2ECWA

Solution structure of the zinc finger, c3hc4 type (ring finger) domain tripartite motif protein 30
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
85
structure length
85
Chain Sequence
b'GSSGSSGMASSVLEMIKEEVTCPICLELLKEPVSADCNHSFCRACITLNYESNRNTDGKGNCPVCRVPYPFGNLKPNLHVANIVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tripartite motif-containing protein 30
publication title Solution structure of the Zinc finger, C3HC4 type (RING finger) domain Tripartite motif protein 30
rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 4
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecwA00
4GB0A 2MNZA 1X4JA 5B76A 4AUQB 5C13A 2YT5A 3ZTGA 2YUCA 3LQJA 4I7CA 3O34A 4I7DA 2YSJA 2KIZA 1WIMA 1K2FA 3KV5A 5H1TA 2MIQA 2LGKA 2CSYA 4A49A 3N9PA 2C2VS 4UP0A 2K1JA 2KWKA 3DQVR 1JM7A 4QF2A 4AVXA 2LXPC 3KV6A 2LQ6A 2LN0A 2IDAA 4MVTA 2EA6A 1WESA 5G0FA 3HCUA 2VJEB 2L75A 2M1RA 2KGGA 2NAAA 1MM3A 1WEOA 2L0BA 2MA6A 3O33A 2YHNA 3ASLA 3ZVYA 5H1UA 2VNFA 2KU3A 1IYMA 5FEYA 3SOUA 2ECIA 2Y1MA 4S3OB 3GL6A 5TBNA 3EB6A 5KH7A 2VP7A 4FJCA 1ZBDB 2E6SA 3T6RA 1WEUA 4TKPB 5D1KB 1DVPA 4NN2A 2KFTA 1WEPA 2ECNA 3EB5A 3SOXA 4YADA 4IC2A 4L7XA 3LQHA 1WEQA 2K4DA 2MT5A 3SHBA 3ZPV1 2K16A 2Y43A 2EGPA 4MSXA 2LGLA 5TDWA 3RPGB 3O36A 3DPLR 1JM7B 2XEUA 4A0CD 2L43A 4FK5A 4ZDTA 2MA5A 3PHDA 4GNGA 2RSDA 2YQLA 4XI1A 1U6GB 1WEEA 5LKXA 5DKAA 1LDJB 2KWOA 3MHSA 4AYCB 3HTKC 4LADB 2HDPA 2AN6A 2VPEA 4YABA 1WEWA 2ECTA 1N87A 1VD4A 3U5PA 5FERA 1MM2A 2VPGA 2ECGA 4S3OC 4F52B 2JMDA 5H1VA 4R2YA 5AITA 2PNXA 5H9MA 4BBQA 2KYUA 2LRIC 2CT2A 4YAXA 2EODA 4GNEA 4R7EA 4QF3A 4L58A 3SOWA 1F62A 5B8DA 3MHHA 5KH9A 4ZQLA 5LKUA 2HYED 1RMDA 1FBVA 1FP0A 3U5NA 4W4UA 5LKZA 5TDRA 4AYCA 2LXHC 5B75A 2KGIA 2KREA 1CHCA 1E4UA 1WFKA 1Z2QA 4O64A 3O37A 3LRQA 3IHPA 1VFYA 1HYIA 3N9LA 5J3XA 5LCWB 2Y1NA 1JOCA 2JMJA 4LK9A 2YU4A 3LQIA 1HYJA 2F6NA 2UZGA 2M85A 4YBSA 1WENA 3M99A 3ZNIA 3N9OA 2VPBA 2FSAA 2YURA 3ZVZB 2L5UA 4N3WA 2FUUA 1WGMA 3VK6A 3V43A 2XB1A 3NG2A 1G25A 2OXQC 5TABA 1Z6UA 5FB1A 4WZ0A 5D1MB 5JG6A 2M3HA 1WILA 1T1HA 4P5OB 4UP5A 2G6QA 3M62A 5B77A 5EYAF 2KWNA 2JMIA 2C2LA 2RI7A 3N9MA 3ZYQA 3ZPVE 3L1XA 4R8PK 2KR4A 4B86C 2KWJA 2CSZA 2MNYA 5LKTA 3M63A 2ZETC 2YW8A 2I50A 2LGGA 5TRBA 2D8SA 3KQIA 3C5KA 4PTBA 5DINA 2VPDA 4PPEA 4YATA 4YC9A 4A4BA 4YBMA 4X3GA 2QICA 2LGVA 2ECVA 4WZ3B 2PUYA 5G04B 3O35A 1WEVA 2LDRA 5AIUA 4V3LC 1VYXA 4LKAA 2G43A 3KNVA 2G45A 5D1LB 5B79A 4N4FA 4AP4A 4UI9B 4Q6FA 