3FJUB

Ascaris suum carboxypeptidase inhibitor in complex with human carboxypeptidase a1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
VRKCLSDTDCTNGEKCVQKNKICSTIVEIQRCEKEHFTIPCKSNNDCQVWAHEKICNKGCCWDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Carboxypeptidase A1
publication title Mammalian metallopeptidase inhibition at the defense barrier of Ascaris parasite
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.170 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3fjuB00
3FJUB
chains in the Genus database with same CATH superfamily
2RI7A 1LDJB 3SOWA 2CSYA 1E4UA 2VNFA 3FEHA 3HCUA 4R7EA 5FERA 3FL2A 2LGVA 2M6MA 2P57A 1K2FA 1U6GB 3KV5A 5FEYA 3L1XA 2EGMA 3Q1DA 1G25A 1X4JA 4PTBA 5D1MB 2LGKA 3ZVYA 3RPGC 2XOCA 2FUIA 2KKXA 1VFYA 3DDTA 4QQ4A 1X4UA 4QF2A 3I2DA 2KGGA 3U5NA 2VPGA 1IYMA 2JMDA 2CSZA 3SOXA 2RR4A 1WEUA 4IC3A 2VJFA 1F62A 1WEOA 3M7KA 4V3LC 2YURA 5TBNA 4W4UA 3LVQE 1WE9A 5B8DA 5LKZA 4FIPA 4B7YC 5K3QA 4WA6A 1FP0A 2JM3A 2L75A 5J3XA 2ECWA 1CHCA 2CKLA 1WFKA 2LRIC 3ZYQA 4BBQA 3LVRE 2L43A 3O36A 3HCTA 5B79A 2K4DA 4I7DA 2DX8A 2MKEA 1WIMA 3O34A 3KNVA 2L5UA 5C13A 2ECJA 3N9NA 2G43A 3LDYA 1JOCA 2E61A 2K16A 1HYIA 2VJEA 2LDRA 2ECNA 3KV6A 4YBSA 2XOZA 4AVXA 2CONA 2LV9A 2YUCA 5TABA 4WZ3B 3FM8C 2LXHC 1VD4A 2Y1NA 1HYJA 5C11A 2FFWA 2KKYA 2XEUA 1VYXA 2YSJA 2JMIA 3IHPA 4FO9A 2ECTA 4R2YA 3L1ZB 2VPDA 2JRJA 5I3LA 2LQ6A 2KIZA 4N4FA 4AP4A 3RPGB 2C2VS 2LGGA 4LJNA 4GNDA 3DWDA 3ZVZB 4AYCB 3KQIA 2YW8A 2CRWA 5KH3A 2KREA 5DINA 4YADA 2B0OE 4QF3A 2YQMA 4A4CA 5LKTA 5G0FA 4YATA 5TDWA 2G45A 3HTKC 2EA6A 2PUYA 1N87A 3E2DA 2KWJA 4AYCA 3O33A 3SHBA 4MSXA 2KYUA 2KU3A 3GV4A 2E6RA 3EB6A 4AUQB 2L7PA 4C9ZA 5LKUA 2VJFB 5KH7A 3T6RA 1BORA 3O35A 3HCSA 2YVRA 2ZETC 4S3OB 4X3GA 2M85A 4LKAA 5AIUA 3M63A 5H9MA 2KWNA 5LCWB 2IQJA 4L7XA 1WEEA 2MT5A 2CKLB 5H1VA 2FSAA 2DJAA 3N9OA 4I7CA 2QJ0A 3LJUX 3JUEA 2YYRA 3O47A 2EXUA 3ZPV1 2K17A 4S3OC 4B86C 3GL6A 3N9PA 3M62A 3U5MA 2LGLA 2QIZA 4H9DA 2HDPA 4GNGA 5SVIA 4IC2A 5H1TA 4A4BA 5TDRA 2KGIA 4OGCA 2M13A 2VJEB 2ECGA 3PUQA 1V87A 2YREA 4UP0A 4YAXA 2KWKA 4Z0RA 3T9KA 3C5KA 4GNEA 2DSMA 2FUUA 4N3WA 2H0DB 4FK5A 3PLWA 4UI9B 1WEWA 4NN2A 2KWOA 4F1PA 2QICA 2JUNA 5DKAA 