5H1VA

Complex structure of trim24 phd-bromodomain and inhibitor 6
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
169
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQESMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 50
structure length 169
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1vA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1vA01
2KGIA 3N9QA 5E73A 4PCEA 3RPGC 4NRBA 4O75A 5CUDA 3LJWA 5I29A 5D3JA 4Q0NA 5EP7A 5CUAA 5CTLA 5F3AA 4NR6A 2DATA 5I83A 3MQMA 4OUFA 5CGPA 4UIVA 5EWHA 3AADA 5L99A 5LVQA 3VK6A 5AMEA 3UW9A 3P1EA 4LZSA 4O7BA 4XY8A 5EA1A 3SVHA 2YURA 2VJEA 5EPBA 5HQ7A 5I7XA 4MR6A 5A81A 4BW3A 2YW5A 4Q6FA 5C8GA 4QB3A 5BT5A 4WHWA 5FE4A 4NUCA 2C2VS 2K16A 4BW2A 1WIMA 2G43A 4NQMA 4O71A 5ENHA 2VJEB 2EODA 2RNXA 4QUTA 3MHSA 5LJ1A 4YK0A 4CCGX 2ECWA 2Y43A 2YUCA 5HJCA 4QC1A 3N9LA 4GNFA 4QUUA 2RSDA 3MUKA 3M62A 4O77A 3HMFA 1DVPA 2E7OA 2I50A 4CFLA 5FE2A 2L5EA 5IBNA 5I89A 5AD3A 4TU4A 3DQVR 2E7NA 4MSXA 4QEUA 2YEMA 4OGJA 4A9OA 3MB4A 5F61A 4KCXA 4IR4A 5EU1A 5ETDA 3N9NA 4TQNA 3UV2A 3ONIA 1IYMA 5CUBA 3U5LA 4O72A 3U5KA 3P1DA 4A9EA 5F63A 2L75A 3U5OA 5KO4A 4V3KC 5EI4A 3ZVYA 4QNSA 5F25A 5D7XA 5I88A 3GV4A 4UI9B 4FJCA 1G25A 3O70A 2ECNA 2MIQA 2YREA 5FFVA 4Z6HA 2YW8A 2KE1A 4MENA 5HEMA 4PPEA 1WEQA 4TTEA 1WGMA 1Z60A 3T7LA 5CFWA 5JG6A 4ZW1A 3ZYQA 4QYLA 4MR3A 3P1FA 2M6MA 3MULA 2MUMA 4QF3A 3S91A 5KTXA 5LJ2A 4LC2A 4PCIA 2VPBA 2DVRA 2M1RA 1T1HA 4LZRA 5KTUA 3L11A 3IHPA 5TDWA 3QZSA 5FE0A 4S3OC 5DKDA 2OUOA 2RNYA 5HLSA 5CQ4A 1RMDA 4QR3A 1F68A 2XEUA 2MD8C 4GPJA 5HENA 3UV4A 2KWJA 4MEPA 1K2FA 4AUQB 4N4HA 4X2IA 1WESA 5FBXA 4NR5A 4QSQA 4AP4A 2EGPA 5EICA 4PY6A 4NR4A 2RFJA 3O7AA 5FE8A 2KWKA 4TT4A 5L98A 4I7DA 2CSZA 5DFCA 4QEWA 4HBWA 5D3TA 2OSSA 3ASLA 4N4IA 4NN2A 4QY4A 5A85A 4AKNA 5A7CA 4CL9A 4A4CA 5FH7A 5ACYA 2E6SA 