2EGPA

Solution structure of the ring-finger domain from human tripartite motif protein 34
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
79
structure length
79
Chain Sequence
GSSGSSGNVQEEVTCPICLELLTEPLSLDCGHSLCRACITVSNKEAVTSMGGKSSCPVCGISYSFEHLQANQHLANIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tripartite motif-containing protein 34
publication title Solution structure of the RING-finger domain from human Tripartite motif protein 34
rcsb
source organism Homo sapiens
molecule tags Antiviral protein
total genus 2
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15227 zf-C3HC4_4 zinc finger of C3HC4-type, RING
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2egpA00
4LJNA 4UI9B 4GB0A 1JOCA 2EA6A 4ZQLA 3LQIA 5DKAA 3O35A 4AP4A 3LQJA 3NG2A 2KYUA 2JMDA 1XWHA 4YBSA 2MD8C 1G25A 2H0DA 5J3XA 2DX8A 4A0CD 3KNVA 2L5UA 3EB5A 3U5NA 3SOXA 4FK5A 4L58A 5AIUA 3O70A 2LGKA 2KIZA 4PPEA 2ECTA 5B75A 4PTBA 2ECNA 3T6RA 1E4UA 3O36A 4LKAA 4AYCB 2YSJA 2BAYA 4A49A 5KH3A 5LKUA 3N9MA 1BORA 2E6SA 2LN0A 3HCTA 2YT5A 2YHNA 4GNGA 5AITA 2LV9A 3RPGC 2LGLA 2Y1NA 3DPLR 4F52B 3C5KA 5C11A 2KWNA 2LXPC 5KH7A 1Z6UA 2EODA 4R7EA 2KREA 2FSAA 5FB0A 2YHOA 2NAAA 3I2DA 2LGGA 4XI1A 2ECJA 1X4UA 4I7CA 4GNFA 3O7AA 2AN6A 5D1LB 3ZNIA 1WEUA 3ZVZB 4YC9A 1JM7B 4ZDTA 4GNEA 3T7LA 2ZETC 4TKPB 3LRQA 2VNFA 3KQIA 5FEYA 2JMIA 1WEPA 2K1JA 5FB1A 2CT2A 4N3WA 3PHDA 1WEOA 2F6NA 2Y1MA 3MHHA 5TRBA 2K16A 5B79A 4N4FA 2UZGA 2VJEB 3VK6A 2MT5A 4AYCA 4Q6FA 2G43A 2PNXA 4C9ZA 3QZVA 1VFYA 3ZVYA 4QF2A 3ZPVE 5B77A 3N9NA 2LXHC 5EYAF 3SOUA 1X4JA 2CKLA 2JMJA 1F62A 2C2VS 5KH9A 4FJCA 4P5OB 1FBVA 3ZPV1 4QF3A 2E6RA 2YW8A 3N9OA 4LLBA 1WGMA 2YU4A 1WENA 5LKTA 1WE9A 2L0BA 2LDRA 3PURA 4R8PK 2I50A 4WZ0A 2QJ0A 4YBTA 2YSMA 1WILA 2L43A 2MUMA 3O37A 4UP5A 2PUYA 5H1TA 1HYJA 2KGGA 2VPGA 4I7DA 2MA6A 5TDRA 1ZBDB 5B8DA 2KWOA 2M85A 4I7BA 2M1RA 5TDWA 3LQHA 3PUQA 2VPEA 3M62A 5I3LA 2CSZA 4V3KC 1WEWA 1T1HA 3N9LA 2HDPA 3KV6A 4B86C 3HTKC 2OXQC 2LQ6A 4YATA 3L1XA 4IC3A 2D8SA 2VJEA 3DQVR 1WESA 3MHSA 2YQMA 2MNYA 3U5OA 4L7XA 4YADA 4GNDA 4NN2A 4BBQA 1CHCA 2RI7A 5TABA 1Z2QA 5LKZA 1LDKC 2K4DA 1FP0A 4A4BA 2FUUA 2XEUA 5D1MB 1LDJB 2XB1A 3C6WA 2L75A 5DINA 3HCUA 5B78A 1K2FA 5H1UA 1IYMA 2Y43A 4AVXA 3FL2A 3L11A 2MNZA 4BHWA 2YURA 1WEVA 4W4UA 2ECIA 3N9QA 2MA5A 2IDAA 4LADB 2G45A 2KWKA 3U5PA 5LCWB 4MSXA 2K17A 1WEMA 2M3HA 5D1KB 1RMDA 4WZ3B 1WEEA 5JG6A 4IC2A 4CA1A 2KGIA 2F6JA 4A4CA 3ZYQA 5FERA 3ASLA 5B76A 4FIPA 