5FB0A 1X4UA 4ZUXU 2YREA 2YQMA 3L11A 4FO9A 5KH3A 3RPGC 5C11A 3C6WA 3HCTA 2CKLA 4WA6A 2ECJA 4YBTA 4V3KC 5G05B 5I3LA 1BORA 3I2DA 2F42A 2H0DA 4A4CA 2MUMA 2F6JA 2FUIA 1XWHA 1LDKC 5B78A 4CA1A 1WE9A 3PUQA 1X4IA 3RTRB 2VJFB 4B7YC 3QZVA 2MD7B 2DX8A 3GV4A 4LLBA 3U5OA 4WZ2A 2QJ0A 2MD8C 4GNFA 3N9NA 2E6RA 1V87A 2LV9A 3PURA 1Z60A 3FL2A 4C9ZA 4I7BA 4LJNA 2YYRA 2L80A 2QIZA 2M6MA 2BAYA 2VJEA 2ECWA 3L1ZB 4IC3A 3T7LA 2YSMA 3O70A 4BHWA 3U5MA 2VJFA 3O7AA 2YHOA 1WEMA 2KE1A 2CKLB 4CCGX 3N9QA 2K17A 4FIPA 2JRJA 4GNDA 3HCSA 2H0DB
chains in the Genus database with same CATH superfamily
4GB0A 2MNZA 1X4JA 5SVXA 5B76A 4AUQB 2EGMA 5C13A 2YT5A 3ZTGA 2YUCA 3LQJA 4I7CA 3O34A 4I7DA 2YSJA 2KIZA 1WIMA 1K2FA 3KV5A 5H1TA 2MIQA 2LGKA 2CSYA 4A49A 3N9PA 2CRRA 2C2VS 2DJAA 2CSVA 4UP0A 2K1JA 2KWKA 3DQVR 1JM7A 4QF2A 4H9DA 4AVXA 2LXPC 2P57A 3KV6A 2LQ6A 2LN0A 5SVYA 2IDAA 4MVTA 2EA6A 1WESA 5G0FA 3HCUA 2VJEB 2XOCA 3M7KA 2L75A 2M1RA 2KGGA 2NAAA 1MM3A 1WEOA 2L0BA 2MA6A 3O33A 2YHNA 2B0OE 3ASLA 3ZVYA 3LVRE 2VNFA 2KU3A 5H1UA 1IYMA 5FEYA 3SOUA 2ECIA 2Y1MA 4S3OB 3GL6A 5TBNA 3EB6A 5KH7A 2VP7A 3JUEA 4FJCA 1ZBDB 3E2DA 5K3QA 2E6SA 3T6RA 1WEUA 4TKPB 3LJUX 5D1KB 4Z0OA 1DVPA 4NN2A 2KFTA 1WEPA 2ECNA 3EB5A 3SOXA 4YADA 3FAOA 4IC2A 4L7XA 3LQHA 1WEQA 2K4DA 2MT5A 3SHBA 2JM3A 3ZPV1 2K16A 2Y43A 2EGPA 4MSXA 2LGLA 5TDWA 3RPGB 4F1PA 3O36A 4O62A 3DPLR 1JM7B 2XEUA 4A0CD 4Z0RA 2L43A 3MDBC 4FK5A 4ZDTA 2MA5A 3PHDA 4GNGA 2RSDA 2YQLA 4XI1A 3LVQE 1U6GB 1WEEA 5LKXA 2LAUA 5DKAA 1LDJB 2KWOA 2M13A 3O47A 3FANA 3MHSA 3PLWA 4AYCB 3HTKC 4LADB 2HDPA 3DWDA 2KKYA 2AN6A 2VPEA 4YABA 1WEWA 2ECTA 1N87A 1VD4A 3U5PA 5FERA 1MM2A 2VPGA 2ECGA 4S3OC 4F52B 2JMDA 5H1VA 4R2YA 5AITA 2PNXA 5H9MA 4BBQA 2KYUA 2LRIC 2CT2A 4YAXA 2EODA 4GNEA 4R7EA 4QF3A 4L58A 3SOWA 1F62A 5B8DA 3MHHA 5KH9A 4ZQLA 5LKUA 2HYED 1RMDA 1FBVA 1FP0A 3U5NA 4W4UA 5LKZA 5TDRA 4AYCA 2LXHC 3T9KA 5B75A 2KGIA 2KREA 3SUBA 1CHCA 1E4UA 1WFKA 1Z2QA 4O64A 3O37A 5SVIB 3LRQA 3IHPA 1VFYA 1HYIA 3N9LA 5J3XA 5LCWB 2Y1NA 1JOCA 3KDEC 2FFWA 2JMJA 4LK9A 2YU4A 3LQIA 1HYJA 2F6NA 2UZGA 2M85A 4YBSA 1WENA 3M99A 3ZNIA 2L7PA 3N9OA 2VPBA 2FSAA 2YURA 3ZVZB 2L5UA 4N3WA 2FUUA 1WGMA 3VK6A 3V43A 2XB1A 3NG2A 1G25A 2OXQC 5TABA 1Z6UA 5FB1A 4WZ0A 5D1MB 5JG6A 2M3HA 3DDTA 1WILA 1T1HA 4P5OB 4UP5A 2G6QA 3FJUB 3M62A 5B77A 5EYAF 2KWNA 2JMIA 2XOYA 2C2LA 2RI7A 3N9MA 3ZYQA 3ZPVE 3L1XA 4R8PK 2KR4A 4B86C 2KWJA 5SVIA 2CSZA 2MNYA 2CRWA 5LKTA 2YVRA 3M63A 2ZETC 2YW8A 2MKEA 2I50A 