2LXPC 1DCQA 4F52B 1WEQA 2H0DA 2D8SA 2HYED 4R8PK 2L80A 5D1LB 1Z60A 3N9LA 4A49A 1XWHA 2MA6A 3QZVA 3N9MA 2F6JA 4LK9A 2K1JA 4Z0OA 3FAOA 1WILA 3O37A 5LKXA 1MBMA 4YABA 5FB1A 5B75A 3O70A 2KR4A 2YT5A 2IDAA 3PURA 2MIQA 4UP5A 3NG2A 2ECIA 1JM7A 2XOYA 2LN0A 4PPEA 4V3KC 2MNYA 5G04B 4WZ0A 5B78A 4ZUXU 2MD7B 3V43A 1WESA 3MHHA 1WENA 3KDEC 2KFTA 2UZGA 1Z2QA 2I50A 2YHNA 4FJCA 1T1HA 4LLBA 3MDBC 5SVXA 2D8UA 4WZ2A 2M3HA 2F42A 2JMJA 5B77A 4TKPB 3ZPVE 5SVIB 2G6QA 4YC9A 2M1RA 2OWAA 2E6SA 2MD8C 5TRBA 2Y1MA 2Y43A 4P5OB 2VP7A 5AITA 4YBMA 1WEMA 5B76A 2VPEA 5SVYA 3FJUB 3ZNIA 4GNFA 2ECVA 2YQLA 2YSMA 3H7HA 3U5PA 3DPLR 2YHOA 4LADB 2MUMA 4CA1A 3C6WA 1WEPA 1RMDA 3LQJA 1WGMA 2MNZA 5D1KB 3LQHA 1FBVA 2VPBA 4YBTA 2BAYA 1Z6UA 2XB1A 4XI1A 3SUBA 3LRQA 4ZQLA 3T7LA 2C2LA 3N9QA 4O62A 3DQVR 1X4IA 3PHDA 2L0BA 2YU4A 2AN6A 1LDKC 4L58A 5KH9A 2NAAA 5H1UA 4MVTA 3M99A 2KE1A 2RSDA 2LAUA 1MM3A 3L11A 4Q6FA 3ZTGA 3RTRB 1DVPA 3EB5A 1WEVA 1ZBDB 4CCGX 3O7AA 4O64A 5EYAF 3VK6A 5FB0A 3MHSA 2FD4A 1JM7B 2CRRA 2CSVA 3FANA 2CT2A 3U5OA 2EGPA 2EODA 4A0CD 4BHWA 2XP0A 2MA5A 3LQIA 2F6NA 4OGEA 5JG6A 4I7BA 1MM2A 2OXQC 2PNXA 4ZDTA 5G05B 4GB0A 3ASLA 3SOUA
chains in the Genus database with same CATH topology
4OGCA 3LVQE 2KKXA 2CRWA 2L7PA 3FM8C 2YREA 2DJAA 3H7HA 4F1PA 2JUNA 3FEHA 2FFWA 2KKYA 1DCQA 2B0OE 2FD4A 3DDTA 4Z0OA 5K3QA 3LJUX 2CRRA 3JUEA 4QQ4A 2CSVA 2MKEA 2OWAA 2JM3A 4Z0RA 3O47A 2EXUA 2P57A 3T9KA 3LDYA 2YVRA 3DWDA 2E61A 2LAUA 3KDEC 2EGMA 3E2DA 3SUBA 2RR4A 3Q1DA 2IQJA 2XP0A 3MDBC 2XOZA 4H9DA 2D8UA 3LVRE 4OGEA 5SVIA 5SVXA 3M7KA 2CONA 5SVYA 2XOYA 3PLWA 3FJUB 2XOCA 5SVIB 2M13A 4O62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJU B; 
#chains in the Genus database with same CATH topology
 2RI7 A;  1LDJ B;  3SOW A;  2CSY A;  1E4U A;  2VNF A;  3FEH A;  3HCU A;  4R7E A;  5FER A;  3FL2 A;  2LGV A;  2M6M A;  2P57 A;  1K2F A;  1U6G B;  3KV5 A;  5FEY A;  3L1X A;  2EGM A;  3Q1D A;  1G25 A;  1X4J A;  4PTB A;  5D1M B;  2LGK A;  3ZVY A;  3RPG C;  2XOC A;  2FUI A;  2KKX A;  1VFY A;  3DDT A;  4QQ4 A;  1X4U A;  4QF2 A;  3I2D A;  2KGG A;  3U5N A;  2VPG A;  1IYM A;  2JMD A;  2CSZ A;  3SOX A;  2RR4 A;  1WEU A;  4IC3 A;  2VJF A;  1F62 A;  1WEO