5H9MA 1X4IA 3O33A 3RTRB 2YREA 3EB6A 1WFKA 4CCGX 4X3GA 1N87A 2FUIA 1WIMA 2RSDA 4B7YC 2VP7A 4YAXA 2L80A 2VJFB 2LGVA 3M63A 2KE1A 4WA6A 4S3OC 2VPDA 1MM2A 1JM7A 3SHBA 5C13A 4WZ2A 3U5MA 2KWJA 2CSYA 5H1VA 2LRIC 2H0DB 2HYED 2YYRA 5G05B 2CKLB 2ECGA 2ECVA 2C2LA 2G6QA 2ECWA 1U6GB 3O34A 4LK9A 2VPBA 1V87A 4AUQB 2F42A 5LKXA 3HCSA 4MVTA 4YBMA 1WEQA 4ZUXU 2MIQA 4V3LC 4S3OB 3V43A 5G0FA 2KFTA 1Z60A 3ZTGA 2JRJA 4R2YA 1DVPA 1VD4A 3GL6A 3KV5A 2KU3A 2M6MA 2QIZA 5G04B 3M99A 5TBNA 3N9PA 3RPGB 2MD7B 4FO9A 2YQLA 3SOWA 2YUCA 4UP0A 2KR4A 3L1ZB 1MM3A 2QICA 3GV4A 1HYIA 3IHPA 2EGPA 4YABA 4O64A 1VYXA 2VJFA
chains in the Genus database with same CATH superfamily
3FANA 2YVRA 4LJNA 4UI9B 4GB0A 1JOCA 2EA6A 3DDTA 4ZQLA 2JM3A 3LQIA 5DKAA 3O35A 4AP4A 3LQJA 3NG2A 2KYUA 2JMDA 1XWHA 2KKXA 4YBSA 2P57A 2MD8C 1G25A 2H0DA 2XP0A 5J3XA 2DX8A 4A0CD 3KNVA 2M13A 2L5UA 3EB5A 3U5NA 3SOXA 4FK5A 4L58A 5AIUA 3O70A 2LGKA 2KIZA 4PPEA 2ECTA 5B75A 4PTBA 2ECNA 3T6RA 1E4UA 2EGMA 2CRRA 3O36A 4LKAA 4AYCB 2YSJA 2BAYA 3T9KA 2CRWA 4A49A 5KH3A 5LKUA 3N9MA 4Z0RA 1BORA 2JUNA 2E6SA 2LN0A 3HCTA 2YT5A 2YHNA 4GNGA 5AITA 2LV9A 3RPGC 2LGLA 2Y1NA 3DPLR 4F52B 3C5KA 5C11A 2KWNA 2LXPC 5KH7A 1Z6UA 2EODA 4R7EA 2KREA 2FSAA 5FB0A 2YHOA 2NAAA 3I2DA 2LGGA 4XI1A 2ECJA 3Q1DA 3LVQE 1X4UA 4I7CA 4GNFA 3O7AA 2AN6A 5D1LB 3ZNIA 1WEUA 3KDEC 3ZVZB 4YC9A 1JM7B 4Z0OA 4ZDTA 4GNEA 3T7LA 2ZETC 4TKPB 3LRQA 2VNFA 3KQIA 2CSVA 5SVIB 5FEYA 2JMIA 1WEPA 2K1JA 5FB1A 2CT2A 4N3WA 3PHDA 1WEOA 2F6NA 2Y1MA 3MHHA 5TRBA 2K16A 5B79A 4N4FA 2UZGA 2VJEB 3VK6A 2MT5A 4AYCA 4Q6FA 2G43A 2EXUA 2PNXA 4C9ZA 3QZVA 1VFYA 3ZVYA 4QF2A 3ZPVE 5B77A 3N9NA 2CONA 2LXHC 5EYAF 1DCQA 3SOUA 3M7KA 1X4JA 2CKLA 2JMJA 1F62A 4OGCA 2C2VS 5KH9A 4FJCA 4P5OB 1FBVA 3ZPV1 4F1PA 4QF3A 3FAOA 2E6RA 2YW8A 3N9OA 4LLBA 1WGMA 2YU4A 1WENA 5LKTA 1WE9A 2L0BA 2XOCA 2LDRA 3PURA 4R8PK 2I50A 4WZ0A 3E2DA 2QJ0A 4YBTA 2YSMA 1WILA 3MDBC 2L43A 2MUMA 3O37A 4UP5A 3PLWA 2PUYA 5H1TA 1HYJA 2KGGA 2VPGA 4I7DA 2MA6A 4O62A 2L7PA 2D8UA 5TDRA 1ZBDB 3LVRE 5B8DA 2KWOA 2M85A 4I7BA 3H7HA 2M1RA 5TDWA 3LQHA 3PUQA 2OWAA 2VPEA 3M62A 5I3LA 2CSZA 4V3KC 1WEWA 1T1HA 3N9LA 2HDPA 3KV6A 4B86C 3HTKC 3FM8C 2OXQC 2LQ6A 4YATA 3L1XA 4IC3A 2DSMA 2D8SA 2VJEA 3DQVR 1WESA 2MKEA 3MHSA 2YQMA 2MNYA 3U5OA 4OGEA 4L7XA 4YADA 4GNDA 4NN2A 4BBQA 1CHCA 2RI7A 5TABA 2FD4A 1Z2QA 5LKZA 2LAUA 1LDKC 2K4DA 1FP0A 4A4BA 2FUUA 2XEUA 5D1MB 1LDJB 2XB1A 3C6WA 2L75A 5DINA 3HCUA 5B78A 1K2FA 5H1UA 2B0OE 2FFWA 1IYMA 2Y43A 