2LGGA 5TRBA 2D8SA 3KQIA 3C5KA 4PTBA 5DINA 2D8UA 2VPDA 4PPEA 4YATA 4YC9A 4A4BA 1DCQA 4YBMA 2E61A 4X3GA 2QICA 2LGVA 2ECVA 4WZ3B 2PUYA 5G04B 3O35A 1WEVA 2LDRA 5AIUA 3FEHA 4V3LC 1VYXA 4LKAA 2G43A 3KNVA 2G45A 5D1LB 2OWAA 4N4FA 4AP4A 5B79A 4UI9B 4Q6FA 5FB0A 1X4UA 4ZUXU 2YREA 2YQMA 2RR4A 3L11A 4FO9A 5KH3A 3RPGC 5C11A 3C6WA 3HCTA 2CKLA 4WA6A 2ECJA 4YBTA 3Q1DA 4V3KC 5G05B 2FD4A 2XP0A 5I3LA 1BORA 3I2DA 2F42A 4OGEA 2H0DA 4A4CA 2MUMA 2F6JA 2EXUA 2FUIA 2IQJA 1XWHA 1LDKC 1MBMA 4CA1A 1WE9A 3PUQA 1X4IA 3RTRB 5B78A 2VJFB 4B7YC 2KKXA 3QZVA 2MD7B 2DX8A 4OGCA 3GV4A 4LLBA 3U5OA 4WZ2A 2QJ0A 2JUNA 3LDYA 2MD8C 4GNFA 3N9NA 2E6RA 1V87A 2LV9A 3PURA 1Z60A 3FL2A 4C9ZA 4I7BA 4LJNA 2YYRA 2L80A 4QQ4A 2QIZA 3H7HA 2M6MA 2BAYA 2VJEA 2XOZA 2ECWA 3L1ZB 4IC3A 2CONA 3T7LA 2YSMA 3O70A 3FM8C 4BHWA 3U5MA 2VJFA 3O7AA 2YHOA 1WEMA 2KE1A 2CKLB 4CCGX 3N9QA 2K17A 4FIPA 2DSMA 2JRJA 4GNDA 3HCSA 2H0DB
chains in the Genus database with same CATH topology
4GB0A 2MNZA 1X4JA 5B76A 4AUQB 5C13A 2YT5A 3ZTGA 2YUCA 3LQJA 4I7CA 3O34A 4I7DA 2YSJA 2KIZA 1WIMA 1K2FA 3KV5A 5H1TA 2MIQA 2LGKA 2CSYA 4A49A 3N9PA 2C2VS 4UP0A 2K1JA 2KWKA 3DQVR 1JM7A 4QF2A 4AVXA 2LXPC 3KV6A 2LQ6A 2LN0A 2IDAA 4MVTA 2EA6A 1WESA 5G0FA 3HCUA 2VJEB 2L75A 2M1RA 2KGGA 2NAAA 1MM3A 1WEOA 2L0BA 2MA6A 3O33A 2YHNA 3ASLA 3ZVYA 5H1UA 2VNFA 2KU3A 1IYMA 5FEYA 3SOUA 2ECIA 2Y1MA 4S3OB 3GL6A 5TBNA 3EB6A 5KH7A 2VP7A 4FJCA 1ZBDB 2E6SA 3T6RA 1WEUA 4TKPB 5D1KB 1DVPA 4NN2A 2KFTA 1WEPA 2ECNA 3EB5A 3SOXA 4YADA 4IC2A 4L7XA 3LQHA 1WEQA 2K4DA 2MT5A 3SHBA 3ZPV1 2K16A 2Y43A 2EGPA 4MSXA 2LGLA 5TDWA 3RPGB 3O36A 3DPLR 1JM7B 2XEUA 4A0CD 2L43A 4FK5A 4ZDTA 2MA5A 3PHDA 4GNGA 2RSDA 2YQLA 4XI1A 1U6GB 1WEEA 5LKXA 5DKAA 1LDJB 2KWOA 3MHSA 4AYCB 3HTKC 4LADB 2HDPA 2AN6A 2VPEA 4YABA 1WEWA 2ECTA 1N87A 1VD4A 3U5PA 5FERA 1MM2A 2VPGA 2ECGA 4S3OC 4F52B 2JMDA 5H1VA 4R2YA 5AITA 2PNXA 5H9MA 4BBQA 2KYUA 2LRIC 2CT2A 4YAXA 2EODA 4GNEA 4R7EA 4QF3A 4L58A 3SOWA 1F62A 5B8DA 3MHHA 5KH9A 4ZQLA 5LKUA 2HYED 1RMDA 1FBVA 1FP0A 3U5NA 4W4UA 5LKZA 5TDRA 4AYCA 2LXHC 5B75A 2KGIA 2KREA 1CHCA 1E4UA 1WFKA 1Z2QA 4O64A 3O37A 3LRQA 3IHPA 1VFYA 1HYIA 3N9LA 5J3XA 5LCWB 2Y1NA 1JOCA 2JMJA 4LK9A 2YU4A 3LQIA 1HYJA 2F6NA 2UZGA 2M85A 4YBSA 1WENA 3M99A 3ZNIA 3N9OA 2VPBA 2FSAA 2YURA 3ZVZB 2L5UA 4N3WA 2FUUA 1WGMA 3VK6A 3V43A 2XB1A 3NG2A 1G25A 2OXQC 5TABA 1Z6UA 5FB1A 4WZ0A 5D1MB 5JG6A 2M3HA 1WILA 1T1HA 4P5OB 4UP5A 2G6QA 3M62A 5B77A 5EYAF 2KWNA 2JMIA 2C2LA 2RI7A 