2ECWA

Solution structure of the zinc finger, c3hc4 type (ring finger) domain tripartite motif protein 30
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
85
structure length
85
Chain Sequence
GSSGSSGMASSVLEMIKEEVTCPICLELLKEPVSADCNHSFCRACITLNYESNRNTDGKGNCPVCRVPYPFGNLKPNLHVANIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Zinc finger, C3HC4 type (RING finger) domain Tripartite motif protein 30
rcsb
source organism Mus musculus
molecule tags Apoptosis
molecule keywords Tripartite motif-containing protein 30
total genus 4
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ecwA00
4MSXA 2VJFA 2YQLA 2LGGA 2K17A 2CKLA 5FB1A 2MD8C 4CA1A 2JRJA 4MVTA 3IHPA 2YHOA 5JG6A 1WFKA 4L7XA 1WEMA 4YADA 5D1KB 2ECNA 4IC2A 5B79A 2IDAA 2NAAA 1WEEA 2MT5A 4LADB 5AIUA 2C2LA 2E6SA 4GNDA 5TABA 4UP0A 2YU4A 2ECTA 4XI1A 4AVXA 2XB1A 1RMDA 1VFYA 4C9ZA 1E4UA 3HCUA 1Z2QA 2ECIA 3LQJA 2EODA 2KE1A 3O7AA 4QF2A 4A0CD 4R7EA 4FK5A 4YATA 2LN0A 4AYCB 2YSJA 4CCGX 3V43A 2ECWA 2MNZA 4PPEA 2LV9A 1VYXA 5LKXA 2YYRA 5B8DA 5G0FA 4AP4A 5B77A 4LJNA 2YREA 2Y43A 5H1VA 2L43A 2VPBA 4X3GA 1BORA 1WILA 2F6NA 3L1ZB 2MD7B 3PHDA 2KU3A 5TBNA 2K16A 3ZNIA 2MA5A 3N9PA 3HCTA 2VP7A 4BHWA 4L58A 3LQIA 3N9NA 5DKAA 3LRQA 3L1XA 1LDJB 4QF3A 4W4UA 4V3LC 3SOUA 2YQMA 5D1LB 2BAYA 3O37A 2KWOA 2FUUA 3N9LA 3QZVA 2M85A 4A4BA 3C5KA 3SHBA 1X4IA 5DINA 3M62A 4YBTA 4ZDTA 2ECGA 5EYAF 2OXQC 2YHNA 1T1HA 4B86C 2QIZA 1LDKC 5KH7A 3N9QA 2PNXA 4NN2A 3U5OA 3O35A 5LKZA 3RPGB 2Y1MA 3EB6A 3KQIA 4LK9A 4WZ3B 2LQ6A 4AUQB 3HCSA 2UZGA 3O36A 3N9MA 4O64A 2LXPC 4A4CA 2H0DA 2EGPA 2M6MA 1MM3A 5AITA 5H1UA 3MHHA 1X4UA 2AN6A 1WEQA 1G25A 3PUQA 2CSYA 1CHCA 2G43A 2K4DA 4YABA 3FL2A 2Y1NA 4S3OB 2KWNA 4TKPB 2M1RA 1IYMA 4YBSA 2VJEB 4YAXA 2FSAA 3DQVR 1WEWA 4WZ2A 1Z60A 2L80A 2G6QA 3SOWA 3RTRB 5LCWB 2L75A 5H1TA 2MIQA 2JMJA 2JMIA 4UI9B 5LKUA 1Z6UA 4WA6A 2EA6A 2M3HA 3L11A 5B75A 5KH3A 3O70A 4GNEA 1WEPA 2ECVA 3VK6A 3ZPV1 2LDRA 1ZBDB 5B76A 2L5UA 3ZTGA 1MM2A 5FERA 2LGLA 2F6JA 4YBMA 3NG2A 2YUCA 2RI7A 3U5PA 3ASLA 4BBQA 4F52B 1WEUA 2YSMA 2LXHC 2F42A 2HDPA 2KYUA 3ZPVE 4WZ0A 2VJEA 4I7BA 1HYIA 2G45A 2K1JA 5B78A 3N9OA 3T6RA 2MUMA 5J3XA 4LLBA 4PTBA 5TDRA 3SOXA 4Q6FA 3KV5A 5I3LA 3ZVZB 3C6WA 2QJ0A 2MA6A 2JMDA 1FP0A 1WESA 3I2DA 5C13A 2I50A 2CKLB 3O34A 4I7DA 1V87A 1WIMA 1WGMA 5H9MA 3GL6A 2QICA 5KH9A 2LGVA 2ECJA 2KGIA 2VPGA 4P5OB 4FO9A 4A49A 1K2FA 2VPEA 1WEVA 1HYJA 3DPLR 1DVPA 1XWHA 1U6GB 4UP5A 2KWKA 3KNVA 2KR4A 3U5MA 