2YVRA

Crystal structure of ms1043
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
45
structure length
45
Chain Sequence
GERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription intermediary factor 1-beta
publication title Crystal structure of MS1043
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 12
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2yvrA00
2JUNA 3Q1DA 5K3QA 2DJAA 3DDTA 2YVRA 2EGMA 2D8UA 2CSVA
chains in the Genus database with same CATH superfamily
2LN0A 2EGPA 2KKYA 2ECIA 2VPEA 5G0FA 4YBMA 2L5UA 2H0DB 5J3XA 2P57A 3MDBC 4P5OB 1VD4A 2XOZA 3ZNIA 2ECWA 2MIQA 4C9ZA 1N87A 4LK9A 2HDPA 4CCGX 4V3KC 2VPBA 3L11A 2YURA 4YBSA 5KH7A 3LDYA 5JG6A 4IC2A 2ECGA 1T1HA 1WEWA 2G45A 2KU3A 3HCSA 3O33A 1X4UA 2JRJA 4AYCB 5FERA 2JMJA 2PNXA 2OWAA 3HCUA 1WFKA 4GNEA 4BHWA 2VJEA 1K2FA 2K1JA 2AN6A 2G6QA 3KV5A 4I7DA 4B7YC 3MHSA 4N3WA 2ECJA 3SHBA 3KV6A 3O37A 1X4JA 3LQHA 2YQMA 3N9NA 2QICA 2VJEB 3RTRB 5TDWA 2RI7A 5C11A 5B8DA 5G04B 4FJCA 3C5KA 5AITA 3JUEA 4S3OB 1FP0A 3DDTA 4GNFA 3L1XA 1XWHA 5TRBA 3RPGC 4S3OC 3ASLA 4YC9A 1VFYA 4I7BA 4I7CA 1WIMA 2YU4A 1V87A 2MD7B 3SOXA 2Y1NA 4A49A 5LKUA 3ZYQA 2DX8A 2LGLA 2FSAA 2MA5A 2CT2A 2KGIA 2CRWA 2K16A 3N9QA 3O36A 2LV9A 5LKZA 4MSXA 5B78A 3N9PA 2YYRA 4Q6FA 2VNFA 2VPGA 5B77A 5D1LB 2G43A 3FL2A 2DJAA 2YT5A 1WEOA 2L75A 4BBQA 3LVQE 5B79A 4LLBA 2E6SA 3LQJA 3U5OA 3T7LA 2JMIA 2LQ6A 2ECNA 4ZDTA 2KWNA 1Z60A 2KWOA 2KFTA 4AUQB 2L80A 5G05B 2EA6A 3GL6A 2YW8A 4L7XA 3KDEC 2RSDA 2CKLA 5I3LA 2KR4A 1Z2QA 3SOUA 4LKAA 4OGCA 4GNGA 5H1UA 1HYIA 2FUIA 2KIZA 4L58A 2XOCA 4F1PA 5SVIA 3QZVA 2NAAA 2D8SA 4X3GA 1DCQA 2KKXA 5AIUA 3I2DA 4LJNA 2FUUA 4AVXA 2YSMA 2YSJA 1RMDA 1WESA 4O62A 2L43A 3V43A 5FB0A 2YQLA 2M1RA 2EGMA 4FIPA 5FB1A 2MA6A 5SVIB 2LXPC 2MNZA 1VYXA 2KE1A 2MNYA 2XB1A 3FANA 3ZVZB 4B86C 4WZ0A 3ZVYA 1JM7A 2ECTA 4ZUXU 2B0OE 3ZPVE 2CRRA 5KH3A 4AP4A 2FFWA 2QIZA 2E61A 2LGKA 4F52B 2KGGA 2KYUA 2Y43A 3KQIA 4W4UA 3DPLR 1FBVA 2YVRA 1JM7B 4PPEA 4NN2A 1WENA 5SVYA 2LXHC 4WZ3B 5DKAA 2CSZA 3PLWA 1WEQA 4UP0A 5B76A 3O34A 3N9OA 1CHCA 2EODA 2KWJA 2M85A 2IQJA 3ZTGA 5B75A 3VK6A 2LGGA 1MM3A 3M7KA 2OXQC 4YATA 2YREA 1LDJB 3O47A 1BORA 2JM3A 3M62A 4YADA 3E2DA 4FK5A 2JUNA 