3N9MA 3ZYQA 3ZPVE 3L1XA 4R8PK 2KR4A 4B86C 2KWJA 2CSZA 2MNYA 5LKTA 3M63A 2ZETC 2YW8A 2I50A 2LGGA 5TRBA 2D8SA 3KQIA 3C5KA 4PTBA 5DINA 2VPDA 4PPEA 4YATA 4YC9A 4A4BA 4YBMA 4X3GA 2QICA 2LGVA 2ECVA 4WZ3B 2PUYA 5G04B 3O35A 1WEVA 2LDRA 5AIUA 4V3LC 1VYXA 4LKAA 2G43A 3KNVA 2G45A 5D1LB 5B79A 4N4FA 4AP4A 4UI9B 4Q6FA 5FB0A 1X4UA 4ZUXU 2YREA 2YQMA 3L11A 4FO9A 5KH3A 3RPGC 5C11A 3C6WA 3HCTA 2CKLA 4WA6A 2ECJA 4YBTA 4V3KC 5G05B 5I3LA 1BORA 3I2DA 2F42A 2H0DA 4A4CA 2MUMA 2F6JA 2FUIA 1XWHA 1LDKC 5B78A 4CA1A 1WE9A 3PUQA 1X4IA 3RTRB 2VJFB 4B7YC 3QZVA 2MD7B 2DX8A 3GV4A 4LLBA 3U5OA 4WZ2A 2QJ0A 2MD8C 4GNFA 3N9NA 2E6RA 1V87A 2LV9A 3PURA 1Z60A 3FL2A 4C9ZA 4I7BA 4LJNA 2YYRA 2L80A 2QIZA 2M6MA 2BAYA 2VJEA 2ECWA 3L1ZB 4IC3A 3T7LA 2YSMA 3O70A 4BHWA 3U5MA 2VJFA 3O7AA 2YHOA 1WEMA 2KE1A 2CKLB 4CCGX 3N9QA 2K17A 4FIPA 2JRJA 4GNDA 3HCSA 2H0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GB0 A;  2MNZ A;  1X4J A;  5B76 A;  4AUQ B;  5C13 A;  2YT5 A;  3ZTG A;  2YUC A;  3LQJ A;  4I7C A;  3O34 A;  4I7D A;  2YSJ A;  2KIZ A;  1WIM A;  1K2F A;  3KV5 A;  5H1T A;  2MIQ A;  2LGK A;  2CSY A;  4A49 A;  3N9P A;  2C2V S;  4UP0 A;  2K1J A;  2KWK A;  3DQV R;  1JM7 A;  4QF2 A;  4AVX A;  2LXP C;  3KV6 A;  2LQ6 A;  2LN0 A;  2IDA A;  4MVT A;  2EA6 A;  1WES A;  5G0F A;  3HCU A;  2VJE B;  2L75 A;  2M1R A;  2KGG A;  2NAA A;  1MM3 A;  1WEO A;  2L0B A;  2MA6 A;  3O33 A;  2YHN A;  3ASL A;  3ZVY A;  5H1U A;  2VNF A;  2KU3 A;  1IYM A;  5FEY A;  3SOU A;  2ECI A;  2Y1M A;  4S3O B;  3GL6 A;  5TBN A;  3EB6 A;  5KH7 A;  2VP7 A;  4FJC A;  1ZBD B;  2E6S A;  3T6R A;  1WEU A;  4TKP B;  5D1K B;  1DVP A;  4NN2 A;  2KFT A;  1WEP A;  2ECN A;  3EB5 A;  3SOX A;  4YAD A;  4IC2 A;  4L7X A;  3LQH A;  1WEQ A;  2K4D A;  2MT5 A;  3SHB A;  3ZPV 1;  2K16 A;  2Y43 A;  2EGP A;  4MSX A;  2LGL A;  5TDW A;  3RPG B;  3O36 A;  3DPL R;  1JM7 B;  2XEU A;  4A0C D;  2L43 A;  4FK5 A;  4ZDT A;  2MA5 A;  3PHD A;  4GNG A;  2RSD A;  2YQL A;  4XI1 A;  1U6G B;  1WEE A;  5LKX A;  5DKA A;  1LDJ B;  2KWO A;  3MHS A;  4AYC B;  3HTK C;  4LAD B;  2HDP A;  2AN6 A;  2VPE A;  4YAB A;  1WEW A;  2ECT A;  1N87 A;  1VD4 A;  3U5P A;  5FER A;  1MM2 A;  2VPG A;  2ECG A;  4S3O C;  4F52 B;  2JMD A;  5H1V A;  4R2Y A;  5AIT A;  2PNX A;  5H9M A;  4BBQ A;  2KYU A;  2LRI C;  2CT2 A;  4YAX A;  2EOD A;  4GNE A;  4R7E A;  4QF3 A;  4L58 A;  3SOW A;  1F62 A;  5B8D A;  3MHH A;  5KH9 A;  4ZQL A;  5LKU A;  2HYE D;  1RMD A;  