2IQJA 4AVXA 3FL2A 3L11A 2MNZA 4BHWA 2YURA 1WEVA 4W4UA 2ECIA 3N9QA 2MA5A 2IDAA 4LADB 2G45A 2KWKA 3U5PA 5LCWB 4MSXA 2K17A 1WEMA 2M3HA 5D1KB 1RMDA 4WZ3B 1WEEA 5JG6A 4IC2A 4CA1A 2KGIA 2F6JA 4A4CA 5SVYA 3ZYQA 5FERA 3ASLA 3DWDA 5B76A 4FIPA 5H9MA 1X4IA 3O33A 3RTRB 2YREA 3EB6A 1WFKA 3SUBA 4CCGX 4X3GA 1N87A 2FUIA 1WIMA 2RSDA 4B7YC 2E61A 2VP7A 4YAXA 2L80A 2VJFB 2LGVA 3M63A 2KE1A 4WA6A 4S3OC 2VPDA 1MM2A 1JM7A 3SHBA 5C13A 4WZ2A 3U5MA 2KWJA 2CSYA 5H1VA 2LRIC 2H0DB 2HYED 2YYRA 5G05B 2CKLB 3FJUB 5SVIA 2ECGA 2ECVA 2C2LA 2G6QA 2ECWA 1U6GB 3O34A 2RR4A 4LK9A 2VPBA 1V87A 4AUQB 2F42A 5LKXA 3HCSA 3JUEA 4MVTA 4YBMA 3FEHA 1WEQA 4H9DA 4ZUXU 2MIQA 4V3LC 4S3OB 3V43A 5G0FA 2KFTA 1Z60A 2KKYA 3ZTGA 2JRJA 4R2YA 1DVPA 2DJAA 1VD4A 3GL6A 3KV5A 2XOYA 5SVXA 2KU3A 2M6MA 2QIZA 5G04B 3M99A 5TBNA 3N9PA 3RPGB 2XOZA 1MBMA 3LJUX 2MD7B 4FO9A 2YQLA 3SOWA 2YUCA 4UP0A 5K3QA 3LDYA 2KR4A 3L1ZB 1MM3A 2QICA 3GV4A 1HYIA 3IHPA 2EGPA 4QQ4A 4YABA 4O64A 1VYXA 3O47A 2VJFA
chains in the Genus database with same CATH topology
4LJNA 4UI9B 4GB0A 1JOCA 2EA6A 4ZQLA 3LQIA 5DKAA 3O35A 4AP4A 3LQJA 3NG2A 2KYUA 2JMDA 1XWHA 4YBSA 2MD8C 1G25A 2H0DA 5J3XA 2DX8A 4A0CD 3KNVA 2L5UA 3EB5A 3U5NA 3SOXA 4FK5A 4L58A 5AIUA 3O70A 2LGKA 2KIZA 4PPEA 2ECTA 5B75A 4PTBA 2ECNA 3T6RA 1E4UA 3O36A 4LKAA 4AYCB 2YSJA 2BAYA 4A49A 5KH3A 5LKUA 3N9MA 1BORA 2E6SA 2LN0A 3HCTA 2YT5A 2YHNA 4GNGA 5AITA 2LV9A 3RPGC 2LGLA 2Y1NA 3DPLR 4F52B 3C5KA 5C11A 2KWNA 2LXPC 5KH7A 1Z6UA 2EODA 4R7EA 2KREA 2FSAA 5FB0A 2YHOA 2NAAA 3I2DA 2LGGA 4XI1A 2ECJA 1X4UA 4I7CA 4GNFA 3O7AA 2AN6A 5D1LB 3ZNIA 1WEUA 3ZVZB 4YC9A 1JM7B 4ZDTA 4GNEA 3T7LA 2ZETC 4TKPB 3LRQA 2VNFA 3KQIA 5FEYA 2JMIA 1WEPA 2K1JA 5FB1A 2CT2A 4N3WA 3PHDA 1WEOA 2F6NA 2Y1MA 3MHHA 5TRBA 2K16A 5B79A 4N4FA 2UZGA 2VJEB 3VK6A 2MT5A 4AYCA 4Q6FA 2G43A 2PNXA 4C9ZA 3QZVA 1VFYA 3ZVYA 4QF2A 3ZPVE 5B77A 3N9NA 2LXHC 5EYAF 3SOUA 1X4JA 2CKLA 2JMJA 1F62A 2C2VS 5KH9A 4FJCA 4P5OB 1FBVA 3ZPV1 4QF3A 2E6RA 2YW8A 3N9OA 4LLBA 1WGMA 2YU4A 1WENA 5LKTA 1WE9A 2L0BA 2LDRA 3PURA 4R8PK 2I50A 4WZ0A 2QJ0A 4YBTA 2YSMA 1WILA 2L43A 2MUMA 3O37A 4UP5A 2PUYA 5H1TA 1HYJA 2KGGA 2VPGA 4I7DA 2MA6A 5TDRA 1ZBDB 5B8DA 2KWOA 2M85A 4I7BA 2M1RA 5TDWA 3LQHA 3PUQA 2VPEA 3M62A 5I3LA 2CSZA 4V3KC 1WEWA 1T1HA 3N9LA 2HDPA 3KV6A 4B86C 3HTKC 2OXQC 2LQ6A 4YATA 3L1XA 4IC3A 2D8SA 2VJEA 3DQVR 1WESA 3MHSA 2YQMA 2MNYA 3U5OA 4L7XA 4YADA 4GNDA 4NN2A 4BBQA 1CHCA 2RI7A 5TABA 1Z2QA 5LKZA 1LDKC 2K4DA 1FP0A 4A4BA 2FUUA 2XEUA 