2KWJA 5TDWA 2KIZA 2CSZA 2H0DB 2KGGA 4IC3A 4AYCA 5FB0A 4GNFA 2D8SA 3MHSA 2YURA 4I7CA 5FEYA 3PURA 3KV6A 4N4FA 3U5NA 2C2VS 3M99A 3T7LA 1WENA 2LGKA 2VNFA 4LKAA 4FIPA 1X4JA 3ZYQA 3EB5A 2XEUA 4ZUXU 1JM7A 2YT5A 3LQHA 2MNYA 2KFTA 5TRBA 2FUIA 4R8PK 3GV4A 4R2YA 1WE9A 1N87A 1JM7B 3RPGC 2YW8A 4ZQLA 3ZVYA 2ZETC 3M63A 1VD4A 2CT2A 2E6RA 4N3WA 3HTKC 2KREA 5C11A 4V3KC 2RSDA 1WEOA 1JOCA 2PUYA 4FJCA 2L0BA 2HYED 2VJFB 1FBVA 5G05B 5LKTA 2DX8A 4YC9A 4B7YC 2VPDA 4GB0A 1F62A 3O33A 4GNGA 5D1MB 4S3OC 2LRIC 5G04B
chains in the Genus database with same CATH superfamily
4MSXA 2VJFA 2YQLA 4F1PA 3MDBC 3DDTA 2LGGA 2K17A 2CKLA 5FB1A 2MD8C 4CA1A 2JRJA 4MVTA 3IHPA 2YHOA 5JG6A 1WFKA 4L7XA 1WEMA 3FANA 4YADA 5D1KB 2ECNA 2EXUA 4IC2A 5B79A 2IDAA 2NAAA 1WEEA 2MT5A 4LADB 5AIUA 2C2LA 2E6SA 4GNDA 5TABA 2RR4A 2YU4A 2E61A 4UP0A 2KKXA 2ECTA 4XI1A 4AVXA 2XB1A 1RMDA 2MKEA 2DSMA 1VFYA 4C9ZA 4Z0RA 1E4UA 5SVIB 3SUBA 3HCUA 4Z0OA 1Z2QA 2ECIA 3LQJA 3LVRE 2EODA 2CSVA 2XP0A 2L7PA 2KE1A 3O7AA 4QF2A 4A0CD 4R7EA 4FK5A 4YATA 2LN0A 4AYCB 3LJUX 2YSJA 2CONA 4CCGX 3V43A 2ECWA 2MNZA 4PPEA 2LV9A 1VYXA 5LKXA 2YYRA 5B8DA 5G0FA 4AP4A 5B77A 4LJNA 2YREA 2LAUA 2Y43A 5H1VA 2L43A 2DJAA 2VPBA 4X3GA 2D8UA 1BORA 1WILA 2F6NA 3L1ZB 2MD7B 3PHDA 2KU3A 5TBNA 2K16A 3ZNIA 2MA5A 3N9PA 3HCTA 2VP7A 4QQ4A 4BHWA 4L58A 3LQIA 3Q1DA 3N9NA 5DKAA 3LRQA 3L1XA 1LDJB 4QF3A 4W4UA 4V3LC 3SOUA 2YQMA 5D1LB 2BAYA 3O37A 2KWOA 2FUUA 3N9LA 3QZVA 2M85A 1MBMA 4A4BA 3C5KA 3SHBA 1X4IA 3H7HA 5DINA 2JUNA 3M62A 4YBTA 4ZDTA 2ECGA 5EYAF 2OXQC 2YHNA 1T1HA 4B86C 2QIZA 1LDKC 5KH7A 3N9QA 2PNXA 4NN2A 3U5OA 3O35A 5LKZA 3RPGB 2Y1MA 3EB6A 3KQIA 4LK9A 4WZ3B 2LQ6A 4AUQB 3HCSA 2UZGA 3O36A 3N9MA 4O64A 2LXPC 4A4CA 2FFWA 2H0DA 2EGPA 2M6MA 1MM3A 5AITA 5H1UA 1DCQA 3MHHA 1X4UA 2AN6A 5SVIA 1WEQA 1G25A 3T9KA 3PUQA 2CSYA 1CHCA 2G43A 2K4DA 4YABA 3FL2A 2Y1NA 4S3OB 2KWNA 4TKPB 2M1RA 1IYMA 4YAXA 2VJEB 3E2DA 4YBSA 2FSAA 3DQVR 3FJUB 1WEWA 4WZ2A 2XOCA 1Z60A 2L80A 2G6QA 3SOWA 3PLWA 3RTRB 5LCWB 2L75A 5H1TA 2MIQA 2JMJA 2JMIA 4UI9B 5LKUA 1Z6UA 4WA6A 3M7KA 5SVYA 2EA6A 3FM8C 2M3HA 3L11A 5B75A 5KH3A 4H9DA 5K3QA 3O70A 4GNEA 1WEPA 2ECVA 3VK6A 3ZPV1 2LDRA 1ZBDB 5B76A 2L5UA 3ZTGA 1MM2A 5FERA 2LGLA 2F6JA 4YBMA 3NG2A 2M13A 2YUCA 2RI7A 3LDYA 2P57A 3U5PA 3ASLA 4OGCA 4BBQA 4F52B 1WEUA 2YSMA 2LXHC 2F42A 2XOYA 2HDPA 2KYUA 3ZPVE 4WZ0A 2VJEA 4I7BA 1HYIA 2G45A 2K1JA 5B78A 3N9OA 3T6RA 2MUMA 5J3XA 3FEHA 4LLBA 4PTBA 5TDRA 3SOXA 2EGMA 4Q6FA 3KV5A 