1FBV A;  1FP0 A;  3U5N A;  4W4U A;  5LKZ A;  5TDR A;  4AYC A;  2LXH C;  5B75 A;  2KGI A;  2KRE A;  1CHC A;  1E4U A;  1WFK A;  1Z2Q A;  4O64 A;  3O37 A;  3LRQ A;  3IHP A;  1VFY A;  1HYI A;  3N9L A;  5J3X A;  5LCW B;  2Y1N A;  1JOC A;  2JMJ A;  4LK9 A;  2YU4 A;  3LQI A;  1HYJ A;  2F6N A;  2UZG A;  2M85 A;  4YBS A;  1WEN A;  3M99 A;  3ZNI A;  3N9O A;  2VPB A;  2FSA A;  2YUR A;  3ZVZ B;  2L5U A;  4N3W A;  2FUU A;  1WGM A;  3VK6 A;  3V43 A;  2XB1 A;  3NG2 A;  1G25 A;  2OXQ C;  5TAB A;  1Z6U A;  5FB1 A;  4WZ0 A;  5D1M B;  5JG6 A;  2M3H A;  1WIL A;  1T1H A;  4P5O B;  4UP5 A;  2G6Q A;  3M62 A;  5B77 A;  5EYA F;  2KWN A;  2JMI A;  2C2L A;  2RI7 A;  3N9M A;  3ZYQ A;  3ZPV E;  3L1X A;  4R8P K;  2KR4 A;  4B86 C;  2KWJ A;  2CSZ A;  2MNY A;  5LKT A;  3M63 A;  2ZET C;  2YW8 A;  2I50 A;  2LGG A;  5TRB A;  2D8S A;  3KQI A;  3C5K A;  4PTB A;  5DIN A;  2VPD A;  4PPE A;  4YAT A;  4YC9 A;  4A4B A;  4YBM A;  4X3G A;  2QIC A;  2LGV A;  2ECV A;  4WZ3 B;  2PUY A;  5G04 B;  3O35 A;  1WEV A;  2LDR A;  5AIU A;  4V3L C;  1VYX A;  4LKA A;  2G43 A;  3KNV A;  2G45 A;  5D1L B;  5B79 A;  4N4F A;  4AP4 A;  4UI9 B;  4Q6F A;  5FB0 A;  1X4U A;  4ZUX U;  2YRE A;  2YQM A;  3L11 A;  4FO9 A;  5KH3 A;  3RPG C;  5C11 A;  3C6W A;  3HCT A;  2CKL A;  4WA6 A;  2ECJ A;  4YBT A;  4V3K C;  5G05 B;  5I3L A;  1BOR A;  3I2D A;  2F42 A;  2H0D A;  4A4C A;  2MUM A;  2F6J A;  2FUI A;  1XWH A;  1LDK C;  5B78 A;  4CA1 A;  1WE9 A;  3PUQ A;  1X4I A;  3RTR B;  2VJF B;  4B7Y C;  3QZV A;  2MD7 B;  2DX8 A;  3GV4 A;  4LLB A;  3U5O A;  4WZ2 A;  2QJ0 A;  2MD8 C;  4GNF A;  3N9N A;  2E6R A;  1V87 A;  2LV9 A;  3PUR A;  1Z60 A;  3FL2 A;  4C9Z A;  4I7B A;  4LJN A;  2YYR A;  2L80 A;  2QIZ A;  2M6M A;  2BAY A;  2VJE A;  2ECW A;  3L1Z B;  4IC3 A;  3T7L A;  2YSM A;  3O70 A;  4BHW A;  3U5M A;  2VJF A;  3O7A A;  2YHO A;  1WEM A;  2KE1 A;  2CKL B;  4CCG X;  3N9Q A;  2K17 A;  4FIP A;  2JRJ A;  4GND A;  3HCS A;  2H0D B; 
#chains in the Genus database with same CATH topology
 4GB0 A;  2MNZ A;  1X4J A;  5SVX A;  5B76 A;  4AUQ B;  2EGM A;  5C13 A;  2YT5 A;  3ZTG A;  2YUC A;  3LQJ A;  4I7C A;  3O34 A;  4I7D A;  2YSJ A;  2KIZ A;  1WIM A;  1K2F A;  3KV5 A;  5H1T A;  2MIQ A;  2LGK A;  2CSY A;  4A49 A;  3N9P A;  2CRR A;  2C2V S;  2DJA A;  2CSV A;  4UP0 A;  2K1J A;  2KWK A;  3DQV R;  1JM7 A;  4QF2 A;  4H9D A;  4AVX A;  2LXP C;  2P57 A;  3KV6 A;  2LQ6 A;  2LN0 A;  5SVY A;  2IDA