A;  3M7K A;  4V3L C;  2YUR A;  5TBN A;  4W4U A;  3LVQ E;  1WE9 A;  5B8D A;  5LKZ A;  4FIP A;  4B7Y C;  5K3Q A;  4WA6 A;  1FP0 A;  2JM3 A;  2L75 A;  5J3X A;  2ECW A;  1CHC A;  2CKL A;  1WFK A;  2LRI C;  3ZYQ A;  4BBQ A;  3LVR E;  2L43 A;  3O36 A;  3HCT A;  5B79 A;  2K4D A;  4I7D A;  2DX8 A;  2MKE A;  1WIM A;  3O34 A;  3KNV A;  2L5U A;  5C13 A;  2ECJ A;  3N9N A;  2G43 A;  3LDY A;  1JOC A;  2E61 A;  2K16 A;  1HYI A;  2VJE A;  2LDR A;  2ECN A;  3KV6 A;  4YBS A;  2XOZ A;  4AVX A;  2CON A;  2LV9 A;  2YUC A;  5TAB A;  4WZ3 B;  3FM8 C;  2LXH C;  1VD4 A;  2Y1N A;  1HYJ A;  5C11 A;  2FFW A;  2KKY A;  2XEU A;  1VYX A;  2YSJ A;  2JMI A;  3IHP A;  4FO9 A;  2ECT A;  4R2Y A;  3L1Z B;  2VPD A;  2JRJ A;  5I3L A;  2LQ6 A;  2KIZ A;  4N4F A;  4AP4 A;  3RPG B;  2C2V S;  2LGG A;  4LJN A;  4GND A;  3DWD A;  3ZVZ B;  4AYC B;  3KQI A;  2YW8 A;  2CRW A;  5KH3 A;  2KRE A;  5DIN A;  4YAD A;  2B0O E;  4QF3 A;  2YQM A;  4A4C A;  5LKT A;  5G0F A;  4YAT A;  5TDW A;  2G45 A;  3HTK C;  2EA6 A;  2PUY A;  1N87 A;  3E2D A;  2KWJ A;  4AYC A;  3O33 A;  3SHB A;  4MSX A;  2KYU A;  2KU3 A;  3GV4 A;  2E6R A;  3EB6 A;  4AUQ B;  2L7P A;  4C9Z A;  5LKU A;  2VJF B;  5KH7 A;  3T6R A;  1BOR A;  3O35 A;  3HCS A;  2YVR A;  2ZET C;  4S3O B;  4X3G A;  2M85 A;  4LKA A;  5AIU A;  3M63 A;  5H9M A;  2KWN A;  5LCW B;  2IQJ A;  4L7X A;  1WEE A;  2MT5 A;  2CKL B;  5H1V A;  2FSA A;  2DJA A;  3N9O A;  4I7C A;  2QJ0 A;  3LJU X;  3JUE A;  2YYR A;  3O47 A;  2EXU A;  3ZPV 1;  2K17 A;  4S3O C;  4B86 C;  3GL6 A;  3N9P A;  3M62 A;  3U5M A;  2LGL A;  2QIZ A;  4H9D A;  2HDP A;  4GNG A;  5SVI A;  4IC2 A;  5H1T A;  4A4B A;  5TDR A;  2KGI A;  4OGC A;  2M13 A;  2VJE B;  2ECG A;  3PUQ A;  1V87 A;  2YRE A;  4UP0 A;  4YAX A;  2KWK A;  4Z0R A;  3T9K A;  3C5K A;  4GNE A;  2DSM A;  2FUU A;  4N3W A;  2H0D B;  4FK5 A;  3PLW A;  4UI9 B;  1WEW A;  4NN2 A;  2KWO A;  4F1P A;  2QIC A;  2JUN A;  5DKA A;  2LXP C;  1DCQ A;  4F52 B;  1WEQ A;  2H0D A;  2D8S A;  2HYE D;  4R8P K;  2L80 A;  5D1L B;  1Z60 A;  3N9L A;  4A49 A;  1XWH A;  2MA6 A;  3QZV A;  3N9M A;  2F6J A;  4LK9 A;  2K1J A;  4Z0O A;  3FAO A;  1WIL A;  3O37 A;  5LKX A;  1MBM A;  4YAB