3FJUB

Ascaris suum carboxypeptidase inhibitor in complex with human carboxypeptidase a1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
b'VRKCLSDTDCTNGEKCVQKNKICSTIVEIQRCEKEHFTIPCKSNNDCQVWAHEKICNKGCCWDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxypeptidase A1
publication title Mammalian metallopeptidase inhibition at the defense barrier of Ascaris parasite
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.170 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3fjuB00
3FJUB
chains in the Genus database with same CATH superfamily
4IC2A 3LDYA 5K3QA 2FUIA 4P5OB 2CONA 2QIZA 3N9PA 4ZUXU 4WA6A 4Z0OA 2K4DA 2EODA 3ZVZB 4YADA 3KQIA 2YW8A 5SVIB 5B75A 3T6RA 2M85A 2KGGA 2VJFA 3N9NA 3U5PA 2ECIA 5TBNA 5FB0A 4GNEA 3O47A 4N3WA 2L80A 2M13A 1DCQA 1Z6UA 3L11A 2D8SA 3ZTGA 5I3LA 3N9OA 4WZ0A 5AITA 4LK9A 2MUMA 2FUUA 2K16A 4A4BA 5LCWB 2I50A 3E2DA 2YSJA 2VJEA 3PHDA 2CRRA 2K17A 3FANA 2ECNA 2VJFB 2M1RA 5KH3A 2CKLA 3I2DA 5G04B 2L75A 2JUNA 3T9KA 5TABA 4F52B 1WEVA 3NG2A 5SVYA 1ZBDB 3FEHA 4OGCA 1VD4A 3EB5A 1MM2A 1WEQA 4YATA 3ASLA 3U5MA 3M99A 2DJAA 4V3LC 2DX8A 2E6SA 3HCTA 2MD7B 4Z0RA 4PTBA 5H1VA 1V87A 1RMDA 5B76A 2D8UA 1IYMA 2ECTA 1MM3A 3ZPVE 3FJUB 4UP5A 3HTKC 3L1ZB 4A49A 1WIMA 5LKUA 2CKLB 2VPEA 3MHHA 4YC9A 3LJUX 5G0FA 2MNZA 4YABA 5LKZA 3DWDA 1F62A 1VYXA 4N4FA 4CCGX 5FERA 2LDRA 3N9MA 2C2VS 3SOXA 2FD4A 3N9QA 3MDBC 3L1XA 3PLWA 2YT5A 2KWOA 4AYCB 1JOCA 3LQJA 2M3HA 4IC3A 3SOUA 4C9ZA 3H7HA 5D1MB 2LGGA 2VPDA 2YHOA 2LN0A 2KWNA 3FM8C 4L58A 2YQLA 3VK6A 4TKPB 2B0OE 2KWKA 2MKEA 3MHSA 3O7AA 1X4JA 4LLBA 3V43A 4ZQLA 3ZVYA 5TDWA 3GV4A 1K2FA 4CA1A 2LAUA 2JM3A 3KV6A 3O70A 2YSMA 3U5OA 5DKAA 1LDJB 2RR4A 4BHWA 2XB1A 1X4UA 2LXPC 1JM7A 2G43A 2ECJA 4H9DA 3DDTA 5JG6A 4UI9B 3JUEA 2L7PA 4B7YC 3N9LA 5B8DA 2PNXA 2IDAA 2CSVA 2FFWA 3O34A 4O62A 4XI1A 2KE1A 4BBQA 4QF2A 4W4UA 4GNFA 3KDEC 1WEEA 5LKTA 3LVQE 4S3OC 2FSAA 1CHCA 1WENA 2KU3A 5H9MA 1WE9A 3GL6A 1VFYA 1JM7B 4R2YA 2MNYA 4AP4A 2PUYA 4MSXA 2AN6A 3PUQA 5AIUA 3RPGC 1LDKC 3DQVR 4I7DA 2RI7A 4AUQB 3DPLR 3LQIA 1Z2QA 2RSDA 2EA6A 2F6JA 4OGEA 5C11A 2YREA 2VJEB 1HYIA 5H1TA 2CRWA 2ECGA 1WEOA 3O33A 4Q6FA 3LQHA 2ZETC 2JMDA 2VP7A 4R7EA 1XWHA 4I7BA 5TRBA 2MT5A 