A;  4MVT A;  2EA6 A;  1WES A;  5G0F A;  3HCU A;  2VJE B;  2XOC A;  3M7K A;  2L75 A;  2M1R A;  2KGG A;  2NAA A;  1MM3 A;  1WEO A;  2L0B A;  2MA6 A;  3O33 A;  2YHN A;  2B0O E;  3ASL A;  3ZVY A;  3LVR E;  2VNF A;  2KU3 A;  5H1U A;  1IYM A;  5FEY A;  3SOU A;  2ECI A;  2Y1M A;  4S3O B;  3GL6 A;  5TBN A;  3EB6 A;  5KH7 A;  2VP7 A;  3JUE A;  4FJC A;  1ZBD B;  3E2D A;  5K3Q A;  2E6S A;  3T6R A;  1WEU A;  4TKP B;  3LJU X;  5D1K B;  4Z0O A;  1DVP A;  4NN2 A;  2KFT A;  1WEP A;  2ECN A;  3EB5 A;  3SOX A;  4YAD A;  3FAO A;  4IC2 A;  4L7X A;  3LQH A;  1WEQ A;  2K4D A;  2MT5 A;  3SHB A;  2JM3 A;  3ZPV 1;  2K16 A;  2Y43 A;  2EGP A;  4MSX A;  2LGL A;  5TDW A;  3RPG B;  4F1P A;  3O36 A;  4O62 A;  3DPL R;  1JM7 B;  2XEU A;  4A0C D;  4Z0R A;  2L43 A;  3MDB C;  4FK5 A;  4ZDT A;  2MA5 A;  3PHD A;  4GNG A;  2RSD A;  2YQL A;  4XI1 A;  3LVQ E;  1U6G B;  1WEE A;  5LKX A;  2LAU A;  5DKA A;  1LDJ B;  2KWO A;  2M13 A;  3O47 A;  3FAN A;  3MHS A;  3PLW A;  4AYC B;  3HTK C;  4LAD B;  2HDP A;  3DWD A;  2KKY A;  2AN6 A;  2VPE A;  4YAB A;  1WEW A;  2ECT A;  1N87 A;  1VD4 A;  3U5P A;  5FER A;  1MM2 A;  2VPG A;  2ECG A;  4S3O C;  4F52 B;  2JMD A;  5H1V A;  4R2Y A;  5AIT A;  2PNX A;  5H9M A;  4BBQ A;  2KYU A;  2LRI C;  2CT2 A;  4YAX A;  2EOD A;  4GNE A;  4R7E A;  4QF3 A;  4L58 A;  3SOW A;  1F62 A;  5B8D A;  3MHH A;  5KH9 A;  4ZQL A;  5LKU A;  2HYE D;  1RMD A;  1FBV A;  1FP0 A;  3U5N A;  4W4U A;  5LKZ A;  5TDR A;  4AYC A;  2LXH C;  3T9K A;  5B75 A;  2KGI A;  2KRE A;  3SUB A;  1CHC A;  1E4U A;  1WFK A;  1Z2Q A;  4O64 A;  3O37 A;  5SVI B;  3LRQ A;  3IHP A;  1VFY A;  1HYI A;  3N9L A;  5J3X A;  5LCW B;  2Y1N A;  1JOC A;  3KDE C;  2FFW A;  2JMJ A;  4LK9 A;  2YU4 A;  3LQI A;  1HYJ A;  2F6N A;  2UZG A;  2M85 A;  4YBS A;  1WEN A;  3M99 A;  3ZNI A;  2L7P A;  3N9O A;  2VPB A;  2FSA A;  2YUR A;  3ZVZ B;  2L5U A;  4N3W A;  2FUU A;  1WGM A;  3VK6 A;  3V43 A;  2XB1 A;  3NG2 A;  1G25 A;  2OXQ C;  5TAB A;  1Z6U A;  5FB1 A;  4WZ0 A;  5D1M B;  5JG6 A;  2M3H A;  3DDT A;  1WIL A;  1T1H A;  4P5O B;  4UP5 A;  2G6Q A;  3FJU B;  3M62 A;  5B77 A;  5EYA F;  2KWN A;  2JMI A;  2XOY A;  2C2L A;  2RI7 A;  3N9M A;  3ZYQ A;  3ZPV E;  3L1X A;  4R8P K;  2KR4 A;  4B86 C;  2KWJ A;  5SVI A;  2CSZ A;  2MNY A;  2CRW A;  5LKT A;  2YVR A;  3M63 A;  2ZET C;  2YW8 A;  2MKE A;  2I50 A;  2LGG A;  5TRB A;  2D8S A;  3KQI A;  3C5K A;  4PTB A;  5DIN A;  2D8U A;  2VPD A;  