2CSYA 2LGVA 3M63A 2KWKA 4TKPB 1LDKC 5FEYA 5K3QA 3U5MA 4Z0OA 3PUQA 2DSMA 3T6RA 4QF3A 2LDRA 3FM8C 4MVTA 2CSVA 4N4FA 4GB0A 2M6MA 2E6RA 3O70A 5D1MB 4OGEA 2Y1MA 5DINA 3C6WA 1WEEA 2YHOA 5TABA 4A0CD 4CA1A 1WEUA 2C2VS 2HYED 3O35A 3O7AA 2K4DA 2VP7A 4IC3A 2IDAA 3Q1DA 2K17A 5SVXA 1F62A 1HYJA 5KH9A 2ECVA 2JMDA 3LRQA 2VJFA 4R7EA 2UZGA 2BAYA 1X4IA 4QQ4A 4R8PK 3PHDA 3SUBA 2D8UA 4FO9A 3M99A 4PTBA 2CKLB 2CONA 5LKXA 1G25A 3IHPA 4V3LC 2VJFB 3LJUX 3N9LA 4AYCA 3FAOA 3EB5A 4O64A 4WZ2A 4A4CA 3U5NA 3SOWA 2VPDA 2XOYA 1WILA 3FEHA 2ZETC 1Z6UA 4UI9B 5C13A 2MT5A 3LQIA 2PUYA 4YAXA 2EXUA 5TDRA 2M13A 4UP5A 3GV4A 3ZPV1 1E4UA 1MM2A 2XP0A 3FJUB 3HTKC 4YBTA 2KREA 2F6JA 2LRIC 4Z0RA 2MUMA 3EB6A 1WEMA 1DVPA 2MKEA 3T9KA 2XEUA 3RPGB 5D1KB 2C2LA 3N9MA 1WE9A 4A4BA 4LADB 2RR4A 2L7PA 4WA6A 4H9DA 2MD8C 5H1TA 1WEPA 4XI1A 1WEVA 2YHNA 5H9MA 1JOCA 3H7HA 5LKTA 1ZBDB 3L1ZB 1WGMA 5EYAF 5LCWB 2FD4A 2L0BA 4ZQLA 2F6NA 2QJ0A 3LVRE 5TBNA 1MBMA 4R2YA 3HCTA 2YUCA 1IYMA 4QF2A 4YABA 1U6GB 5H1VA 3DWDA 2F42A 2I50A 3KNVA 3PURA 2LAUA 2H0DA 3MHHA 4GNDA 3U5PA 3NG2A 3DQVR 2M3HA
chains in the Genus database with same CATH topology
2OWAA 3H7HA 2CRRA 3KDEC 3Q1DA 3M7KA 2KKYA 2FFWA 2EXUA 2E61A 2MKEA 2EGMA 3LJUX 2FD4A 3FM8C 5SVXA 3T9KA 2M13A 2CSVA 3LVQE 2YREA 3LVRE 5SVIB 3O47A 3JUEA 4OGCA 3DDTA 2JM3A 2YVRA 3LDYA 2CRWA 3E2DA 2XP0A 4OGEA 3FJUB 2XOCA 2RR4A 2JUNA 2P57A 3DWDA 2XOYA 5SVIA 3MDBC 5SVYA 2L7PA 2XOZA 4QQ4A 4F1PA 1DCQA 2KKXA 3FEHA 3PLWA 2LAUA 3SUBA 2D8UA 4H9DA 4Z0RA 5K3QA 2B0OE 2IQJA 4Z0OA 2CONA 4O62A 2DJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JUN A;  3Q1D A;  5K3Q A;  2DJA A;  3DDT A;  2YVR A;  2EGM A;  2D8U A;  2CSV A; 
#chains in the Genus database with same CATH topology
 2LN0 A;  2EGP A;  2KKY A;  2ECI A;  2VPE A;  5G0F A;  4YBM A;  2L5U A;  2H0D B;  5J3X A;  2P57 A;  3MDB C;  4P5O B;  1VD4 A;  2XOZ A;  3ZNI A;  2ECW A;  2MIQ A;  4C9Z A;  1N87 A;  4LK9 A;  2HDP A;  4CCG X;  4V3K C;  2VPB A;  3L11 A;  2YUR A;  4YBS A;  5KH7 A;  3LDY A;  5JG6 A;  4IC2 A;  2ECG A;  1T1H A;  1WEW A;  2G45 A;  2KU3 A;  3HCS A;  3O33 A;  1X4U A;  2JRJ A;  4AYC B;  5FER A;  2JMJ A;  2PNX A;  2OWA A;  3HCU A;  1WFK A;  4GNE A;  