2DSMA 4ZUXU 2XOZA 2HDPA 2H0DB 2YURA 2VPDA 3FM8C 3O34A 3MHSA 5FERA 2YVRA 2P57A 3PUQA 4S3OC 2M13A 5B78A 1RMDA 3EB5A 2PUYA 3PLWA 3DWDA 4BBQA 1CHCA 5B77A 2MUMA 5DINA 5LKUA 2VPEA 2AN6A 3U5PA 3LQHA 4R2YA 4ZQLA 3LQJA 5LKXA 1VYXA 1MBMA 1VD4A 2MT5A 2JMIA 3ASLA 3N9LA 4A4BA 2L0BA 2NAAA 2LAUA 1WEVA 5DKAA 3ZVYA 2ZETC 3T6RA 2LGKA 4V3KC 4FO9A 1Z6UA 5G05B 3ZTGA 4QF2A 4W4UA 2JUNA 5I3LA 3LVRE 2FSAA 3U5NA 5H1TA 1V87A 2VJFB 2YSMA 2L75A 2VPBA 4CA1A 2KWNA 4YBTA 3LDYA 2RSDA 4QF3A 2KE1A 3LQIA 2VJFA 2OWAA 4GNGA 4QQ4A 3ZNIA 3LJUX 3U5OA 1MM3A 3U5MA 5KH3A 2VJEA 1LDKC 1WIMA 1FBVA 3Q1DA 2VJEB 5KH9A 4L7XA 3IHPA 3N9MA 2G45A 3O36A 4ZDTA 2ECNA 3HTKC 1WE9A 2F42A 2OXQC 4F52B 1U6GB 2KGGA 3L1XA 2LXHC 5FEYA 3SOUA 1WESA 4I7DA 4AYCB 2CT2A 1WEPA 3O35A 3N9NA 1WEWA 1ZBDB 4FJCA 4OGCA 4LLBA 2CKLA 2E6RA 2CRRA 2JRJA 4F1PA 2E6SA 2I50A 5TBNA 4WZ2A 2F6JA 2YQMA 2H0DA 1HYIA 3E2DA 4N3WA 3LRQA 5K3QA 3I2DA 2UZGA 2PNXA 2CONA 4H9DA 2L5UA 4AVXA 3DPLR 4A0CD 1JOCA 4GNEA 4B86C 4WZ0A 2D8UA 5H1UA 2ECTA 3FAOA 3RPGB 2XOYA 5FB1A 3M63A 3DQVR 3FANA 5D1LB 2LN0A 1DCQA 2M1RA 3ZPV1 4LKAA 3M99A 3SUBA 4L58A 5C11A 2DJAA 2MA5A 2CSYA 3O70A 4P5OB 5J3XA 2MKEA 4UP5A 1XWHA 2L7PA 2LRIC 2KKXA 4PTBA 2YSJA 4YC9A 2XP0A 1MM2A 2LGLA 4WZ3B 4FIPA 3LVQE 2YREA 5SVIA 3GV4A 3RPGC 2YT5A 2G43A 4V3LC 2HYED 2LQ6A 5G0FA 2CRWA 4LJNA 4YATA 2VPGA 3PURA 4N4FA 4MVTA 1WEUA 2ECIA 2L80A 5FB0A 4GNDA 2C2LA 2VP7A 3FJUB 2KWKA 4AUQB 4TKPB 1F62A 1Z2QA 2KREA 2KWOA 2KGIA 1LDJB 1G25A 2CSVA 4Z0RA 4CCGX 2D8SA 5LCWB 2YUCA 3H7HA 2BAYA 5KH7A 5D1KB 3L11A 4Q6FA 4I7BA 3T7LA 3DDTA 2Y43A 3QZVA 2KYUA 2XEUA 2JM3A 2K1JA 2LDRA 5JG6A 3FL2A 2K17A 3C5KA 4MSXA 2FUUA 2ECGA 2G6QA 5H1VA 5SVIB 4R7EA 2EA6A 4X3GA 2LXPC 2MD7B 3SHBA 4GB0A 3VK6A 3HCSA 4I7CA 2IDAA 3HCTA 5TABA 4YABA 3C6WA 2FUIA 1BORA 1JM7B 3PHDA 2KWJA 5B8DA 2JMDA 2XB1A 3O37A 5AITA 5B76A 3MHHA 2M85A 2E61A 3N9OA 3KQIA 4R8PK 3V43A 3M62A 1WEOA 2YW8A 4UI9B 2QIZA 5EYAF 5SVXA 3JUEA 1WEMA 2LGGA 2DX8A 2MIQA 1DVPA 2LV9A 2MNYA 3KNVA 