3LRQA 3RTRB 4FK5A 2YUCA 2KIZA 2K1JA 4YBTA 4GNGA 2LQ6A 1WEMA 2OXQC 4GNDA 3ZPV1 3SHBA 1WEPA 1FP0A 4B86C 4LJNA 2OWAA 1WFKA 2CT2A 2Y1NA 5SVIA 2P57A 2G45A 2MA6A 2L5UA 2F42A 4PPEA 3Q1DA 3HCSA 3HCUA 1WEUA 2CSYA 2C2LA 2HDPA 2F6NA 4FJCA 4AVXA 3C6WA 2QICA 2EXUA 2XEUA 4YBMA 2M6MA 3O37A 5TDRA 2YU4A 2KWJA 2JMIA 5KH7A 1Z60A 1DVPA 3T7LA 2BAYA 1WESA 3KV5A 1G25A 2MD8C 4NN2A 2NAAA 1WGMA 2LGLA 2XOYA 4WZ3B 2G6QA 1WILA 3SOWA 4YBSA 2MIQA 3LVRE 3FL2A 2LV9A 2Y43A 3M63A 3O36A 1BORA 5J3XA 4WZ2A 2KKYA 2VPGA 3M62A 2ECWA 2Y1MA 5LKXA 4LADB 5D1KB 4V3KC 2XOCA 5DINA 2IQJA 5B79A 4O64A 3PURA 2YURA 5SVXA 2YHNA 4S3OB 1WEWA 2LGKA 4A0CD 2YYRA 5H1UA 2CSZA 5D1LB 4R8PK 2KREA 4L7XA 4LKAA 1E4UA 1X4IA 3KNVA 1T1HA 4YAXA 4UP0A 3M7KA 2KR4A 2KKXA 2JMJA 5FEYA 2H0DA 2MA5A 4GB0A 4ZDTA 2HYED 3RPGB 4QF3A 3EB6A 2KYUA 2XP0A 4QQ4A 2LGVA 4I7CA 2E6RA 3C5KA 3ZNIA 4A4CA 2KGIA 3ZYQA 5B77A 3SUBA 4F1PA 3O35A 3QZVA 4AYCA 2XOZA 5C13A 1HYJA 1FBVA 2L43A 4X3GA 3FAOA 2EGMA 4FO9A 2UZGA 2VPBA 2JRJA 2DSMA 3IHPA 2LXHC 3U5NA 2H0DB 2ECVA 2LRIC 2EGPA 2VNFA 2YVRA 2E61A 1MBMA 1U6GB 2L0BA 5KH9A 4FIPA 5FB1A 4MVTA 5G05B 5B78A 2QJ0A 2KFTA 5EYAF 1N87A 2YQMA
chains in the Genus database with same CATH topology
2XOCA 3O47A 3PLWA 5K3QA 3LDYA 2IQJA 2EGMA 2XOYA 3LJUX 2OWAA 2CSVA 2M13A 2FFWA 2LAUA 2JM3A 2XP0A 4QQ4A 4O62A 1DCQA 2EXUA 5SVIA 3DWDA 2P57A 3H7HA 5SVXA 2CRRA 2DJAA 2CONA 3LVRE 2RR4A 4Z0RA 3SUBA 4F1PA 2KKYA 3Q1DA 3KDEC 2YVRA 3LVQE 2E61A 2D8UA 2XOZA 4Z0OA 4OGEA 2JUNA 4H9DA 2FD4A 3DDTA 3T9KA 2YREA 3FM8C 5SVIB 2B0OE 2MKEA 3MDBC 5SVYA 3FEHA 2CRWA 3E2DA 3FJUB 3JUEA 4OGCA 3M7KA 2KKXA 2L7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJU B; 
#chains in the Genus database with same CATH topology
 4IC2 A;  3LDY A;  5K3Q A;  2FUI A;  4P5O B;  2CON A;  2QIZ A;  3N9P A;  4ZUX U;  4WA6 A;  4Z0O A;  2K4D A;  2EOD A;  3ZVZ B;  4YAD A;  3KQI A;  2YW8 A;  5SVI B;  5B75 A;  3T6R A;  2M85 A;  2KGG A;  2VJF A;  3N9N A;  3U5P A;  2ECI A;  5TBN A;  5FB0 A;  4GNE A;  3O47 A;  4N3W A;  2L80 A;  2M13 A;  1DCQ A;  1Z6U A;  3L11 A;  2D8S A;  3ZTG A;  5I3L A;  3N9O A;  4WZ0 A;  5AIT A;  4LK9 A;  2MUM A;  2FUU A;  2K16 A;  4A4B A;  5LCW B;  2I50 A;  3E2D