5I3LA 3ZVZB 3C6WA 2OWAA 2QJ0A 2MA6A 2JMDA 1FP0A 2YVRA 1WESA 3I2DA 5C13A 2I50A 2CKLB 3LVQE 3O34A 4I7DA 1V87A 1WIMA 3KDEC 1WGMA 5H9MA 3GL6A 2QICA 5KH9A 2LGVA 2ECJA 2KGIA 2VPGA 4P5OB 4FO9A 4A49A 1K2FA 2FD4A 1WEVA 2VPEA 1HYJA 3DPLR 1DVPA 1XWHA 1U6GB 4UP5A 2KWKA 2CRWA 3KNVA 2KR4A 3U5MA 2KWJA 3FAOA 2KIZA 5TDWA 4OGEA 2CSZA 2H0DB 2KGGA 4IC3A 4AYCA 5FB0A 4O62A 4GNFA 2D8SA 2IQJA 3MHSA 2YURA 2CRRA 4I7CA 5FEYA 3PURA 3KV6A 4N4FA 3U5NA 2C2VS 3M99A 3T7LA 1WENA 3DWDA 2LGKA 2VNFA 4LKAA 4FIPA 1X4JA 3ZYQA 3EB5A 2XEUA 4ZUXU 2KKYA 1JM7A 2YT5A 3O47A 2XOZA 3LQHA 2MNYA 2KFTA 2B0OE 5TRBA 2FUIA 4R8PK 3GV4A 4R2YA 1WE9A 1N87A 1JM7B 3RPGC 2YW8A 4ZQLA 3ZVYA 2ZETC 3M63A 1VD4A 2CT2A 2E6RA 4N3WA 3HTKC 3JUEA 2KREA 5C11A 4V3KC 2RSDA 1WEOA 1JOCA 2PUYA 4FJCA 5SVXA 2L0BA 2HYED 2JM3A 2VJFB 1FBVA 5G05B 5LKTA 2DX8A 4YC9A 4B7YC 2VPDA 4GB0A 1F62A 3O33A 4GNGA 5D1MB 4S3OC 2LRIC 5G04B
chains in the Genus database with same CATH topology
4MSXA 2VJFA 2YQLA 2LGGA 2K17A 2CKLA 5FB1A 2MD8C 4CA1A 2JRJA 4MVTA 3IHPA 2YHOA 5JG6A 1WFKA 4L7XA 1WEMA 4YADA 5D1KB 2ECNA 4IC2A 5B79A 2IDAA 2NAAA 1WEEA 2MT5A 4LADB 5AIUA 2C2LA 2E6SA 4GNDA 5TABA 4UP0A 2YU4A 2ECTA 4XI1A 4AVXA 2XB1A 1RMDA 1VFYA 4C9ZA 1E4UA 3HCUA 1Z2QA 2ECIA 3LQJA 2EODA 2KE1A 3O7AA 4QF2A 4A0CD 4R7EA 4FK5A 4YATA 2LN0A 4AYCB 2YSJA 4CCGX 3V43A 2ECWA 2MNZA 4PPEA 2LV9A 1VYXA 5LKXA 2YYRA 5B8DA 5G0FA 4AP4A 5B77A 4LJNA 2YREA 2Y43A 5H1VA 2L43A 2VPBA 4X3GA 1BORA 1WILA 2F6NA 3L1ZB 2MD7B 3PHDA 2KU3A 5TBNA 2K16A 3ZNIA 2MA5A 3N9PA 3HCTA 2VP7A 4BHWA 4L58A 3LQIA 3N9NA 5DKAA 3LRQA 3L1XA 1LDJB 4QF3A 4W4UA 4V3LC 3SOUA 2YQMA 5D1LB 2BAYA 3O37A 2KWOA 2FUUA 3N9LA 3QZVA 2M85A 4A4BA 3C5KA 3SHBA 1X4IA 5DINA 3M62A 4YBTA 4ZDTA 2ECGA 5EYAF 2OXQC 2YHNA 1T1HA 4B86C 2QIZA 1LDKC 5KH7A 3N9QA 2PNXA 4NN2A 3U5OA 3O35A 5LKZA 3RPGB 2Y1MA 3EB6A 3KQIA 4LK9A 4WZ3B 2LQ6A 4AUQB 3HCSA 2UZGA 3O36A 3N9MA 4O64A 2LXPC 4A4CA 2H0DA 2EGPA 2M6MA 1MM3A 5AITA 5H1UA 3MHHA 1X4UA 2AN6A 1WEQA 1G25A 3PUQA 2CSYA 1CHCA 2G43A 2K4DA 4YABA 3FL2A 2Y1NA 4S3OB 2KWNA 4TKPB 2M1RA 1IYMA 4YBSA 2VJEB 4YAXA 2FSAA 3DQVR 1WEWA 4WZ2A 1Z60A 2L80A 2G6QA 3SOWA 3RTRB 5LCWB 2L75A 5H1TA 2MIQA 2JMJA 2JMIA 4UI9B 5LKUA 1Z6UA 4WA6A 2EA6A 2M3HA 3L11A 5B75A 5KH3A 3O70A 4GNEA 1WEPA 2ECVA 3VK6A 3ZPV1 2LDRA 1ZBDB 5B76A 2L5UA 3ZTGA 1MM2A 5FERA 2LGLA 2F6JA 4YBMA 3NG2A 2YUCA 2RI7A 3U5PA 3ASLA 4BBQA 4F52B 1WEUA 2YSMA 2LXHC 2F42A 2HDPA 2KYUA 3ZPVE 4WZ0A 2VJEA 4I7BA 1HYIA 2G45A 2K1JA 