5FFWA 2XB1A 2KIZA 2YEKA 1WEWA 2CSYA 2DKWA 4YC9A 5D3HA 5FEYA 5F1HA 5EWCA 5L97A 3EB5A 4QSVA 5F62A 4YH4A 5HFRA 3T6RA 3SOWA 3LQIA 4WZ3B 5TDRA 5H1VA 5KH3A 5D0CA 4UITA 5EGUA 2D82A 4R2YA 4IORA 5LVRA 1LDJB 4YY4A 4P5OB 2LGKA 4YYIA 4F52B 4HXSA 4LADB 5EYAF 3O33A 5B75A 5IGLA 3O35A 3UVDA 5CQ5A 4J1PA 3PHDA 4IC2A 4GNDA 4UYFA 4A9FA 3ZYUA 5KH7A 1X0JA 5FE3A 1E4UA 2YYNA 3JVKA 3FKMX 4J0SA 2QICA 5C13A 2LXPC 4ZUXU 4BHWA 2D9EA 2L0BA 5H9MA 5FB1A 5FE6A 5I7YA 2KWNA 4TT6A 5CRZA 4KV4A 4UYFB 3HMHA 1N72A 2I8NA 5A5SA 4O7FA 4NR9A 3O36A 4YYMA 1HYIA 1WEEA 1JM7A 4N4GA 2YQMA 2L80A 4PS5A 4YBTA 5EPRA 5G0FA 1XWHA 5HRXA 5C4QA 3IU6A 4QZSA 5LKZA 5DKHA 4QR5A 4WHUA 1JM7B 4CLBA 4MR4A 2Y1MA 5A5OA 2NAAA 5I86A 5EQ1A 4IR3A 5HRVA 1FP0A 5ENBA 4FLPA 2DWWA 4LYIA 4QSXA 4NYVA 4TZ2A 5H1UA 5I3LA 4RVRA 3JVJA 5E9VA 5LKXA 4QF2A 5AIUA 1WEMA 4BW4A 4LYSA 4BJXA 1WILA 2PNXA 5B79A 5EV9A 4FO9A 5D3LA 5B8DA 4YY6A 2H60A 4F3IA 1WE9A 4FIPA 2WP1A 4HBYA 5CP5A 2E3KA 3L1XA 5DBMA 1MM2A 1F62A 4QC3A 3HTKC 5TBNA 3SOXA 3O34A 3U5JA 5DLZA 2LDRA 3ZPV1 5F36A 2YQLA 3Q2FA 4NUDA 5DX4A 4A9LA 4LZ2A 3U5PA 4QBMA 2DX8A 5EWVA 2MA5A 3Q2EA 2YDWA 5D3NA 3SVFA 3TLPA 5CU8A 2JMIA 5D25A 2K4DA 5D1LB 3LQJA 5D1MB 2VP7A 3AQAA 5HCLA 4NS5A 3MB3A 4J0RA 5DKCA 5B78A 5LKTA 5TRBA 2L84A 5JI8A 5CQ3A 4IR6A 5IIDA 5DY7A 4A9KA 5I1QA 4YBMA 1WUGA 2OO1A 2ZETC 5C11A 5CQ6A 2LGLA 3LQHA 2KREA 3SOUA 2ECTA 5AMFA 2DVQA 4A9MA 5E9IA 4OGIA 3QZVA 4C66A 4CUUA 5CUCA 4CUPA 3G0LA 2FSAA 5TB6A 2FUUA 2Y1NA 4Z1QA 2LRIC 5CUGA 3IU5A 4QR4A 5J3XA 2MNZA 5FERA 5EISA 4QSPA 1HYJA 4UYGA 5FB0A 4J3IA 5TABA 4XYAA 1N87A 4O7CA 5A83A 2R0VA 3D7CA 3ZTGA 2MJVB 4YH3A 4IOQA 5CZGA 2RO1A 2DVVA 3HCUA 3PURA 4YYHA 1X4IA 5F5ZA 4N4FA 1WEOA 2G4AA 4TZ8A 4Z93A 4ZQLA 4TT2A 2LQ6A 4QSSA 3JVMA 5AITA 4PTBA 4QSTA 3N9OA 4UIZA 4MR5A 4IOOA 3QZTA 2D8SA 5CY9A 2JMDA 2LGVA 4HBVA 2ECIA 4L58A 