A;  2YSJ A;  2VJE A;  3PHD A;  2CRR A;  2K17 A;  3FAN A;  2ECN A;  2VJF B;  2M1R A;  5KH3 A;  2CKL A;  3I2D A;  5G04 B;  2L75 A;  2JUN A;  3T9K A;  5TAB A;  4F52 B;  1WEV A;  3NG2 A;  5SVY A;  1ZBD B;  3FEH A;  4OGC A;  1VD4 A;  3EB5 A;  1MM2 A;  1WEQ A;  4YAT A;  3ASL A;  3U5M A;  3M99 A;  2DJA A;  4V3L C;  2DX8 A;  2E6S A;  3HCT A;  2MD7 B;  4Z0R A;  4PTB A;  5H1V A;  1V87 A;  1RMD A;  5B76 A;  2D8U A;  1IYM A;  2ECT A;  1MM3 A;  3ZPV E;  3FJU B;  4UP5 A;  3HTK C;  3L1Z B;  4A49 A;  1WIM A;  5LKU A;  2CKL B;  2VPE A;  3MHH A;  4YC9 A;  3LJU X;  5G0F A;  2MNZ A;  4YAB A;  5LKZ A;  3DWD A;  1F62 A;  1VYX A;  4N4F A;  4CCG X;  5FER A;  2LDR A;  3N9M A;  2C2V S;  3SOX A;  2FD4 A;  3N9Q A;  3MDB C;  3L1X A;  3PLW A;  2YT5 A;  2KWO A;  4AYC B;  1JOC A;  3LQJ A;  2M3H A;  4IC3 A;  3SOU A;  4C9Z A;  3H7H A;  5D1M B;  2LGG A;  2VPD A;  2YHO A;  2LN0 A;  2KWN A;  3FM8 C;  4L58 A;  2YQL A;  3VK6 A;  4TKP B;  2B0O E;  2KWK A;  2MKE A;  3MHS A;  3O7A A;  1X4J A;  4LLB A;  3V43 A;  4ZQL A;  3ZVY A;  5TDW A;  3GV4 A;  1K2F A;  4CA1 A;  2LAU A;  2JM3 A;  3KV6 A;  3O70 A;  2YSM A;  3U5O A;  5DKA A;  1LDJ B;  2RR4 A;  4BHW A;  2XB1 A;  1X4U A;  2LXP C;  1JM7 A;  2G43 A;  2ECJ A;  4H9D A;  3DDT A;  5JG6 A;  4UI9 B;  3JUE A;  2L7P A;  4B7Y C;  3N9L A;  5B8D A;  2PNX A;  2IDA A;  2CSV A;  2FFW A;  3O34 A;  4O62 A;  4XI1 A;  2KE1 A;  4BBQ A;  4QF2 A;  4W4U A;  4GNF A;  3KDE C;  1WEE A;  5LKT A;  3LVQ E;  4S3O C;  2FSA A;  1CHC A;  1WEN A;  2KU3 A;  5H9M A;  1WE9 A;  3GL6 A;  1VFY A;  1JM7 B;  4R2Y A;  2MNY A;  4AP4 A;  2PUY A;  4MSX A;  2AN6 A;  3PUQ A;  5AIU A;  3RPG C;  1LDK C;  3DQV R;  4I7D A;  2RI7 A;  4AUQ B;  3DPL R;  3LQI A;  1Z2Q A;  2RSD A;  2EA6 A;  2F6J A;  4OGE A;  5C11 A;  2YRE A;  2VJE B;  1HYI A;  5H1T A;  2CRW A;  2ECG A;  1WEO A;  3O33 A;  4Q6F A;  3LQH A;  2ZET C;  2JMD A;  2VP7 A;  4R7E A;  1XWH A;  4I7B A;  5TRB A;  2MT5 A;  3LRQ A;  3RTR B;  4FK5 A;  2YUC A;  2KIZ A;  2K1J A;  4YBT A;  4GNG A;  2LQ6 A;  1WEM A;  2OXQ C;  4GND A;  3ZPV 1;  3SHB A;  1WEP A;  1FP0 A;  4B86 C;  4LJN A;  2OWA A;  1WFK A;  2CT2 A;  2Y1N A;  5SVI A;  2P57 A;  2G45 A;  2MA6 