5B78A 3N9OA 3T6RA 2MUMA 5J3XA 4LLBA 4PTBA 5TDRA 3SOXA 4Q6FA 3KV5A 5I3LA 3ZVZB 3C6WA 2QJ0A 2MA6A 2JMDA 1FP0A 1WESA 3I2DA 5C13A 2I50A 2CKLB 3O34A 4I7DA 1V87A 1WIMA 1WGMA 5H9MA 3GL6A 2QICA 5KH9A 2LGVA 2ECJA 2KGIA 2VPGA 4P5OB 4FO9A 4A49A 1K2FA 2VPEA 1WEVA 1HYJA 3DPLR 1DVPA 1XWHA 1U6GB 4UP5A 2KWKA 3KNVA 2KR4A 3U5MA 2KWJA 5TDWA 2KIZA 2CSZA 2H0DB 2KGGA 4IC3A 4AYCA 5FB0A 4GNFA 2D8SA 3MHSA 2YURA 4I7CA 5FEYA 3PURA 3KV6A 4N4FA 3U5NA 2C2VS 3M99A 3T7LA 1WENA 2LGKA 2VNFA 4LKAA 4FIPA 1X4JA 3ZYQA 3EB5A 2XEUA 4ZUXU 1JM7A 2YT5A 3LQHA 2MNYA 2KFTA 5TRBA 2FUIA 4R8PK 3GV4A 4R2YA 1WE9A 1N87A 1JM7B 3RPGC 2YW8A 4ZQLA 3ZVYA 2ZETC 3M63A 1VD4A 2CT2A 2E6RA 4N3WA 3HTKC 2KREA 5C11A 4V3KC 2RSDA 1WEOA 1JOCA 2PUYA 4FJCA 2L0BA 2HYED 2VJFB 1FBVA 5G05B 5LKTA 2DX8A 4YC9A 4B7YC 2VPDA 4GB0A 1F62A 3O33A 4GNGA 5D1MB 4S3OC 2LRIC 5G04B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSX A;  2VJF A;  2YQL A;  2LGG A;  2K17 A;  2CKL A;  5FB1 A;  2MD8 C;  4CA1 A;  2JRJ A;  4MVT A;  3IHP A;  2YHO A;  5JG6 A;  1WFK A;  4L7X A;  1WEM A;  4YAD A;  5D1K B;  2ECN A;  4IC2 A;  5B79 A;  2IDA A;  2NAA A;  1WEE A;  2MT5 A;  4LAD B;  5AIU A;  2C2L A;  2E6S A;  4GND A;  5TAB A;  4UP0 A;  2YU4 A;  2ECT A;  4XI1 A;  4AVX A;  2XB1 A;  1RMD A;  1VFY A;  4C9Z A;  1E4U A;  3HCU A;  1Z2Q A;  2ECI A;  3LQJ A;  2EOD A;  2KE1 A;  3O7A A;  4QF2 A;  4A0C D;  4R7E A;  4FK5 A;  4YAT A;  2LN0 A;  4AYC B;  2YSJ A;  4CCG X;  3V43 A;  2ECW A;  2MNZ A;  4PPE A;  2LV9 A;  1VYX A;  5LKX A;  2YYR A;  5B8D A;  5G0F A;  4AP4 A;  5B77 A;  4LJN A;  2YRE A;  2Y43 A;  5H1V A;  2L43 A;  2VPB A;  4X3G A;  1BOR A;  1WIL A;  2F6N A;  3L1Z B;  2MD7 B;  3PHD A;  2KU3 A;  5TBN A;  2K16 A;  3ZNI A;  2MA5 A;  3N9P A;  3HCT A;  2VP7 A;  4BHW A;  4L58 A;  3LQI A;  3N9N A;  5DKA A;  3LRQ A;  3L1X A;  1LDJ B;  4QF3 A;  4W4U A;  4V3L C;  3SOU A;  2YQM A;  5D1L B;  2BAY A;  3O37 A;  2KWO A;  2FUU A;  3N9L A;  3QZV A;  2M85 A;  4A4B A;  3C5K A;  3SHB A;  1X4I A;  5DIN A;  3M62 A;  4YBT A;  4ZDT A;  2ECG A;  5EYA F;  2OXQ C;  2YHN A;  1T1H A;  4B86 C;  2QIZ A;  1LDK C;  5KH7 A;  3N9Q A;  2PNX A;  4NN2 A;  3U5O A;  3O35 A;  5LKZ A;  3RPG B;  2Y1M A;  3EB6 A;  3KQI A;  4LK9 A;  4WZ3 B;  2LQ6 A;  4AUQ B;  3HCS A;  2UZG A;  3O36 A;  3N9M A;  4O64 A;  2LXP C;  4A4C A;  2H0D A;  2EGP A;  2M6M A;  1MM3 A;  5AIT A;  5H1U A;  3MHH A;  1X4U A;  2AN6 A;  1WEQ A;  1G25 A;  3PUQ A;  2CSY A;  1CHC