5D1MB 1LDJB 2XB1A 3C6WA 2L75A 5DINA 3HCUA 5B78A 1K2FA 5H1UA 1IYMA 2Y43A 4AVXA 3FL2A 3L11A 2MNZA 4BHWA 2YURA 1WEVA 4W4UA 2ECIA 3N9QA 2MA5A 2IDAA 4LADB 2G45A 2KWKA 3U5PA 5LCWB 4MSXA 2K17A 1WEMA 2M3HA 5D1KB 1RMDA 4WZ3B 1WEEA 5JG6A 4IC2A 4CA1A 2KGIA 2F6JA 4A4CA 3ZYQA 5FERA 3ASLA 5B76A 4FIPA 5H9MA 1X4IA 3O33A 3RTRB 2YREA 3EB6A 1WFKA 4CCGX 4X3GA 1N87A 2FUIA 1WIMA 2RSDA 4B7YC 2VP7A 4YAXA 2L80A 2VJFB 2LGVA 3M63A 2KE1A 4WA6A 4S3OC 2VPDA 1MM2A 1JM7A 3SHBA 5C13A 4WZ2A 3U5MA 2KWJA 2CSYA 5H1VA 2LRIC 2H0DB 2HYED 2YYRA 5G05B 2CKLB 2ECGA 2ECVA 2C2LA 2G6QA 2ECWA 1U6GB 3O34A 4LK9A 2VPBA 1V87A 4AUQB 2F42A 5LKXA 3HCSA 4MVTA 4YBMA 1WEQA 4ZUXU 2MIQA 4V3LC 4S3OB 3V43A 5G0FA 2KFTA 1Z60A 3ZTGA 2JRJA 4R2YA 1DVPA 1VD4A 3GL6A 3KV5A 2KU3A 2M6MA 2QIZA 5G04B 3M99A 5TBNA 3N9PA 3RPGB 2MD7B 4FO9A 2YQLA 3SOWA 2YUCA 4UP0A 2KR4A 3L1ZB 1MM3A 2QICA 3GV4A 1HYIA 3IHPA 2EGPA 4YABA 4O64A 1VYXA 2VJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJN A;  4UI9 B;  4GB0 A;  1JOC A;  2EA6 A;  4ZQL A;  3LQI A;  5DKA A;  3O35 A;  4AP4 A;  3LQJ A;  3NG2 A;  2KYU A;  2JMD A;  1XWH A;  4YBS A;  2MD8 C;  1G25 A;  2H0D A;  5J3X A;  2DX8 A;  4A0C D;  3KNV A;  2L5U A;  3EB5 A;  3U5N A;  3SOX A;  4FK5 A;  4L58 A;  5AIU A;  3O70 A;  2LGK A;  2KIZ A;  4PPE A;  2ECT A;  5B75 A;  4PTB A;  2ECN A;  3T6R A;  1E4U A;  3O36 A;  4LKA A;  4AYC B;  2YSJ A;  2BAY A;  4A49 A;  5KH3 A;  5LKU A;  3N9M A;  1BOR A;  2E6S A;  2LN0 A;  3HCT A;  2YT5 A;  2YHN A;  4GNG A;  5AIT A;  2LV9 A;  3RPG C;  2LGL A;  2Y1N A;  3DPL R;  4F52 B;  3C5K A;  5C11 A;  2KWN A;  2LXP C;  5KH7 A;  1Z6U A;  2EOD A;  4R7E A;  2KRE A;  2FSA A;  5FB0 A;  2YHO A;  2NAA A;  3I2D A;  2LGG A;  4XI1 A;  2ECJ A;  1X4U A;  4I7C A;  4GNF A;  3O7A A;  2AN6 A;  5D1L B;  3ZNI A;  1WEU A;  3ZVZ B;  4YC9 A;  1JM7 B;  4ZDT A;  4GNE A;  3T7L A;  2ZET C;  4TKP B;  3LRQ A;  2VNF A;  3KQI A;  5FEY A;  2JMI A;  1WEP A;  2K1J A;  5FB1 A;  2CT2 A;  4N3W A;  3PHD A;  1WEO A;  2F6N A;  2Y1M A;  3MHH A;  5TRB A;  2K16 A;  5B79 A;  4N4F A;  2UZG A;  2VJE B;  3VK6 A;  2MT5 A;  4AYC A;  4Q6F A;  2G43 A;  2PNX A;  4C9Z A;  3QZV A;  1VFY A;  3ZVY A;  4QF2 A;  3ZPV E;  5B77 A;  3N9N A;  2LXH C;  5EYA F;  3SOU A;  1X4J A;  2CKL A;  2JMJ A;  1F62 A;  2C2V S;  5KH9 A;  4FJC A;  4P5O B;  1FBV A;  3ZPV 1;  4QF3 A;  2E6R A;  2YW8 A;  3N9O A;  4LLB A;  1WGM A;  2YU4 A;  1WEN A;  5LKT A;  1WE9 A;  2L0B A;  2LDR A;  3PUR A;  4R8P K;  