4PPE A;  4YAT A;  4YC9 A;  4A4B A;  1DCQ A;  4YBM A;  2E61 A;  4X3G A;  2QIC A;  2LGV A;  2ECV A;  4WZ3 B;  2PUY A;  5G04 B;  3O35 A;  1WEV A;  2LDR A;  5AIU A;  3FEH A;  4V3L C;  1VYX A;  4LKA A;  2G43 A;  3KNV A;  2G45 A;  5D1L B;  2OWA A;  4N4F A;  4AP4 A;  5B79 A;  4UI9 B;  4Q6F A;  5FB0 A;  1X4U A;  4ZUX U;  2YRE A;  2YQM A;  2RR4 A;  3L11 A;  4FO9 A;  5KH3 A;  3RPG C;  5C11 A;  3C6W A;  3HCT A;  2CKL A;  4WA6 A;  2ECJ A;  4YBT A;  3Q1D A;  4V3K C;  5G05 B;  2FD4 A;  2XP0 A;  5I3L A;  1BOR A;  3I2D A;  2F42 A;  4OGE A;  2H0D A;  4A4C A;  2MUM A;  2F6J A;  2EXU A;  2FUI A;  2IQJ A;  1XWH A;  1LDK C;  1MBM A;  4CA1 A;  1WE9 A;  3PUQ A;  1X4I A;  3RTR B;  5B78 A;  2VJF B;  4B7Y C;  2KKX A;  3QZV A;  2MD7 B;  2DX8 A;  4OGC A;  3GV4 A;  4LLB A;  3U5O A;  4WZ2 A;  2QJ0 A;  2JUN A;  3LDY A;  2MD8 C;  4GNF A;  3N9N A;  2E6R A;  1V87 A;  2LV9 A;  3PUR A;  1Z60 A;  3FL2 A;  4C9Z A;  4I7B A;  4LJN A;  2YYR A;  2L80 A;  4QQ4 A;  2QIZ A;  3H7H A;  2M6M A;  2BAY A;  2VJE A;  2XOZ A;  2ECW A;  3L1Z B;  4IC3 A;  2CON A;  3T7L A;  2YSM A;  3O70 A;  3FM8 C;  4BHW A;  3U5M A;  2VJF A;  3O7A A;  2YHO A;  1WEM A;  2KE1 A;  2CKL B;  4CCG X;  3N9Q A;  2K17 A;  4FIP A;  2DSM A;  2JRJ A;  4GND A;  3HCS A;  2H0D B; 
#chains in the Genus database with same CATH homology
 4GB0 A;  2MNZ A;  1X4J A;  5B76 A;  4AUQ B;  5C13 A;  2YT5 A;  3ZTG A;  2YUC A;  3LQJ A;  4I7C A;  3O34 A;  4I7D A;  2YSJ A;  2KIZ A;  1WIM A;  1K2F A;  3KV5 A;  5H1T A;  2MIQ A;  2LGK A;  2CSY A;  4A49 A;  3N9P A;  2C2V S;  4UP0 A;  2K1J A;  2KWK A;  3DQV R;  1JM7 A;  4QF2 A;  4AVX A;  2LXP C;  3KV6 A;  2LQ6 A;  2LN0 A;  2IDA A;  4MVT A;  2EA6 A;  1WES A;  5G0F A;  3HCU A;  2VJE B;  2L75 A;  2M1R A;  2KGG A;  2NAA A;  1MM3 A;  1WEO A;  2L0B A;  2MA6 A;  3O33 A;  2YHN A;  3ASL A;  3ZVY A;  5H1U A;  2VNF A;  2KU3 A;  1IYM A;  5FEY A;  3SOU A;  2ECI A;  2Y1M A;  4S3O B;  3GL6 A;  5TBN A;  3EB6 A;  5KH7 A;  2VP7 A;  4FJC A;  1ZBD B;  2E6S A;  3T6R A;  1WEU A;  4TKP B;  5D1K B;  1DVP A;  4NN2 A;  2KFT A;  1WEP A;  2ECN A;  3EB5 A;  3SOX A;  4YAD A;  4IC2 A;  4L7X A;  3LQH A;  1WEQ A;  2K4D A;  2MT5 A;  3SHB A;  3ZPV 1;  2K16 A;  2Y43 A;  2EGP A;  4MSX A;  2LGL A;  5TDW A;  3RPG B;  3O36 A;  3DPL R;  1JM7 B;  2XEU A;  4A0C D;  2L43 A;  4FK5 A;  4ZDT A;  2MA5 A;  3PHD A;  4GNG A;  2RSD A;  2YQL A;  4XI1 A;  1U6G B;  1WEE A;  5LKX A;  5DKA A;  1LDJ B;  