4HXRA 4TS8A 4O70A 5CQTA 4UIYA 2PUYA 4ZDTA 4XUAA 5IGNA 4GB0A 1JSPB 3V43A 3P1CA 2MT5A 4A4BA 5ENCA 2BAYA 2KGGA 3DAIA 4NYXA 5ETBA 2LN0A 5DKAA 1WEUA 5I80A 3RTRB 4PKLA 4QSRA 5HFQA 5DW2A 5EK9A 2ECVA 4WZ2A 2LXHC 5DYUA 5E9YA 2LSPB 1WUMA 4DONA 4O64A 4YBSA 3C5KA 3KV6A 5ENEA 4WZ0A 1MM3A 2F42A 5LCWB 4HXNA 5B76A 5L8TA 3L1ZB 3ZPVE 4CA1A 3HMEA 3UVWA 5C89A 4QSUA 5KHMA 1JOCA 2RS9B 1WEVA 4YYJA 5BT4A 4CURA 3I3JA 4A9NA 2MNYA 3RCWA 4MVTA 2E6RA 5G04B 3GL6A 4NR8A 3N9PA 2R10A 4NRCA 5F2PA 5KU3A 5C85A 4LK9A 3DPLR 3EB6A 5C7NA 4W4UA 4O7AA 5HM0A 2KU3A 4XI1A 4L7XA 2G6QA 2VNFA 1BORA 5DFDA 5KH9A 4C67A 3LRQA 2ECJA 4WA6A 2R0SA 3RPGB 2F6NA 1V87A 5II2A 5D26A 4A0CD 5D3RA 2F6JA 2UZGA 3C6WA 3UVXA 4X3GA 3P5OA 5BT3A 1X4JA 5ENJA 5E3DA 2HYED 5E74A 3U5MA 4CFKA 4Q0OA 5EVAA 5G05B 4ZC9A 5A5QA 4TYLA 1VFYA 4A9IA 5H1TA 5IGMA 5L96A 2LV9A 4E96A 5G4RA 5EPSA 5CS8A 5D3SA 2QJ0A 3FL2A 4LKAA 5FE9A 5IGKA 2KWOA 3S92A 2L43A 5DLXA 1FBVA 5H85A 5FDZA 5EWWA 4AYCA 4O7EA 5I40A 5AD2A 4UIXA 5DW1A 5K29A 4I7BA 4LR6A 2YHOA 4NR7A 4IC3A 4C9ZA 3O37A 2YHNA 5C87A 5DYCA 1EQFA 4AVXA 5FH6A 5FH8A 4ALHA 1ZBDB 4UP0A 4CUSA 4AYCB 2NXBA 5F60A 2KFTA 4B7YC 5G4SA 2R0YA 5E0RA 2LGGA 2YYRA 1ZS5A 3GG3A 3MXFA 3MHHA 1LDKC 4LJNA 4NRAA 4YYDA 5FFYA 3UVYA 3U5NA 1WFKA 2YU4A 2OXQC 5CQ8A 2VJFA 5FG5A 3M63A 2EA6A 3KNVA 3K2JA 4XUBA 2MD7B 2RNWA 4HXOA 5E3GA 2RI7A 4XY9A 2DVSA 5D24A 1Z6UA 5ENFA 5HELA 2VJFB 4YATA 4BW1A 2VPEA 4CUQA 3PUQA 4TKPB 4MEOA 4NQNA 4O78A 4YADA 4LRGA 2N9GA 5DYXA 3UV5A 2KR4A 4LDFA 5CRMA 4R7EA 5FG4A 2WP2A 2C2LA 2G45A 5LJ0A 4HBXA 1VYXA 2M3HA 4MEQA 3N9MA 4V3LC 5FE5A 4R8PK 4NXJA 4A9HA 5FE1A 1JM4B 2AN6A 3HCTA 3NG2A 4BBQA 4N3WA 4QSWA 5A5NA 4UIWA 5HQ6A 5CUEA 4S3OB 3KQIA 3DWYA 5HRWA 4YAXA 4UYEA 5A5RA 2KTBB 4ALGA 2YELA 5E9MA 2IDAA 2VPDA 5DINA 4QYDA 5LUUA 3ZNIA 2YQDA 3KV5A 5A82A 4UIUA 1Z2QA 3I2DA 4HXPA 3HCSA 