2I50 A;  4WZ0 A;  2QJ0 A;  4YBT A;  2YSM A;  1WIL A;  2L43 A;  2MUM A;  3O37 A;  4UP5 A;  2PUY A;  5H1T A;  1HYJ A;  2KGG A;  2VPG A;  4I7D A;  2MA6 A;  5TDR A;  1ZBD B;  5B8D A;  2KWO A;  2M85 A;  4I7B A;  2M1R A;  5TDW A;  3LQH A;  3PUQ A;  2VPE A;  3M62 A;  5I3L A;  2CSZ A;  4V3K C;  1WEW A;  1T1H A;  3N9L A;  2HDP A;  3KV6 A;  4B86 C;  3HTK C;  2OXQ C;  2LQ6 A;  4YAT A;  3L1X A;  4IC3 A;  2D8S A;  2VJE A;  3DQV R;  1WES A;  3MHS A;  2YQM A;  2MNY A;  3U5O A;  4L7X A;  4YAD A;  4GND A;  4NN2 A;  4BBQ A;  1CHC A;  2RI7 A;  5TAB A;  1Z2Q A;  5LKZ A;  1LDK C;  2K4D A;  1FP0 A;  4A4B A;  2FUU A;  2XEU A;  5D1M B;  1LDJ B;  2XB1 A;  3C6W A;  2L75 A;  5DIN A;  3HCU A;  5B78 A;  1K2F A;  5H1U A;  1IYM A;  2Y43 A;  4AVX A;  3FL2 A;  3L11 A;  2MNZ A;  4BHW A;  2YUR A;  1WEV A;  4W4U A;  2ECI A;  3N9Q A;  2MA5 A;  2IDA A;  4LAD B;  2G45 A;  2KWK A;  3U5P A;  5LCW B;  4MSX A;  2K17 A;  1WEM A;  2M3H A;  5D1K B;  1RMD A;  4WZ3 B;  1WEE A;  5JG6 A;  4IC2 A;  4CA1 A;  2KGI A;  2F6J A;  4A4C A;  3ZYQ A;  5FER A;  3ASL A;  5B76 A;  4FIP A;  5H9M A;  1X4I A;  3O33 A;  3RTR B;  2YRE A;  3EB6 A;  1WFK A;  4CCG X;  4X3G A;  1N87 A;  2FUI A;  1WIM A;  2RSD A;  4B7Y C;  2VP7 A;  4YAX A;  2L80 A;  2VJF B;  2LGV A;  3M63 A;  2KE1 A;  4WA6 A;  4S3O C;  2VPD A;  1MM2 A;  1JM7 A;  3SHB A;  5C13 A;  4WZ2 A;  3U5M A;  2KWJ A;  2CSY A;  5H1V A;  2LRI C;  2H0D B;  2HYE D;  2YYR A;  5G05 B;  2CKL B;  2ECG A;  2ECV A;  2C2L A;  2G6Q A;  2ECW A;  1U6G B;  3O34 A;  4LK9 A;  2VPB A;  1V87 A;  4AUQ B;  2F42 A;  5LKX A;  3HCS A;  4MVT A;  4YBM A;  1WEQ A;  4ZUX U;  2MIQ A;  4V3L C;  4S3O B;  3V43 A;  5G0F A;  2KFT A;  1Z60 A;  3ZTG A;  2JRJ A;  4R2Y A;  1DVP A;  1VD4 A;  3GL6 A;  3KV5 A;  2KU3 A;  2M6M A;  2QIZ A;  5G04 B;  3M99 A;  5TBN A;  3N9P A;  3RPG B;  2MD7 B;  4FO9 A;  2YQL A;  3SOW A;  2YUC A;  4UP0 A;  2KR4 A;  3L1Z B;  1MM3 A;  2QIC A;  3GV4 A;  1HYI A;  3IHP A;  2EGP A;  4YAB A;  4O64 A;  1VYX A;  2VJF A; 
#chains in the Genus database with same CATH topology
 3FAN A;  2YVR A;  4LJN A;  4UI9 B;  4GB0 A;  1JOC A;  2EA6 A;  3DDT A;  4ZQL A;  2JM3 A;  3LQI A;  5DKA A;  3O35 A;  4AP4 A;  3LQJ A;  3NG2 A;  2KYU A;  2JMD A;  1XWH A;  2KKX A;  4YBS A;  2P57 A;  2MD8 C;  1G25 A;  2H0D A;  2XP0 A;  5J3X A;  2DX8 A;  4A0C D;  3KNV A;  2M13 A;  2L5U A;  3EB5 A;  3U5N A;  3SOX A;  4FK5 A;  4L58 A;  5AIU A;  3O70 A;  2LGK A;  2KIZ A;  