A;  2G43 A;  2K4D A;  4YAB A;  3FL2 A;  2Y1N A;  4S3O B;  2KWN A;  4TKP B;  2M1R A;  1IYM A;  4YBS A;  2VJE B;  4YAX A;  2FSA A;  3DQV R;  1WEW A;  4WZ2 A;  1Z60 A;  2L80 A;  2G6Q A;  3SOW A;  3RTR B;  5LCW B;  2L75 A;  5H1T A;  2MIQ A;  2JMJ A;  2JMI A;  4UI9 B;  5LKU A;  1Z6U A;  4WA6 A;  2EA6 A;  2M3H A;  3L11 A;  5B75 A;  5KH3 A;  3O70 A;  4GNE A;  1WEP A;  2ECV A;  3VK6 A;  3ZPV 1;  2LDR A;  1ZBD B;  5B76 A;  2L5U A;  3ZTG A;  1MM2 A;  5FER A;  2LGL A;  2F6J A;  4YBM A;  3NG2 A;  2YUC A;  2RI7 A;  3U5P A;  3ASL A;  4BBQ A;  4F52 B;  1WEU A;  2YSM A;  2LXH C;  2F42 A;  2HDP A;  2KYU A;  3ZPV E;  4WZ0 A;  2VJE A;  4I7B A;  1HYI A;  2G45 A;  2K1J A;  5B78 A;  3N9O A;  3T6R A;  2MUM A;  5J3X A;  4LLB A;  4PTB A;  5TDR A;  3SOX A;  4Q6F A;  3KV5 A;  5I3L A;  3ZVZ B;  3C6W A;  2QJ0 A;  2MA6 A;  2JMD A;  1FP0 A;  1WES A;  3I2D A;  5C13 A;  2I50 A;  2CKL B;  3O34 A;  4I7D A;  1V87 A;  1WIM A;  1WGM A;  5H9M A;  3GL6 A;  2QIC A;  5KH9 A;  2LGV A;  2ECJ A;  2KGI A;  2VPG A;  4P5O B;  4FO9 A;  4A49 A;  1K2F A;  2VPE A;  1WEV A;  1HYJ A;  3DPL R;  1DVP A;  1XWH A;  1U6G B;  4UP5 A;  2KWK A;  3KNV A;  2KR4 A;  3U5M A;  2KWJ A;  5TDW A;  2KIZ A;  2CSZ A;  2H0D B;  2KGG A;  4IC3 A;  4AYC A;  5FB0 A;  4GNF A;  2D8S A;  3MHS A;  2YUR A;  4I7C A;  5FEY A;  3PUR A;  3KV6 A;  4N4F A;  3U5N A;  2C2V S;  3M99 A;  3T7L A;  1WEN A;  2LGK A;  2VNF A;  4LKA A;  4FIP A;  1X4J A;  3ZYQ A;  3EB5 A;  2XEU A;  4ZUX U;  1JM7 A;  2YT5 A;  3LQH A;  2MNY A;  2KFT A;  5TRB A;  2FUI A;  4R8P K;  3GV4 A;  4R2Y A;  1WE9 A;  1N87 A;  1JM7 B;  3RPG C;  2YW8 A;  4ZQL A;  3ZVY A;  2ZET C;  3M63 A;  1VD4 A;  2CT2 A;  2E6R A;  4N3W A;  3HTK C;  2KRE A;  5C11 A;  4V3K C;  2RSD A;  1WEO A;  1JOC A;  2PUY A;  4FJC A;  2L0B A;  2HYE D;  2VJF B;  1FBV A;  5G05 B;  5LKT A;  2DX8 A;  4YC9 A;  4B7Y C;  2VPD A;  4GB0 A;  1F62 A;  3O33 A;  4GNG A;  5D1M B;  4S3O C;  2LRI C;  5G04 B; 
#chains in the Genus database with same CATH topology
 4MSX A;  2VJF A;  2YQL A;  4F1P A;  3MDB C;  3DDT A;  2LGG A;  2K17 A;  2CKL A;  5FB1 A;  2MD8 C;  4CA1 A;  2JRJ A;  4MVT A;  3IHP A;  2YHO A;  5JG6 A;  1WFK A;  4L7X A;  1WEM A;  3FAN A;  4YAD A;  5D1K B;  2ECN A;  2EXU A;  4IC2 A;  5B79 A;  2IDA A;  2NAA A;  1WEE A;  2MT5 A;  4LAD B;  5AIU A;  2C2L A;  2E6S A;  4GND A;  5TAB A;  2RR4 A;  2YU4 A;  2E61 A;  4UP0 A;  2KKX A;  2ECT A;  4XI1 A;  4AVX A;  