4LLBA 4B86C 5D1KB 2M85A 1WEPA 3SHBA 4A49A 4O74A 4Z6IA 5E7DA 5ENGA 2K1JA 5A5PA 2K17A 4HXLA 4HXKA 1WENA 4YYKA 2I7KA 1U6GB 2KYUA 2L5UA 4KV1A 4GNEA 2L85A 2QIZA 5ENIA 4O76A 4YYNA 4QEVA 5TCMA 4TU6A 2JRJA 4WIVA 5EWDA 4A9JA 3LXJA 4NUEA 4IR5A 2FUIA 2H0DA 5IG6A 4LYWA 2CKLA 5CQAA 4Y03A 5DFBA 3ZVZB 5J0DA 2YSMA 4FK5A 4UYDA 4CUTA 4Z1SA 2H0DB 2CT2A 4UYHA 5EM3A 5E9LA 2CKLB 4HXMA 5CQ7A 5FE7A 3SVGA 4YABA 3NXBA 2HDPA 2YSJA 5HQ5A 5JWMA 2ECGA 4YYGA 5COIA 1CHCA 1VD4A 3G0JA 5B77A 4I7CA 5II1A 3M99A 2JMJA 5CPEA 5E9KA 5L8UA 5D3PA 2GRCA 1E6IA 5KTWA 4NYWA 5DYAA 5F1LA 3JVLA 4GNGA 5LKUA 2MA6A 4UP5A 2YT5A 1X4UA 2VPGA 5FG6A
chains in the Genus database with same CATH superfamily
2KGIA 3N9QA 5E73A 4PCEA 3RPGC 4NRBA 4O75A 5CUDA 3LJWA 5I29A 3LDYA 5D3JA 4Q0NA 5EP7A 5CUAA 5CTLA 5F3AA 4NR6A 2DATA 5I83A 3MQMA 4OUFA 5CGPA 4UIVA 5EWHA 3AADA 5L99A 5LVQA 3VK6A 5AMEA 3UW9A 5SVXA 3P1EA 4LZSA 4O7BA 4XY8A 5EA1A 2JM3A 2YVRA 3SVHA 2YURA 2VJEA 5EPBA 5HQ7A 5I7XA 4MR6A 5A81A 4BW3A 2YW5A 2CRWA 4Q6FA 5C8GA 4QB3A 5BT5A 4WHWA 5FE4A 4NUCA 2C2VS 2K16A 4BW2A 1WIMA 2G43A 4NQMA 4OGEA 4O71A 5ENHA 2VJEB 2E61A 2EODA 2RNXA 4QUTA 3MHSA 5LJ1A 4YK0A 4CCGX 2ECWA 2Y43A 3O47A 2YUCA 4AKIA 5HJCA 4QC1A 3N9LA 4GNFA 4QUUA 4AKGA 2RSDA 3MUKA 3M62A 4O77A 3HMFA 1DVPA 2E7OA 2I50A 4CFLA 5FE2A 2L5EA 5IBNA 4O62A 5I89A 5AD3A 4TU4A 3DQVR 2E7NA 4MSXA 4QEUA 2YEMA 4OGJA 4A9OA 3MB4A 5F61A 4KCXA 4IR4A 5EU1A 5ETDA 3N9NA 5SVIA 4TQNA 3UV2A 3ONIA 1IYMA 2XOCA 5CUBA 3U5LA 4O72A 3U5KA 2XP0A 3P1DA 5SVIB 4A9EA 5F63A 2L75A 3U5OA 5KO4A 4V3KC 5EI4A 3ZVYA 4QNSA 5F25A 5D7XA 5I88A 3GV4A 4UI9B 4FJCA 1G25A 3O70A 2ECNA 2MIQA 2YREA 5FFVA 4Z6HA 2YW8A 2KE1A 4MENA 4AI6A 5HEMA 4PPEA 1WEQA 4TTEA 1WGMA 3JUEA 1Z60A 3T7LA 5CFWA 5JG6A 4ZW1A 4AKHA 3ZYQA 4QYLA 4MR3A 3P1FA 2M6MA 3MULA 2MUMA 4QF3A 3S91A 5KTXA 5LJ2A 4LC2A 4PCIA 