4PPE A;  2ECT A;  5B75 A;  4PTB A;  2ECN A;  3T6R A;  1E4U A;  2EGM A;  2CRR A;  3O36 A;  4LKA A;  4AYC B;  2YSJ A;  2BAY A;  3T9K A;  2CRW A;  4A49 A;  5KH3 A;  5LKU A;  3N9M A;  4Z0R A;  1BOR A;  2JUN A;  2E6S A;  2LN0 A;  3HCT A;  2YT5 A;  2YHN A;  4GNG A;  5AIT A;  2LV9 A;  3RPG C;  2LGL A;  2Y1N A;  3DPL R;  4F52 B;  3C5K A;  5C11 A;  2KWN A;  2LXP C;  5KH7 A;  1Z6U A;  2EOD A;  4R7E A;  2KRE A;  2FSA A;  5FB0 A;  2YHO A;  2NAA A;  3I2D A;  2LGG A;  4XI1 A;  2ECJ A;  3Q1D A;  3LVQ E;  1X4U A;  4I7C A;  4GNF A;  3O7A A;  2AN6 A;  5D1L B;  3ZNI A;  1WEU A;  3KDE C;  3ZVZ B;  4YC9 A;  1JM7 B;  4Z0O A;  4ZDT A;  4GNE A;  3T7L A;  2ZET C;  4TKP B;  3LRQ A;  2VNF A;  3KQI A;  2CSV A;  5SVI B;  5FEY A;  2JMI A;  1WEP A;  2K1J A;  5FB1 A;  2CT2 A;  4N3W A;  3PHD A;  1WEO A;  2F6N A;  2Y1M A;  3MHH A;  5TRB A;  2K16 A;  5B79 A;  4N4F A;  2UZG A;  2VJE B;  3VK6 A;  2MT5 A;  4AYC A;  4Q6F A;  2G43 A;  2EXU A;  2PNX A;  4C9Z A;  3QZV A;  1VFY A;  3ZVY A;  4QF2 A;  3ZPV E;  5B77 A;  3N9N A;  2CON A;  2LXH C;  5EYA F;  1DCQ A;  3SOU A;  3M7K A;  1X4J A;  2CKL A;  2JMJ A;  1F62 A;  4OGC A;  2C2V S;  5KH9 A;  4FJC A;  4P5O B;  1FBV A;  3ZPV 1;  4F1P A;  4QF3 A;  3FAO A;  2E6R A;  2YW8 A;  3N9O A;  4LLB A;  1WGM A;  2YU4 A;  1WEN A;  5LKT A;  1WE9 A;  2L0B A;  2XOC A;  2LDR A;  3PUR A;  4R8P K;  2I50 A;  4WZ0 A;  3E2D A;  2QJ0 A;  4YBT A;  2YSM A;  1WIL A;  3MDB C;  2L43 A;  2MUM A;  3O37 A;  4UP5 A;  3PLW A;  2PUY A;  5H1T A;  1HYJ A;  2KGG A;  2VPG A;  4I7D A;  2MA6 A;  4O62 A;  2L7P A;  2D8U A;  5TDR A;  1ZBD B;  3LVR E;  5B8D A;  2KWO A;  2M85 A;  4I7B A;  3H7H A;  2M1R A;  5TDW A;  3LQH A;  3PUQ A;  2OWA A;  2VPE A;  3M62 A;  5I3L A;  2CSZ A;  4V3K C;  1WEW A;  1T1H A;  3N9L A;  2HDP A;  3KV6 A;  4B86 C;  3HTK C;  3FM8 C;  2OXQ C;  2LQ6 A;  4YAT A;  3L1X A;  4IC3 A;  2DSM A;  2D8S A;  2VJE A;  3DQV R;  1WES A;  2MKE A;  3MHS A;  2YQM A;  2MNY A;  3U5O A;  4OGE A;  4L7X A;  4YAD A;  4GND A;  4NN2 A;  4BBQ A;  1CHC A;  2RI7 A;  5TAB A;  2FD4 A;  1Z2Q A;  5LKZ A;  2LAU A;  1LDK C;  2K4D A;  1FP0 A;  4A4B A;  2FUU A;  2XEU A;  5D1M B;  1LDJ B;  2XB1 A;  3C6W A;  2L75 A;  5DIN A;  3HCU A;  5B78 A;  1K2F A;  5H1U A;  2B0O E;  2FFW A;  1IYM A;  2Y43 A;  2IQJ A;  4AVX A;  3FL2 A;  3L11 A;  2MNZ A;  4BHW A;  2YUR A;  1WEV A;  4W4U A;  2ECI A;  3N9Q A;  2MA5 A;  2IDA A;  4LAD B;  2G45 A;  2KWK A;  3U5P A;  5LCW B;  