3GL6A 2C2VS 1FP0A 3MDBC 1VFYA 5D1MB 2B0OE 3ZYQA 4O62A 1WFKA 4YADA 2MD8C 1WENA 2EODA 4PPEA 2JMJA 2VNFA 5TDWA 2FD4A 4AP4A 3NG2A 4A4CA 2MNZA 3O33A 4IC3A 3N9PA 3L1ZB 2ECWA 3N9QA 2M6MA 2Y1NA 3ZPVE 1X4JA 3ZVZB 4OGEA 2YU4A 5TDRA 2YQLA 4FK5A 4NN2A 3O7AA 3KV6A 4C9ZA 4AYCA 4WA6A 2KFTA 3HCUA 2EGPA 2ECVA 5H9MA 1WEEA 3M7KA 1K2FA 1E4UA 3FEHA 3KV5A 5G04B 2XOCA 2CKLB 1JM7A 1IYMA 2MA6A 4IC2A 2K16A
chains in the Genus database with same CATH topology
2D8UA 4F1PA 3FM8C 3H7HA 3LDYA 2YVRA 2P57A 2MKEA 5SVIB 2M13A 2XOYA 2E61A 2CRWA 3MDBC 2OWAA 3E2DA 2L7PA 2LAUA 3DDTA 2EXUA 2B0OE 3PLWA 4QQ4A 5K3QA 3LJUX 3DWDA 3O47A 2KKXA 2EGMA 4O62A 3FJUB 1DCQA 2IQJA 2CONA 3T9KA 3M7KA 3FEHA 2FFWA 3Q1DA 2JM3A 4H9DA 5SVXA 2XP0A 2XOZA 2KKYA 2XOCA 3JUEA 3SUBA 2FD4A 2JUNA 2CSVA 4Z0RA 3LVRE 4Z0OA 4OGEA 5SVYA 2DJAA 2RR4A 3KDEC 3LVQE 4OGCA 2YREA 5SVIA 2CRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8U A;  2JUN A;  2CSV A;  3DDT A;  2DJA A;  3Q1D A;  5K3Q A;  2YVR A;  2EGM A; 
#chains in the Genus database with same CATH topology
 2QJ0 A;  1N87 A;  5C13 A;  2YHN A;  2K4D A;  4YAX A;  2EXU A;  5LKT A;  1WEQ A;  2Y1M A;  2YYR A;  2EGM A;  4S3O B;  2L43 A;  2CSZ A;  1Z60 A;  2RI7 A;  2KU3 A;  2KIZ A;  2ECJ A;  3EB6 A;  4XI1 A;  3SOX A;  4Z0O A;  5AIU A;  5SVY A;  2RR4 A;  1T1H A;  2M3H A;  5TRB A;  1X4I A;  2KR4 A;  2LGV A;  2YHO A;  3RTR B;  5LKZ A;  3SOW A;  1X4U A;  1HYJ A;  1WGM A;  4GNF A;  2F6N A;  2QIC A;  3O47 A;  4YBM A;  1WIL A;  4YBS A;  2IQJ A;  3T9K A;  4B7Y C;  4UP0 A;  2FFW A;  4LK9 A;  5B79 A;  2KKY A;  4BHW A;  4O64 A;  4LAD B;  4A49 A;  5B75 A;  3KDE C;  2DSM A;  4ZUX U;  2XOZ A;  2HDP A;  2H0D B;  2YUR A;  2VPD A;  3FM8 C;  3O34 A;  3MHS A;  5FER A;  2YVR A;  2P57 A;  3PUQ A;  4S3O C;  2M13 A;  5B78 A;  1RMD A;  3EB5 A;  2PUY A;  3PLW A;  3DWD A;  4BBQ A;  1CHC A;  5B77 A;  2MUM A;  5DIN A;  5LKU A;  2VPE A;  2AN6 A;  3U5P A;  3LQH A;  4R2Y A;  4ZQL A;  3LQJ A;  5LKX