2VPBA 2DVRA 2M1RA 1T1HA 4LZRA 5KTUA 3L11A 3IHPA 5TDWA 3QZSA 5FE0A 2DJAA 4S3OC 5DKDA 1DCQA 2OUOA 2RNYA 5HLSA 5CQ4A 1RMDA 4QR3A 1F68A 2XEUA 2MD8C 4GPJA 5HENA 3SUBA 3UV4A 2KWJA 4MEPA 1K2FA 4AUQB 4N4HA 4X2IA 1WESA 5FBXA 4NR5A 3D1DA 4QSQA 4AP4A 2EGPA 5EICA 4PY6A 4NR4A 2RFJA 3O7AA 5FE8A 2KWKA 4TT4A 5L98A 4I7DA 2CSZA 5DFCA 4QEWA 4HBWA 5D3TA 2OSSA 3ASLA 4N4IA 4NN2A 4QY4A 5A85A 3VKHA 4AKNA 5A7CA 4CL9A 4A4CA 5FH7A 5ACYA 2E6SA 3Q1DA 5FFWA 2XB1A 2KIZA 2YEKA 1WEWA 2CSYA 2DKWA 4YC9A 5D3HA 5FEYA 5F1HA 5EWCA 5L97A 3EB5A 4QSVA 5F62A 4YH4A 5HFRA 3T6RA 3SOWA 3LQIA 3T9KA 4WZ3B 5TDRA 5H1VA 5KH3A 5D0CA 4UITA 5EGUA 2D82A 4R2YA 4IORA 5LVRA 1LDJB 4YY4A 4P5OB 2LGKA 4YYIA 4F52B 4HXSA 4LADB 5EYAF 3O33A 5B75A 2CSVA 2DSMA 5IGLA 3O35A 3UVDA 5CQ5A 4J1PA 3PHDA 4IC2A 4GNDA 4UYFA 4A9FA 3ZYUA 5KH7A 1X0JA 5FE3A 1E4UA 2YYNA 3FKMX 3JVKA 4J0SA 2QICA 2MKEA 2LXPC 5C13A 4ZUXU 4BHWA 2D9EA 2L0BA 5H9MA 5FB1A 5FE6A 5I7YA 2KWNA 4TT6A 5CRZA 3H7HA 4KV4A 4UYFB 3HMHA 1N72A 2I8NA 5A5SA 4O7FA 4NR9A 3O36A 4YYMA 1HYIA 1WEEA 1JM7A 4N4GA 2YQMA 2L80A 4PS5A 2CRRA 4YBTA 5EPRA 5G0FA 1XWHA 5HRXA 5C4QA 3IU6A 4QZSA 5LKZA 5DKHA 4QR5A 4WHUA 1JM7B 4CLBA 4MR4A 2Y1MA 3LVRE 5A5OA 2NAAA 5I86A 5EQ1A 4IR3A 5HRVA 1FP0A 1ZKRA 5ENBA 4FLPA 2DWWA 4LYIA 4QSXA 4NYVA 4TZ2A 5H1UA 5I3LA 4RVRA 3JVJA 5E9VA 2EGMA 5LKXA 4QF2A 5AIUA 1WEMA 4BW4A 4LYSA 4BJXA 1WILA 2PNXA 5B79A 5EV9A 4FO9A 5D3LA 5B8DA 4YY6A 2H60A 4F3IA 1WE9A 4FIPA 4F1PA 2WP1A 4HBYA 5CP5A 2E3KA 3L1XA 5DBMA 1MM2A 1F62A 4QC3A 3HTKC 5TBNA 3SOXA 3O34A 3U5JA 5DLZA 2LDRA 3ZPV1 5F36A 2YQLA 3Q2FA 4NUDA 5DX4A 4A9LA 4LZ2A 2XOZA 3U5PA 4QBMA 2DX8A 5EWVA 2MA5A 3Q2EA 2YDWA 5D3NA 3SVFA 3TLPA 5CU8A 2JMIA 5D25A 2K4DA 5D1LB 3LQJA 5D1MB 2VP7A 3AQAA 5HCLA 4NS5A 3MB3A 4J0RA 5DKCA 5B78A 5LKTA 3MDBC 5TRBA 2L84A 5JI8A 5CQ3A 4IR6A 5IIDA 3FANA 5DY7A 4A9KA 5I1QA 