4MSX A;  2K17 A;  1WEM A;  2M3H A;  5D1K B;  1RMD A;  4WZ3 B;  1WEE A;  5JG6 A;  4IC2 A;  4CA1 A;  2KGI A;  2F6J A;  4A4C A;  5SVY A;  3ZYQ A;  5FER A;  3ASL A;  3DWD A;  5B76 A;  4FIP A;  5H9M A;  1X4I A;  3O33 A;  3RTR B;  2YRE A;  3EB6 A;  1WFK A;  3SUB A;  4CCG X;  4X3G A;  1N87 A;  2FUI A;  1WIM A;  2RSD A;  4B7Y C;  2E61 A;  2VP7 A;  4YAX A;  2L80 A;  2VJF B;  2LGV A;  3M63 A;  2KE1 A;  4WA6 A;  4S3O C;  2VPD A;  1MM2 A;  1JM7 A;  3SHB A;  5C13 A;  4WZ2 A;  3U5M A;  2KWJ A;  2CSY A;  5H1V A;  2LRI C;  2H0D B;  2HYE D;  2YYR A;  5G05 B;  2CKL B;  3FJU B;  5SVI A;  2ECG A;  2ECV A;  2C2L A;  2G6Q A;  2ECW A;  1U6G B;  3O34 A;  2RR4 A;  4LK9 A;  2VPB A;  1V87 A;  4AUQ B;  2F42 A;  5LKX A;  3HCS A;  3JUE A;  4MVT A;  4YBM A;  3FEH A;  1WEQ A;  4H9D A;  4ZUX U;  2MIQ A;  4V3L C;  4S3O B;  3V43 A;  5G0F A;  2KFT A;  1Z60 A;  2KKY A;  3ZTG A;  2JRJ A;  4R2Y A;  1DVP A;  2DJA A;  1VD4 A;  3GL6 A;  3KV5 A;  2XOY A;  5SVX A;  2KU3 A;  2M6M A;  2QIZ A;  5G04 B;  3M99 A;  5TBN A;  3N9P A;  3RPG B;  2XOZ A;  1MBM A;  3LJU X;  2MD7 B;  4FO9 A;  2YQL A;  3SOW A;  2YUC A;  4UP0 A;  5K3Q A;  3LDY A;  2KR4 A;  3L1Z B;  1MM3 A;  2QIC A;  3GV4 A;  1HYI A;  3IHP A;  2EGP A;  4QQ4 A;  4YAB A;  4O64 A;  1VYX A;  3O47 A;  2VJF A; 
#chains in the Genus database with same CATH homology
 4LJN A;  4UI9 B;  4GB0 A;  1JOC A;  2EA6 A;  4ZQL A;  3LQI A;  5DKA A;  3O35 A;  4AP4 A;  3LQJ A;  3NG2 A;  2KYU A;  2JMD A;  1XWH A;  4YBS A;  2MD8 C;  1G25 A;  2H0D A;  5J3X A;  2DX8 A;  4A0C D;  3KNV A;  2L5U A;  3EB5 A;  3U5N A;  3SOX A;  4FK5 A;  4L58 A;  5AIU A;  3O70 A;  2LGK A;  2KIZ A;  4PPE A;  2ECT A;  5B75 A;  4PTB A;  2ECN A;  3T6R A;  1E4U A;  3O36 A;  4LKA A;  4AYC B;  2YSJ A;  2BAY A;  4A49 A;  5KH3 A;  5LKU A;  3N9M A;  1BOR A;  2E6S A;  2LN0 A;  3HCT A;  2YT5 A;  2YHN A;  4GNG A;  5AIT A;  2LV9 A;  3RPG C;  2LGL A;  2Y1N A;  3DPL R;  4F52 B;  3C5K A;  5C11 A;  2KWN A;  2LXP C;  5KH7 A;  1Z6U A;  2EOD A;  4R7E A;  2KRE A;  2FSA A;  5FB0 A;  2YHO A;  2NAA A;  3I2D A;  2LGG A;  4XI1 A;  2ECJ A;  1X4U A;  4I7C A;  4GNF A;  3O7A A;  2AN6 A;  5D1L B;  3ZNI A;  1WEU A;  3ZVZ B;  4YC9 A;  1JM7 B;  4ZDT A;  4GNE A;  3T7L A;  2ZET C;  4TKP B;  3LRQ A;  2VNF A;  3KQI A;  5FEY A;  2JMI A;  1WEP A;  2K1J A;  5FB1 A;  2CT2 A;  4N3W A;  3PHD A;  1WEO A;  2F6N A;  2Y1M A;  3MHH A;  5TRB A;  2K16 A;  5B79 A;  4N4F A;  2UZG A;  2VJE