A;  1VYX A;  1MBM A;  1VD4 A;  2MT5 A;  2JMI A;  3ASL A;  3N9L A;  4A4B A;  2L0B A;  2NAA A;  2LAU A;  1WEV A;  5DKA A;  3ZVY A;  2ZET C;  3T6R A;  2LGK A;  4V3K C;  4FO9 A;  1Z6U A;  5G05 B;  3ZTG A;  4QF2 A;  4W4U A;  2JUN A;  5I3L A;  3LVR E;  2FSA A;  3U5N A;  5H1T A;  1V87 A;  2VJF B;  2YSM A;  2L75 A;  2VPB A;  4CA1 A;  2KWN A;  4YBT A;  3LDY A;  2RSD A;  4QF3 A;  2KE1 A;  3LQI A;  2VJF A;  2OWA A;  4GNG A;  4QQ4 A;  3ZNI A;  3LJU X;  3U5O A;  1MM3 A;  3U5M A;  5KH3 A;  2VJE A;  1LDK C;  1WIM A;  1FBV A;  3Q1D A;  2VJE B;  5KH9 A;  4L7X A;  3IHP A;  3N9M A;  2G45 A;  3O36 A;  4ZDT A;  2ECN A;  3HTK C;  1WE9 A;  2F42 A;  2OXQ C;  4F52 B;  1U6G B;  2KGG A;  3L1X A;  2LXH C;  5FEY A;  3SOU A;  1WES A;  4I7D A;  4AYC B;  2CT2 A;  1WEP A;  3O35 A;  3N9N A;  1WEW A;  1ZBD B;  4FJC A;  4OGC A;  4LLB A;  2CKL A;  2E6R A;  2CRR A;  2JRJ A;  4F1P A;  2E6S A;  2I50 A;  5TBN A;  4WZ2 A;  2F6J A;  2YQM A;  2H0D A;  1HYI A;  3E2D A;  4N3W A;  3LRQ A;  5K3Q A;  3I2D A;  2UZG A;  2PNX A;  2CON A;  4H9D A;  2L5U A;  4AVX A;  3DPL R;  4A0C D;  1JOC A;  4GNE A;  4B86 C;  4WZ0 A;  2D8U A;  5H1U A;  2ECT A;  3FAO A;  3RPG B;  2XOY A;  5FB1 A;  3M63 A;  3DQV R;  3FAN A;  5D1L B;  2LN0 A;  1DCQ A;  2M1R A;  3ZPV 1;  4LKA A;  3M99 A;  3SUB A;  4L58 A;  5C11 A;  2DJA A;  2MA5 A;  2CSY A;  3O70 A;  4P5O B;  5J3X A;  2MKE A;  4UP5 A;  1XWH A;  2L7P A;  2LRI C;  2KKX A;  4PTB A;  2YSJ A;  4YC9 A;  2XP0 A;  1MM2 A;  2LGL A;  4WZ3 B;  4FIP A;  3LVQ E;  2YRE A;  5SVI A;  3GV4 A;  3RPG C;  2YT5 A;  2G43 A;  4V3L C;  2HYE D;  2LQ6 A;  5G0F A;  2CRW A;  4LJN A;  4YAT A;  2VPG A;  3PUR A;  4N4F A;  4MVT A;  1WEU A;  2ECI A;  2L80 A;  5FB0 A;  4GND A;  2C2L A;  2VP7 A;  3FJU B;  2KWK A;  4AUQ B;  4TKP B;  1F62 A;  1Z2Q A;  2KRE A;  2KWO A;  2KGI A;  1LDJ B;  1G25 A;  2CSV A;  4Z0R A;  4CCG X;  2D8S A;  5LCW B;  2YUC A;  3H7H A;  2BAY A;  5KH7 A;  5D1K B;  3L11 A;  4Q6F A;  