4YBMA 2FFWA 1WUGA 2OO1A 2ZETC 5C11A 5CQ6A 2LGLA 3ERRA 3LQHA 2KREA 3SOUA 2ECTA 2L7PA 5AMFA 2DVQA 4A9MA 5E9IA 4OGIA 3QZVA 4C66A 4CUUA 5CUCA 4CUPA 3G0LA 4OGCA 2FSAA 5TB6A 2FUUA 2Y1NA 4Z1QA 2LRIC 5CUGA 3IU5A 4QR4A 5J3XA 2MNZA 5FERA 5EISA 4QSPA 2XOYA 1HYJA 4UYGA 5FB0A 4J3IA 5TABA 2CONA 4XYAA 1N87A 4O7CA 5A83A 2R0VA 4Z0OA 3D7CA 3ZTGA 2MJVB 4YH3A 4IOQA 5CZGA 2EJNA 2RO1A 2DVVA 3HCUA 3PURA 4YYHA 1X4IA 5F5ZA 3KDEC 4N4FA 1WEOA 2G4AA 4TZ8A 4Z93A 4ZQLA 4TT2A 2LQ6A 4QSSA 3JVMA 5AITA 4PTBA 4QSTA 3N9OA 4UIZA 4MR5A 4IOOA 3QZTA 2D8SA 5CY9A 2JMDA 2LGVA 4HBVA 3FEHA 2ECIA 4L58A 4HXRA 4TS8A 4O70A 5CQTA 4UIYA 2PUYA 4ZDTA 4XUAA 5IGNA 4GB0A 1JSPB 3V43A 3P1CA 2MT5A 4A4BA 5ENCA 2BAYA 2KGGA 3DAIA 4NYXA 5ETBA 2LN0A 5DKAA 1WEUA 5I80A 3RTRB 4PKLA 4QSRA 5HFQA 5DW2A 5EK9A 2ECVA 3FAOA 4WZ2A 2LXHC 5DYUA 5E9YA 2LSPB 1WUMA 4DONA 4O64A 4YBSA 3C5KA 3KV6A 5ENEA 4WZ0A 1MM3A 2F42A 5LCWB 4HXNA 5B76A 5L8TA 3L1ZB 3ZPVE 2RR4A 4CA1A 3HMEA 3UVWA 5C89A 4QSUA 5KHMA 1JOCA 2RS9B 1WEVA 4YYJA 5BT4A 4CURA 3I3JA 4A9NA 2MNYA 3RCWA 4MVTA 2E6RA 5G04B 3GL6A 4NR8A 3N9PA 2B0OE 2R10A 4NRCA 5F2PA 5KU3A 5C85A 4LK9A 5SVYA 3DPLR 3EB6A 5C7NA 4W4UA 4O7AA 5HM0A 2KU3A 4XI1A 4L7XA 2G6QA 2VNFA 1BORA 2M13A 5DFDA 5KH9A 4C67A 3LRQA 2ECJA 4WA6A 2R0SA 3RPGB 2F6NA 1V87A 5II2A 5D26A 4A0CD 5D3RA 2F6JA 2UZGA 3C6WA 3UVXA 4X3GA 3P5OA 5BT3A 1X4JA 2KKYA 5ENJA 5E3DA 2HYED 3E2DA 5E74A 3U5MA 4CFKA 4Q0OA 5EVAA 5G05B 4ZC9A 5A5QA 4TYLA 1VFYA 4A9IA 5H1TA 5IGMA 5L96A 2LV9A 4E96A 5G4RA 5EPSA 5CS8A 5D3SA 2QJ0A 3FL2A 4LKAA 5FE9A 5IGKA 2KWOA 3S92A 2L43A 5K3QA 5DLXA 1FBVA 5H85A 5FDZA 5EWWA 4AYCA 4O7EA 5I40A 5AD2A 4UIXA 5DW1A 5K29A 4I7BA 4LR6A 2YHOA 4NR7A 3D1BA 3VKGA 4IC3A 4C9ZA 3O37A 3DWDA 2YHNA 5C87A 5DYCA 1EQFA 4AVXA 5FH6A 5FH8A 4ALHA 1ZBDB 4UP0A 4CUSA 2OWAA 4QQ4A 4AYCB 2NXBA 5F60A 2KFTA 4B7YC 5G4SA 