B;  3VK6 A;  2MT5 A;  4AYC A;  4Q6F A;  2G43 A;  2PNX A;  4C9Z A;  3QZV A;  1VFY A;  3ZVY A;  4QF2 A;  3ZPV E;  5B77 A;  3N9N A;  2LXH C;  5EYA F;  3SOU A;  1X4J A;  2CKL A;  2JMJ A;  1F62 A;  2C2V S;  5KH9 A;  4FJC A;  4P5O B;  1FBV A;  3ZPV 1;  4QF3 A;  2E6R A;  2YW8 A;  3N9O A;  4LLB A;  1WGM A;  2YU4 A;  1WEN A;  5LKT A;  1WE9 A;  2L0B A;  2LDR A;  3PUR A;  4R8P K;  2I50 A;  4WZ0 A;  2QJ0 A;  4YBT A;  2YSM A;  1WIL A;  2L43 A;  2MUM A;  3O37 A;  4UP5 A;  2PUY A;  5H1T A;  1HYJ A;  2KGG A;  2VPG A;  4I7D A;  2MA6 A;  5TDR A;  1ZBD B;  5B8D A;  2KWO A;  2M85 A;  4I7B A;  2M1R A;  5TDW A;  3LQH A;  3PUQ A;  2VPE A;  3M62 A;  5I3L A;  2CSZ A;  4V3K C;  1WEW A;  1T1H A;  3N9L A;  2HDP A;  3KV6 A;  4B86 C;  3HTK C;  2OXQ C;  2LQ6 A;  4YAT A;  3L1X A;  4IC3 A;  2D8S A;  2VJE A;  3DQV R;  1WES A;  3MHS A;  2YQM A;  2MNY A;  3U5O A;  4L7X A;  4YAD A;  4GND A;  4NN2 A;  4BBQ A;  1CHC A;  2RI7 A;  5TAB A;  1Z2Q A;  5LKZ A;  1LDK C;  2K4D A;  1FP0 A;  4A4B A;  2FUU A;  2XEU A;  5D1M B;  1LDJ B;  2XB1 A;  3C6W A;  2L75 A;  5DIN A;  3HCU A;  5B78 A;  1K2F A;  5H1U A;  1IYM A;  2Y43 A;  4AVX A;  3FL2 A;  3L11 A;  2MNZ A;  4BHW A;  2YUR A;  1WEV A;  4W4U A;  2ECI A;  3N9Q A;  2MA5 A;  2IDA A;  4LAD B;  2G45 A;  2KWK A;  3U5P A;  5LCW B;  4MSX A;  2K17 A;  1WEM A;  2M3H A;  5D1K B;  1RMD A;  4WZ3 B;  1WEE A;  5JG6 A;  4IC2 A;  4CA1 A;  2KGI A;  2F6J A;  4A4C A;  3ZYQ A;  5FER A;  3ASL A;  5B76 A;  4FIP A;  5H9M A;  1X4I A;  3O33 A;  3RTR B;  2YRE A;  3EB6 A;  1WFK A;  4CCG X;  4X3G A;  1N87 A;  2FUI A;  1WIM A;  2RSD A;  4B7Y C;  2VP7 A;  4YAX A;  2L80 A;  2VJF B;  2LGV A;  3M63 A;  2KE1 A;  4WA6 A;  4S3O C;  2VPD A;  1MM2 A;  1JM7 A;  3SHB A;  5C13 A;  4WZ2 A;  3U5M A;  2KWJ A;  2CSY A;  5H1V A;  2LRI C;  2H0D B;  2HYE D;  2YYR A;  5G05 B;  2CKL B;  2ECG A;  2ECV A;  2C2L A;  2G6Q A;  2ECW A;  1U6G B;  3O34 A;  4LK9 A;  2VPB A;  1V87 A;  4AUQ B;  2F42 A;  5LKX A;  3HCS A;  4MVT A;  4YBM A;  1WEQ A;  4ZUX U;  2MIQ A;  4V3L C;  4S3O B;  3V43 A;  5G0F A;  2KFT A;  1Z60 A;  3ZTG A;  2JRJ A;  4R2Y A;  1DVP A;  1VD4 A;  3GL6 A;  3KV5 A;  2KU3 A;  2M6M A;  2QIZ A;  5G04 B;  3M99 A;  5TBN A;  3N9P A;  3RPG B;  2MD7 B;  4FO9 A;  2YQL A;  3SOW A;  2YUC A;  4UP0 A;  2KR4 A;  3L1Z B;  1MM3 A;  2QIC A;  3GV4 A;  1HYI A;  3IHP A;  2EGP A;  4YAB A;  4O64 A;  1VYX A;  2VJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...