4I7B A;  3T7L A;  3DDT A;  2Y43 A;  3QZV A;  2KYU A;  2XEU A;  2JM3 A;  2K1J A;  2LDR A;  5JG6 A;  3FL2 A;  2K17 A;  3C5K A;  4MSX A;  2FUU A;  2ECG A;  2G6Q A;  5H1V A;  5SVI B;  4R7E A;  2EA6 A;  4X3G A;  2LXP C;  2MD7 B;  3SHB A;  4GB0 A;  3VK6 A;  3HCS A;  4I7C A;  2IDA A;  3HCT A;  5TAB A;  4YAB A;  3C6W A;  2FUI A;  1BOR A;  1JM7 B;  3PHD A;  2KWJ A;  5B8D A;  2JMD A;  2XB1 A;  3O37 A;  5AIT A;  5B76 A;  3MHH A;  2M85 A;  2E61 A;  3N9O A;  3KQI A;  4R8P K;  3V43 A;  3M62 A;  1WEO A;  2YW8 A;  4UI9 B;  2QIZ A;  5EYA F;  5SVX A;  3JUE A;  1WEM A;  2LGG A;  2DX8 A;  2MIQ A;  1DVP A;  2LV9 A;  2MNY A;  3KNV A;  3GL6 A;  2C2V S;  1FP0 A;  3MDB C;  1VFY A;  5D1M B;  2B0O E;  3ZYQ A;  4O62 A;  1WFK A;  4YAD A;  2MD8 C;  1WEN A;  2EOD A;  4PPE A;  2JMJ A;  2VNF A;  5TDW A;  2FD4 A;  4AP4 A;  3NG2 A;  4A4C A;  2MNZ A;  3O33 A;  4IC3 A;  3N9P A;  3L1Z B;  2ECW A;  3N9Q A;  2M6M A;  2Y1N A;  3ZPV E;  1X4J A;  3ZVZ B;  4OGE A;  2YU4 A;  5TDR A;  2YQL A;  4FK5 A;  4NN2 A;  3O7A A;  3KV6 A;  4C9Z A;  4AYC A;  4WA6 A;  2KFT A;  3HCU A;  2EGP A;  2ECV A;  5H9M A;  1WEE A;  3M7K A;  1K2F A;  1E4U A;  3FEH A;  3KV5 A;  5G04 B;  2XOC A;  2CKL B;  1JM7 A;  1IYM A;  2MA6 A;  4IC2 A;  2K16 A; 
#chains in the Genus database with same CATH homology
 2D8U A;  4F1P A;  3FM8 C;  3H7H A;  3LDY A;  2YVR A;  2P57 A;  2MKE A;  5SVI B;  2M13 A;  2XOY A;  2E61 A;  2CRW A;  3MDB C;  2OWA A;  3E2D A;  2L7P A;  2LAU A;  3DDT A;  2EXU A;  2B0O E;  3PLW A;  4QQ4 A;  5K3Q A;  3LJU X;  3DWD A;  3O47 A;  2KKX A;  2EGM A;  4O62 A;  3FJU B;  1DCQ A;  2IQJ A;  2CON A;  3T9K A;  3M7K A;  3FEH A;  2FFW A;  3Q1D A;  2JM3 A;  4H9D A;  5SVX A;  2XP0 A;  2XOZ A;  2KKY A;  2XOC A;  3JUE A;  3SUB A;  2FD4 A;  2JUN A;  2CSV A;  4Z0R A;  3LVR E;  4Z0O A;  4OGE A;  5SVY A;  2DJA A;  2RR4 A;  3KDE C;  3LVQ E;  4OGC A;  2YRE A;  5SVI A;  2CRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...