2R0YA 5E0RA 2LGGA 2YYRA 1ZS5A 3GG3A 3MXFA 3MHHA 1LDKC 4LJNA 4NRAA 4YYDA 5FFYA 3UVYA 3U5NA 1WFKA 2YU4A 2OXQC 5CQ8A 2VJFA 5FG5A 3M63A 2EA6A 3KNVA 3K2JA 4XUBA 2MD7B 2RNWA 4HXOA 5E3GA 2RI7A 4XY9A 2DVSA 5D24A 1Z6UA 5ENFA 3FJUB 3FM8C 5HELA 2VJFB 4YATA 4BW1A 2VPEA 4CUQA 3PUQA 4TKPB 4MEOA 4NQNA 4O78A 4YADA 4LRGA 2N9GA 5DYXA 3UV5A 2KR4A 4LDFA 5CRMA 4R7EA 2LAUA 5FG4A 2WP2A 2C2LA 2G45A 5LJ0A 4HBXA 1VYXA 2M3HA 4MEQA 3N9MA 4V3LC 5FE5A 4R8PK 4NXJA 4A9HA 5FE1A 1JM4B 2AN6A 3HCTA 3NG2A 4BBQA 4N3WA 4QSWA 5A5NA 4UIWA 5HQ6A 3PLWA 5CUEA 4S3OB 3KQIA 3DWYA 5HRWA 4YAXA 4UYEA 5A5RA 2KTBB 4ALGA 2YELA 5E9MA 2IDAA 2VPDA 5DINA 4QYDA 5LUUA 3ZNIA 2YQDA 3KV5A 5A82A 4UIUA 1Z2QA 3I2DA 4HXPA 3HCSA 4LLBA 4B86C 5D1KB 2M85A 1WEPA 3SHBA 4A49A 4O74A 4Z6IA 5E7DA 5ENGA 2K1JA 5A5PA 2K17A 4HXLA 4HXKA 1PUOA 1WENA 2JUNA 4YYKA 2FD4A 2I7KA 1U6GB 2KYUA 2L5UA 4KV1A 3LJUX 4GNEA 2L85A 2QIZA 1MBMA 5ENIA 4O76A 4YYNA 4QEVA 5TCMA 4H9DA 4TU6A 2JRJA 4WIVA 5EWDA 4A9JA 3LXJA 4NUEA 4IR5A 2FUIA 2H0DA 5IG6A 2D8UA 4LYWA 2CKLA 5CQAA 4Y03A 5DFBA 3ZVZB 5J0DA 2YSMA 4FK5A 4UYDA 2EXUA 3DDTA 4CUTA 4Z1SA 2H0DB 2CT2A 4UYHA 5EM3A 5E9LA 2CKLB 3M7KA 4HXMA 5CQ7A 5FE7A 3SVGA 4Z0RA 4YABA 3NXBA 2HDPA 2YSJA 5HQ5A 5JWMA 2ECGA 4YYGA 5COIA 1CHCA 1VD4A 3G0JA 5B77A 4I7CA 5II1A 3M99A 2JMJA 2KKXA 5CPEA 5E9KA 5L8UA 2IQJA 5D3PA 2GRCA 1E6IA 5KTWA 4NYWA 5DYAA 5F1LA 3JVLA 2P57A 5LKUA 2MA6A 4GNGA 4UP5A 2YT5A 1X4UA 3LVQE 2VPGA 5FG6A
chains in the Genus database with same CATH topology
2KGIA 3N9QA 5E73A 4PCEA 3RPGC 4NRBA 4O75A 5CUDA 3LJWA 5I29A 5D3JA 4Q0NA 5EP7A 5CUAA 5CTLA 5F3AA 4NR6A 2DATA 5I83A 3MQMA 4OUFA 5CGPA 4UIVA 5EWHA 3AADA 5L99A 5LVQA 3VK6A 5AMEA 3UW9A 3P1EA 4LZSA 4O7BA 4XY8A 5EA1A 3SVHA 2YURA 2VJEA 5EPBA 5HQ7A 5I7XA 4MR6A 5A81A 4BW3A 2YW5A 4Q6FA 5C8GA 4QB3A 5BT5A 4WHWA 5FE4A 4NUCA 2C2VS 2K16A 