2XB1 A;  1RMD A;  2MKE A;  2DSM A;  1VFY A;  4C9Z A;  4Z0R A;  1E4U A;  5SVI B;  3SUB A;  3HCU A;  4Z0O A;  1Z2Q A;  2ECI A;  3LQJ A;  3LVR E;  2EOD A;  2CSV A;  2XP0 A;  2L7P A;  2KE1 A;  3O7A A;  4QF2 A;  4A0C D;  4R7E A;  4FK5 A;  4YAT A;  2LN0 A;  4AYC B;  3LJU X;  2YSJ A;  2CON A;  4CCG X;  3V43 A;  2ECW A;  2MNZ A;  4PPE A;  2LV9 A;  1VYX A;  5LKX A;  2YYR A;  5B8D A;  5G0F A;  4AP4 A;  5B77 A;  4LJN A;  2YRE A;  2LAU A;  2Y43 A;  5H1V A;  2L43 A;  2DJA A;  2VPB A;  4X3G A;  2D8U A;  1BOR A;  1WIL A;  2F6N A;  3L1Z B;  2MD7 B;  3PHD A;  2KU3 A;  5TBN A;  2K16 A;  3ZNI A;  2MA5 A;  3N9P A;  3HCT A;  2VP7 A;  4QQ4 A;  4BHW A;  4L58 A;  3LQI A;  3Q1D A;  3N9N A;  5DKA A;  3LRQ A;  3L1X A;  1LDJ B;  4QF3 A;  4W4U A;  4V3L C;  3SOU A;  2YQM A;  5D1L B;  2BAY A;  3O37 A;  2KWO A;  2FUU A;  3N9L A;  3QZV A;  2M85 A;  1MBM A;  4A4B A;  3C5K A;  3SHB A;  1X4I A;  3H7H A;  5DIN A;  2JUN A;  3M62 A;  4YBT A;  4ZDT A;  2ECG A;  5EYA F;  2OXQ C;  2YHN A;  1T1H A;  4B86 C;  2QIZ A;  1LDK C;  5KH7 A;  3N9Q A;  2PNX A;  4NN2 A;  3U5O A;  3O35 A;  5LKZ A;  3RPG B;  2Y1M A;  3EB6 A;  3KQI A;  4LK9 A;  4WZ3 B;  2LQ6 A;  4AUQ B;  3HCS A;  2UZG A;  3O36 A;  3N9M A;  4O64 A;  2LXP C;  4A4C A;  2FFW A;  2H0D A;  2EGP A;  2M6M A;  1MM3 A;  5AIT A;  5H1U A;  1DCQ A;  3MHH A;  1X4U A;  2AN6 A;  5SVI A;  1WEQ A;  1G25 A;  3T9K A;  3PUQ A;  2CSY A;  1CHC A;  2G43 A;  2K4D A;  4YAB A;  3FL2 A;  2Y1N A;  4S3O B;  2KWN A;  4TKP B;  2M1R A;  1IYM A;  4YAX A;  2VJE B;  3E2D A;  4YBS A;  2FSA A;  3DQV R;  3FJU B;  1WEW A;  4WZ2 A;  2XOC A;  1Z60 A;  2L80 A;  2G6Q A;  3SOW A;  3PLW A;  3RTR B;  5LCW B;  2L75 A;  5H1T A;  2MIQ A;  2JMJ A;  2JMI A;  4UI9 B;  5LKU A;  1Z6U A;  4WA6 A;  3M7K A;  5SVY A;  2EA6 A;  3FM8 C;  2M3H A;  3L11 A;  5B75 A;  5KH3 A;  4H9D A;  5K3Q A;  3O70 A;  4GNE A;  1WEP A;  2ECV A;  3VK6 A;  3ZPV 1;  2LDR A;  1ZBD B;  5B76 A;  2L5U A;  3ZTG A;  1MM2 A;  5FER A;  2LGL A;  2F6J A;  4YBM A;  3NG2 A;  2M13 A;  2YUC A;  2RI7 A;  3LDY A;  2P57 A;  3U5P A;  3ASL A;  4OGC A;  4BBQ A;  4F52 B;  1WEU A;  2YSM A;  2LXH C;  2F42 A;  2XOY A;  2HDP A;  2KYU A;  3ZPV E;  4WZ0 A;  2VJE A;  4I7B A;  1HYI A;  2G45 A;  2K1J A;  5B78 A;  3N9O A;  3T6R A;  2MUM A;  5J3X A;  3FEH A;  4LLB A;  4PTB A;  5TDR A;  3SOX A;  2EGM A;  4Q6F A;  3KV5 A;  5I3L A;  3ZVZ B;  3C6W A;  2OWA A;  2QJ0 A;  2MA6 A;  2JMD A;  1FP0 