A;  2L5U A;  2F42 A;  4PPE A;  3Q1D A;  3HCS A;  3HCU A;  1WEU A;  2CSY A;  2C2L A;  2HDP A;  2F6N A;  4FJC A;  4AVX A;  3C6W A;  2QIC A;  2EXU A;  2XEU A;  4YBM A;  2M6M A;  3O37 A;  5TDR A;  2YU4 A;  2KWJ A;  2JMI A;  5KH7 A;  1Z60 A;  1DVP A;  3T7L A;  2BAY A;  1WES A;  3KV5 A;  1G25 A;  2MD8 C;  4NN2 A;  2NAA A;  1WGM A;  2LGL A;  2XOY A;  4WZ3 B;  2G6Q A;  1WIL A;  3SOW A;  4YBS A;  2MIQ A;  3LVR E;  3FL2 A;  2LV9 A;  2Y43 A;  3M63 A;  3O36 A;  1BOR A;  5J3X A;  4WZ2 A;  2KKY A;  2VPG A;  3M62 A;  2ECW A;  2Y1M A;  5LKX A;  4LAD B;  5D1K B;  4V3K C;  2XOC A;  5DIN A;  2IQJ A;  5B79 A;  4O64 A;  3PUR A;  2YUR A;  5SVX A;  2YHN A;  4S3O B;  1WEW A;  2LGK A;  4A0C D;  2YYR A;  5H1U A;  2CSZ A;  5D1L B;  4R8P K;  2KRE A;  4L7X A;  4LKA A;  1E4U A;  1X4I A;  3KNV A;  1T1H A;  4YAX A;  4UP0 A;  3M7K A;  2KR4 A;  2KKX A;  2JMJ A;  5FEY A;  2H0D A;  2MA5 A;  4GB0 A;  4ZDT A;  2HYE D;  3RPG B;  4QF3 A;  3EB6 A;  2KYU A;  2XP0 A;  4QQ4 A;  2LGV A;  4I7C A;  2E6R A;  3C5K A;  3ZNI A;  4A4C A;  2KGI A;  3ZYQ A;  5B77 A;  3SUB A;  4F1P A;  3O35 A;  3QZV A;  4AYC A;  2XOZ A;  5C13 A;  1HYJ A;  1FBV A;  2L43 A;  4X3G A;  3FAO A;  2EGM A;  4FO9 A;  2UZG A;  2VPB A;  2JRJ A;  2DSM A;  3IHP A;  2LXH C;  3U5N A;  2H0D B;  2ECV A;  2LRI C;  2EGP A;  2VNF A;  2YVR A;  2E61 A;  1MBM A;  1U6G B;  2L0B A;  5KH9 A;  4FIP A;  5FB1 A;  4MVT A;  5G05 B;  5B78 A;  2QJ0 A;  2KFT A;  5EYA F;  1N87 A;  2YQM A; 
#chains in the Genus database with same CATH homology
 2XOC A;  3O47 A;  3PLW A;  5K3Q A;  3LDY A;  2IQJ A;  2EGM A;  2XOY A;  3LJU X;  2OWA A;  2CSV A;  2M13 A;  2FFW A;  2LAU A;  2JM3 A;  2XP0 A;  4QQ4 A;  4O62 A;  1DCQ A;  2EXU A;  5SVI A;  3DWD A;  2P57 A;  3H7H A;  5SVX A;  2CRR A;  2DJA A;  2CON A;  3LVR E;  2RR4 A;  4Z0R A;  3SUB A;  4F1P A;  2KKY A;  3Q1D A;  3KDE C;  2YVR A;  3LVQ E;  2E61 A;  2D8U A;  2XOZ A;  4Z0O A;  4OGE A;  2JUN A;  4H9D A;  2FD4 A;  3DDT A;  3T9K A;  2YRE A;  3FM8 C;  5SVI B;  2B0O E;  2MKE A;  3MDB C;  5SVY A;  3FEH A;  2CRW A;  3E2D A;  3FJU B;  3JUE A;  4OGC A;  3M7K A;  2KKX A;  2L7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...