4BHW A;  2VJE A;  1K2F A;  2K1J A;  2AN6 A;  2G6Q A;  3KV5 A;  4I7D A;  4B7Y C;  3MHS A;  4N3W A;  2ECJ A;  3SHB A;  3KV6 A;  3O37 A;  1X4J A;  3LQH A;  2YQM A;  3N9N A;  2QIC A;  2VJE B;  3RTR B;  5TDW A;  2RI7 A;  5C11 A;  5B8D A;  5G04 B;  4FJC A;  3C5K A;  5AIT A;  3JUE A;  4S3O B;  1FP0 A;  3DDT A;  4GNF A;  3L1X A;  1XWH A;  5TRB A;  3RPG C;  4S3O C;  3ASL A;  4YC9 A;  1VFY A;  4I7B A;  4I7C A;  1WIM A;  2YU4 A;  1V87 A;  2MD7 B;  3SOX A;  2Y1N A;  4A49 A;  5LKU A;  3ZYQ A;  2DX8 A;  2LGL A;  2FSA A;  2MA5 A;  2CT2 A;  2KGI A;  2CRW A;  2K16 A;  3N9Q A;  3O36 A;  2LV9 A;  5LKZ A;  4MSX A;  5B78 A;  3N9P A;  2YYR A;  4Q6F A;  2VNF A;  2VPG A;  5B77 A;  5D1L B;  2G43 A;  3FL2 A;  2DJA A;  2YT5 A;  1WEO A;  2L75 A;  4BBQ A;  3LVQ E;  5B79 A;  4LLB A;  2E6S A;  3LQJ A;  3U5O A;  3T7L A;  2JMI A;  2LQ6 A;  2ECN A;  4ZDT A;  2KWN A;  1Z60 A;  2KWO A;  2KFT A;  4AUQ B;  2L80 A;  5G05 B;  2EA6 A;  3GL6 A;  2YW8 A;  4L7X A;  3KDE C;  2RSD A;  2CKL A;  5I3L A;  2KR4 A;  1Z2Q A;  3SOU A;  4LKA A;  4OGC A;  4GNG A;  5H1U A;  1HYI A;  2FUI A;  2KIZ A;  4L58 A;  2XOC A;  4F1P A;  5SVI A;  3QZV A;  2NAA A;  2D8S A;  4X3G A;  1DCQ A;  2KKX A;  5AIU A;  3I2D A;  4LJN A;  2FUU A;  4AVX A;  2YSM A;  2YSJ A;  1RMD A;  1WES A;  4O62 A;  2L43 A;  3V43 A;  5FB0 A;  2YQL A;  2M1R A;  2EGM A;  4FIP A;  5FB1 A;  2MA6 A;  5SVI B;  2LXP C;  2MNZ A;  1VYX A;  2KE1 A;  2MNY A;  2XB1 A;  3FAN A;  3ZVZ B;  4B86 C;  4WZ0 A;  3ZVY A;  1JM7 A;  2ECT A;  4ZUX U;  2B0O E;  3ZPV E;  2CRR A;  5KH3 A;  4AP4 A;  2FFW A;  2QIZ A;  2E61 A;  2LGK A;  4F52 B;  2KGG A;  2KYU A;  2Y43 A;  3KQI A;  4W4U A;  3DPL R;  1FBV A;  2YVR A;  1JM7 B;  4PPE A;  4NN2 A;  1WEN A;  5SVY A;  2LXH C;  4WZ3 B;  5DKA A;  2CSZ A;  3PLW A;  1WEQ A;  4UP0 A;  5B76 A;  3O34 A;  3N9O A;  1CHC A;  2EOD A;  2KWJ A;  2M85 A;  2IQJ A;  3ZTG A;  5B75 A;  3VK6 A;  2LGG A;  1MM3 A;  3M7K A;  2OXQ C;  4YAT A;  2YRE A;  1LDJ B;  3O47 A;  1BOR A;  2JM3 A;  3M62 A;  4YAD A;  3E2D A;  4FK5 A;  2JUN A;  2CSY A;  2LGV A;  3M63 A;  2KWK A;  4TKP B;  1LDK C;  5FEY A;  5K3Q A;  3U5M A;  4Z0O A;  3PUQ A;  2DSM A;  3T6R A;  4QF3 A;  2LDR