A;  2YVR A;  1WES A;  3I2D A;  5C13 A;  2I50 A;  2CKL B;  3LVQ E;  3O34 A;  4I7D A;  1V87 A;  1WIM A;  3KDE C;  1WGM A;  5H9M A;  3GL6 A;  2QIC A;  5KH9 A;  2LGV A;  2ECJ A;  2KGI A;  2VPG A;  4P5O B;  4FO9 A;  4A49 A;  1K2F A;  2FD4 A;  1WEV A;  2VPE A;  1HYJ A;  3DPL R;  1DVP A;  1XWH A;  1U6G B;  4UP5 A;  2KWK A;  2CRW A;  3KNV A;  2KR4 A;  3U5M A;  2KWJ A;  3FAO A;  2KIZ A;  5TDW A;  4OGE A;  2CSZ A;  2H0D B;  2KGG A;  4IC3 A;  4AYC A;  5FB0 A;  4O62 A;  4GNF A;  2D8S A;  2IQJ A;  3MHS A;  2YUR A;  2CRR A;  4I7C A;  5FEY A;  3PUR A;  3KV6 A;  4N4F A;  3U5N A;  2C2V S;  3M99 A;  3T7L A;  1WEN A;  3DWD A;  2LGK A;  2VNF A;  4LKA A;  4FIP A;  1X4J A;  3ZYQ A;  3EB5 A;  2XEU A;  4ZUX U;  2KKY A;  1JM7 A;  2YT5 A;  3O47 A;  2XOZ A;  3LQH A;  2MNY A;  2KFT A;  2B0O E;  5TRB A;  2FUI A;  4R8P K;  3GV4 A;  4R2Y A;  1WE9 A;  1N87 A;  1JM7 B;  3RPG C;  2YW8 A;  4ZQL A;  3ZVY A;  2ZET C;  3M63 A;  1VD4 A;  2CT2 A;  2E6R A;  4N3W A;  3HTK C;  3JUE A;  2KRE A;  5C11 A;  4V3K C;  2RSD A;  1WEO A;  1JOC A;  2PUY A;  4FJC A;  5SVX A;  2L0B A;  2HYE D;  2JM3 A;  2VJF B;  1FBV A;  5G05 B;  5LKT A;  2DX8 A;  4YC9 A;  4B7Y C;  2VPD A;  4GB0 A;  1F62 A;  3O33 A;  4GNG A;  5D1M B;  4S3O C;  2LRI C;  5G04 B; 
#chains in the Genus database with same CATH homology
 4MSX A;  2VJF A;  2YQL A;  2LGG A;  2K17 A;  2CKL A;  5FB1 A;  2MD8 C;  4CA1 A;  2JRJ A;  4MVT A;  3IHP A;  2YHO A;  5JG6 A;  1WFK A;  4L7X A;  1WEM A;  4YAD A;  5D1K B;  2ECN A;  4IC2 A;  5B79 A;  2IDA A;  2NAA A;  1WEE A;  2MT5 A;  4LAD B;  5AIU A;  2C2L A;  2E6S A;  4GND A;  5TAB A;  4UP0 A;  2YU4 A;  2ECT A;  4XI1 A;  4AVX A;  2XB1 A;  1RMD A;  1VFY A;  4C9Z A;  1E4U A;  3HCU A;  1Z2Q A;  2ECI A;  3LQJ A;  2EOD A;  2KE1 A;  3O7A A;  4QF2 A;  4A0C D;  4R7E A;  4FK5 A;  4YAT A;  2LN0 A;  4AYC B;  2YSJ A;  4CCG X;  3V43 A;  2ECW A;  2MNZ A;  4PPE A;  2LV9 A;  1VYX A;  5LKX A;  2YYR A;  5B8D A;  5G0F A;  4AP4 A;  5B77 A;  4LJN A;  2YRE A;  2Y43 A;  5H1V A;  2L43 A;  2VPB A;  4X3G A;  1BOR A;  1WIL A;  2F6N A;  3L1Z B;  2MD7 B;  3PHD A;  2KU3 A;  5TBN A;  2K16 A;  3ZNI A;  2MA5 A;  3N9P A;  3HCT A;  2VP7 A;  4BHW A;  4L58 A;  3LQI A;  3N9N A;  5DKA A;  3LRQ A;  3L1X A;  1LDJ B;  4QF3 A;  4W4U A;  4V3L C;  3SOU A;  2YQM A;  5D1L B;  2BAY A;  3O37 A;  2KWO A;  2FUU A;  3N9L A;  3QZV A;  2M85 A;  4A4B A;  3C5K A;  3SHB A;  1X4I A;  5DIN A;  3M62 A;  