2KWO A;  3MHS A;  4AYC B;  3HTK C;  4LAD B;  2HDP A;  2AN6 A;  2VPE A;  4YAB A;  1WEW A;  2ECT A;  1N87 A;  1VD4 A;  3U5P A;  5FER A;  1MM2 A;  2VPG A;  2ECG A;  4S3O C;  4F52 B;  2JMD A;  5H1V A;  4R2Y A;  5AIT A;  2PNX A;  5H9M A;  4BBQ A;  2KYU A;  2LRI C;  2CT2 A;  4YAX A;  2EOD A;  4GNE A;  4R7E A;  4QF3 A;  4L58 A;  3SOW A;  1F62 A;  5B8D A;  3MHH A;  5KH9 A;  4ZQL A;  5LKU A;  2HYE D;  1RMD A;  1FBV A;  1FP0 A;  3U5N A;  4W4U A;  5LKZ A;  5TDR A;  4AYC A;  2LXH C;  5B75 A;  2KGI A;  2KRE A;  1CHC A;  1E4U A;  1WFK A;  1Z2Q A;  4O64 A;  3O37 A;  3LRQ A;  3IHP A;  1VFY A;  1HYI A;  3N9L A;  5J3X A;  5LCW B;  2Y1N A;  1JOC A;  2JMJ A;  4LK9 A;  2YU4 A;  3LQI A;  1HYJ A;  2F6N A;  2UZG A;  2M85 A;  4YBS A;  1WEN A;  3M99 A;  3ZNI A;  3N9O A;  2VPB A;  2FSA A;  2YUR A;  3ZVZ B;  2L5U A;  4N3W A;  2FUU A;  1WGM A;  3VK6 A;  3V43 A;  2XB1 A;  3NG2 A;  1G25 A;  2OXQ C;  5TAB A;  1Z6U A;  5FB1 A;  4WZ0 A;  5D1M B;  5JG6 A;  2M3H A;  1WIL A;  1T1H A;  4P5O B;  4UP5 A;  2G6Q A;  3M62 A;  5B77 A;  5EYA F;  2KWN A;  2JMI A;  2C2L A;  2RI7 A;  3N9M A;  3ZYQ A;  3ZPV E;  3L1X A;  4R8P K;  2KR4 A;  4B86 C;  2KWJ A;  2CSZ A;  2MNY A;  5LKT A;  3M63 A;  2ZET C;  2YW8 A;  2I50 A;  2LGG A;  5TRB A;  2D8S A;  3KQI A;  3C5K A;  4PTB A;  5DIN A;  2VPD A;  4PPE A;  4YAT A;  4YC9 A;  4A4B A;  4YBM A;  4X3G A;  2QIC A;  2LGV A;  2ECV A;  4WZ3 B;  2PUY A;  5G04 B;  3O35 A;  1WEV A;  2LDR A;  5AIU A;  4V3L C;  1VYX A;  4LKA A;  2G43 A;  3KNV A;  2G45 A;  5D1L B;  5B79 A;  4N4F A;  4AP4 A;  4UI9 B;  4Q6F A;  5FB0 A;  1X4U A;  4ZUX U;  2YRE A;  2YQM A;  3L11 A;  4FO9 A;  5KH3 A;  3RPG C;  5C11 A;  3C6W A;  3HCT A;  2CKL A;  4WA6 A;  2ECJ A;  4YBT A;  4V3K C;  5G05 B;  5I3L A;  1BOR A;  3I2D A;  2F42 A;  2H0D A;  4A4C A;  2MUM A;  2F6J A;  2FUI A;  1XWH A;  1LDK C;  5B78 A;  4CA1 A;  1WE9 A;  3PUQ A;  1X4I A;  3RTR B;  2VJF B;  4B7Y C;  3QZV A;  2MD7 B;  2DX8 A;  3GV4 A;  4LLB A;  3U5O A;  4WZ2 A;  2QJ0 A;  2MD8 C;  4GNF A;  3N9N A;  2E6R A;  1V87 A;  2LV9 A;  3PUR A;  1Z60 A;  3FL2 A;  4C9Z A;  4I7B A;  4LJN A;  2YYR A;  2L80 A;  2QIZ A;  2M6M A;  2BAY A;  2VJE A;  2ECW A;  3L1Z B;  4IC3 A;  3T7L A;  2YSM A;  3O70 A;  4BHW A;  3U5M A;  2VJF A;  3O7A A;  2YHO A;  1WEM A;  2KE1 A;  2CKL B;  4CCG X;  3N9Q A;  2K17 A;  4FIP A;  2JRJ A;  4GND A;  3HCS A;  2H0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...