A;  3FM8 C;  4MVT A;  2CSV A;  4N4F A;  4GB0 A;  2M6M A;  2E6R A;  3O70 A;  5D1M B;  4OGE A;  2Y1M A;  5DIN A;  3C6W A;  1WEE A;  2YHO A;  5TAB A;  4A0C D;  4CA1 A;  1WEU A;  2C2V S;  2HYE D;  3O35 A;  3O7A A;  2K4D A;  2VP7 A;  4IC3 A;  2IDA A;  3Q1D A;  2K17 A;  5SVX A;  1F62 A;  1HYJ A;  5KH9 A;  2ECV A;  2JMD A;  3LRQ A;  2VJF A;  4R7E A;  2UZG A;  2BAY A;  1X4I A;  4QQ4 A;  4R8P K;  3PHD A;  3SUB A;  2D8U A;  4FO9 A;  3M99 A;  4PTB A;  2CKL B;  2CON A;  5LKX A;  1G25 A;  3IHP A;  4V3L C;  2VJF B;  3LJU X;  3N9L A;  4AYC A;  3FAO A;  3EB5 A;  4O64 A;  4WZ2 A;  4A4C A;  3U5N A;  3SOW A;  2VPD A;  2XOY A;  1WIL A;  3FEH A;  2ZET C;  1Z6U A;  4UI9 B;  5C13 A;  2MT5 A;  3LQI A;  2PUY A;  4YAX A;  2EXU A;  5TDR A;  2M13 A;  4UP5 A;  3GV4 A;  3ZPV 1;  1E4U A;  1MM2 A;  2XP0 A;  3FJU B;  3HTK C;  4YBT A;  2KRE A;  2F6J A;  2LRI C;  4Z0R A;  2MUM A;  3EB6 A;  1WEM A;  1DVP A;  2MKE A;  3T9K A;  2XEU A;  3RPG B;  5D1K B;  2C2L A;  3N9M A;  1WE9 A;  4A4B A;  4LAD B;  2RR4 A;  2L7P A;  4WA6 A;  4H9D A;  2MD8 C;  5H1T A;  1WEP A;  4XI1 A;  1WEV A;  2YHN A;  5H9M A;  1JOC A;  3H7H A;  5LKT A;  1ZBD B;  3L1Z B;  1WGM A;  5EYA F;  5LCW B;  2FD4 A;  2L0B A;  4ZQL A;  2F6N A;  2QJ0 A;  3LVR E;  5TBN A;  1MBM A;  4R2Y A;  3HCT A;  2YUC A;  1IYM A;  4QF2 A;  4YAB A;  1U6G B;  5H1V A;  3DWD A;  2F42 A;  2I50 A;  3KNV A;  3PUR A;  2LAU A;  2H0D A;  3MHH A;  4GND A;  3U5P A;  3NG2 A;  3DQV R;  2M3H A; 
#chains in the Genus database with same CATH homology
 2OWA A;  3H7H A;  2CRR A;  3KDE C;  3Q1D A;  3M7K A;  2KKY A;  2FFW A;  2EXU A;  2E61 A;  2MKE A;  2EGM A;  3LJU X;  2FD4 A;  3FM8 C;  5SVX A;  3T9K A;  2M13 A;  2CSV A;  3LVQ E;  2YRE A;  3LVR E;  5SVI B;  3O47 A;  3JUE A;  4OGC A;  3DDT A;  2JM3 A;  2YVR A;  3LDY A;  2CRW A;  3E2D A;  2XP0 A;  4OGE A;  3FJU B;  2XOC A;  2RR4 A;  2JUN A;  2P57 A;  3DWD A;  2XOY A;  5SVI A;  3MDB C;  5SVY A;  2L7P A;  2XOZ A;  4QQ4 A;  4F1P A;  1DCQ A;  2KKX A;  3FEH A;  3PLW A;  2LAU A;  3SUB A;  2D8U A;  4H9D A;  4Z0R A;  5K3Q A;  2B0O E;  2IQJ A;  4Z0O A;  2CON A;  4O62 A;  2DJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...