A;  5FB1 A;  5B75 A;  3O70 A;  2KR4 A;  2YT5 A;  2IDA A;  3PUR A;  2MIQ A;  4UP5 A;  3NG2 A;  2ECI A;  1JM7 A;  2XOY A;  2LN0 A;  4PPE A;  4V3K C;  2MNY A;  5G04 B;  4WZ0 A;  5B78 A;  4ZUX U;  2MD7 B;  3V43 A;  1WES A;  3MHH A;  1WEN A;  3KDE C;  2KFT A;  2UZG A;  1Z2Q A;  2I50 A;  2YHN A;  4FJC A;  1T1H A;  4LLB A;  3MDB C;  5SVX A;  2D8U A;  4WZ2 A;  2M3H A;  2F42 A;  2JMJ A;  5B77 A;  4TKP B;  3ZPV E;  5SVI B;  2G6Q A;  4YC9 A;  2M1R A;  2OWA A;  2E6S A;  2MD8 C;  5TRB A;  2Y1M A;  2Y43 A;  4P5O B;  2VP7 A;  5AIT A;  4YBM A;  1WEM A;  5B76 A;  2VPE A;  5SVY A;  3FJU B;  3ZNI A;  4GNF A;  2ECV A;  2YQL A;  2YSM A;  3H7H A;  3U5P A;  3DPL R;  2YHO A;  4LAD B;  2MUM A;  4CA1 A;  3C6W A;  1WEP A;  1RMD A;  3LQJ A;  1WGM A;  2MNZ A;  5D1K B;  3LQH A;  1FBV A;  2VPB A;  4YBT A;  2BAY A;  1Z6U A;  2XB1 A;  4XI1 A;  3SUB A;  3LRQ A;  4ZQL A;  3T7L A;  2C2L A;  3N9Q A;  4O62 A;  3DQV R;  1X4I A;  3PHD A;  2L0B A;  2YU4 A;  2AN6 A;  1LDK C;  4L58 A;  5KH9 A;  2NAA A;  5H1U A;  4MVT A;  3M99 A;  2KE1 A;  2RSD A;  2LAU A;  1MM3 A;  3L11 A;  4Q6F A;  3ZTG A;  3RTR B;  1DVP A;  3EB5 A;  1WEV A;  1ZBD B;  4CCG X;  3O7A A;  4O64 A;  5EYA F;  3VK6 A;  5FB0 A;  3MHS A;  2FD4 A;  1JM7 B;  2CRR A;  2CSV A;  3FAN A;  2CT2 A;  3U5O A;  2EGP A;  2EOD A;  4A0C D;  4BHW A;  2XP0 A;  2MA5 A;  3LQI A;  2F6N A;  4OGE A;  5JG6 A;  4I7B A;  1MM2 A;  2OXQ C;  2PNX A;  4ZDT A;  5G05 B;  4GB0 A;  3ASL A;  3SOU A; 
#chains in the Genus database with same CATH homology
 4OGC A;  3LVQ E;  2KKX A;  2CRW A;  2L7P A;  3FM8 C;  2YRE A;  2DJA A;  3H7H A;  4F1P A;  2JUN A;  3FEH A;  2FFW A;  2KKY A;  1DCQ A;  2B0O E;  2FD4 A;  3DDT A;  4Z0O A;  5K3Q A;  3LJU X;  2CRR A;  3JUE A;  4QQ4 A;  2CSV A;  2MKE A;  2OWA A;  2JM3 A;  4Z0R A;  3O47 A;  2EXU A;  2P57 A;  3T9K A;  3LDY A;  2YVR A;  3DWD A;  2E61 A;  2LAU A;  3KDE C;  2EGM A;  3E2D A;  3SUB A;  2RR4 A;  3Q1D A;  2IQJ A;  2XP0 A;  3MDB C;  2XOZ A;  4H9D A;  2D8U A;  3LVR E;  4OGE A;  5SVI A;  5SVX A;  3M7K A;  2CON A;  5SVY A;  2XOY A;  3PLW A;  3FJU B;  2XOC A;  5SVI B;  2M13 A;  4O62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...