4YBT A;  4ZDT A;  2ECG A;  5EYA F;  2OXQ C;  2YHN A;  1T1H A;  4B86 C;  2QIZ A;  1LDK C;  5KH7 A;  3N9Q A;  2PNX A;  4NN2 A;  3U5O A;  3O35 A;  5LKZ A;  3RPG B;  2Y1M A;  3EB6 A;  3KQI A;  4LK9 A;  4WZ3 B;  2LQ6 A;  4AUQ B;  3HCS A;  2UZG A;  3O36 A;  3N9M A;  4O64 A;  2LXP C;  4A4C A;  2H0D A;  2EGP A;  2M6M A;  1MM3 A;  5AIT A;  5H1U A;  3MHH A;  1X4U A;  2AN6 A;  1WEQ A;  1G25 A;  3PUQ A;  2CSY A;  1CHC A;  2G43 A;  2K4D A;  4YAB A;  3FL2 A;  2Y1N A;  4S3O B;  2KWN A;  4TKP B;  2M1R A;  1IYM A;  4YBS A;  2VJE B;  4YAX A;  2FSA A;  3DQV R;  1WEW A;  4WZ2 A;  1Z60 A;  2L80 A;  2G6Q A;  3SOW A;  3RTR B;  5LCW B;  2L75 A;  5H1T A;  2MIQ A;  2JMJ A;  2JMI A;  4UI9 B;  5LKU A;  1Z6U A;  4WA6 A;  2EA6 A;  2M3H A;  3L11 A;  5B75 A;  5KH3 A;  3O70 A;  4GNE A;  1WEP A;  2ECV A;  3VK6 A;  3ZPV 1;  2LDR A;  1ZBD B;  5B76 A;  2L5U A;  3ZTG A;  1MM2 A;  5FER A;  2LGL A;  2F6J A;  4YBM A;  3NG2 A;  2YUC A;  2RI7 A;  3U5P A;  3ASL A;  4BBQ A;  4F52 B;  1WEU A;  2YSM A;  2LXH C;  2F42 A;  2HDP A;  2KYU A;  3ZPV E;  4WZ0 A;  2VJE A;  4I7B A;  1HYI A;  2G45 A;  2K1J A;  5B78 A;  3N9O A;  3T6R A;  2MUM A;  5J3X A;  4LLB A;  4PTB A;  5TDR A;  3SOX A;  4Q6F A;  3KV5 A;  5I3L A;  3ZVZ B;  3C6W A;  2QJ0 A;  2MA6 A;  2JMD A;  1FP0 A;  1WES A;  3I2D A;  5C13 A;  2I50 A;  2CKL B;  3O34 A;  4I7D A;  1V87 A;  1WIM A;  1WGM A;  5H9M A;  3GL6 A;  2QIC A;  5KH9 A;  2LGV A;  2ECJ A;  2KGI A;  2VPG A;  4P5O B;  4FO9 A;  4A49 A;  1K2F A;  2VPE A;  1WEV A;  1HYJ A;  3DPL R;  1DVP A;  1XWH A;  1U6G B;  4UP5 A;  2KWK A;  3KNV A;  2KR4 A;  3U5M A;  2KWJ A;  5TDW A;  2KIZ A;  2CSZ A;  2H0D B;  2KGG A;  4IC3 A;  4AYC A;  5FB0 A;  4GNF A;  2D8S A;  3MHS A;  2YUR A;  4I7C A;  5FEY A;  3PUR A;  3KV6 A;  4N4F A;  3U5N A;  2C2V S;  3M99 A;  3T7L A;  1WEN A;  2LGK A;  2VNF A;  4LKA A;  4FIP A;  1X4J A;  3ZYQ A;  3EB5 A;  2XEU A;  4ZUX U;  1JM7 A;  2YT5 A;  3LQH A;  2MNY A;  2KFT A;  5TRB A;  2FUI A;  4R8P K;  3GV4 A;  4R2Y A;  1WE9 A;  1N87 A;  1JM7 B;  3RPG C;  2YW8 A;  4ZQL A;  3ZVY A;  2ZET C;  3M63 A;  1VD4 A;  2CT2 A;  2E6R A;  4N3W A;  3HTK C;  2KRE A;  5C11 A;  4V3K C;  2RSD A;  1WEO A;  1JOC A;  2PUY A;  4FJC A;  2L0B A;  2HYE D;  2VJF B;  1FBV A;  5G05 B;  5LKT A;  2DX8 A;  4YC9 A;  4B7Y C;  2VPD A;  4GB0 A;  1F62 A;  3O33 A;  4GNG A;  5D1M B;  4S3O C;  2LRI C;  5G04 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...