4BW2A 1WIMA 2G43A 4NQMA 4O71A 5ENHA 2VJEB 2EODA 2RNXA 4QUTA 3MHSA 5LJ1A 4YK0A 4CCGX 2ECWA 2Y43A 2YUCA 5HJCA 4QC1A 3N9LA 4GNFA 4QUUA 2RSDA 3MUKA 3M62A 4O77A 3HMFA 1DVPA 2E7OA 2I50A 4CFLA 5FE2A 2L5EA 5IBNA 5I89A 5AD3A 4TU4A 3DQVR 2E7NA 4MSXA 4QEUA 2YEMA 4OGJA 4A9OA 3MB4A 5F61A 4KCXA 4IR4A 5EU1A 5ETDA 3N9NA 4TQNA 3UV2A 3ONIA 1IYMA 5CUBA 3U5LA 4O72A 3U5KA 3P1DA 4A9EA 5F63A 2L75A 3U5OA 5KO4A 4V3KC 5EI4A 3ZVYA 4QNSA 5F25A 5D7XA 5I88A 3GV4A 4UI9B 4FJCA 1G25A 3O70A 2ECNA 2MIQA 2YREA 5FFVA 4Z6HA 2YW8A 2KE1A 4MENA 5HEMA 4PPEA 1WEQA 4TTEA 1WGMA 1Z60A 3T7LA 5CFWA 5JG6A 4ZW1A 3ZYQA 4QYLA 4MR3A 3P1FA 2M6MA 3MULA 2MUMA 4QF3A 3S91A 5KTXA 5LJ2A 4LC2A 4PCIA 2VPBA 2DVRA 2M1RA 1T1HA 4LZRA 5KTUA 3L11A 3IHPA 5TDWA 3QZSA 5FE0A 4S3OC 5DKDA 2OUOA 2RNYA 5HLSA 5CQ4A 1RMDA 4QR3A 1F68A 2XEUA 2MD8C 4GPJA 5HENA 3UV4A 2KWJA 4MEPA 1K2FA 4AUQB 4N4HA 4X2IA 1WESA 5FBXA 4NR5A 4QSQA 4AP4A 2EGPA 5EICA 4PY6A 4NR4A 2RFJA 3O7AA 5FE8A 2KWKA 4TT4A 5L98A 4I7DA 2CSZA 5DFCA 4QEWA 4HBWA 5D3TA 2OSSA 3ASLA 4N4IA 4NN2A 4QY4A 5A85A 4AKNA 5A7CA 4CL9A 4A4CA 5FH7A 5ACYA 2E6SA 5FFWA 2XB1A 2KIZA 2YEKA 1WEWA 2CSYA 2DKWA 4YC9A 5D3HA 5FEYA 5F1HA 5EWCA 5L97A 3EB5A 4QSVA 5F62A 4YH4A 5HFRA 3T6RA 3SOWA 3LQIA 4WZ3B 5TDRA 5H1VA 5KH3A 5D0CA 4UITA 5EGUA 2D82A 4R2YA 4IORA 5LVRA 1LDJB 4YY4A 4P5OB 2LGKA 4YYIA 4F52B 4HXSA 4LADB 5EYAF 3O33A 5B75A 5IGLA 3O35A 3UVDA 5CQ5A 4J1PA 3PHDA 4IC2A 4GNDA 4UYFA 4A9FA 3ZYUA 5KH7A 1X0JA 5FE3A 1E4UA 2YYNA 3JVKA 3FKMX 4J0SA 2QICA 5C13A 2LXPC 4ZUXU 4BHWA 2D9EA 2L0BA 5H9MA 5FB1A 5FE6A 5I7YA 2KWNA 4TT6A 5CRZA 4KV4A 4UYFB 3HMHA 1N72A 2I8NA 5A5SA 4O7FA 4NR9A 3O36A 4YYMA 1HYIA 1WEEA 1JM7A 4N4GA 2YQMA 2L80A 4PS5A 4YBTA 5EPRA 5G0FA 1XWHA 5HRXA 5C4QA 3IU6A 4QZSA 5LKZA 5DKHA 4QR5A 4WHUA 1JM7B 4CLBA 4MR4A 2Y1MA 5A5OA 2NAAA 5I86A 5EQ1A 4IR3A 5HRVA 1FP0A 5ENBA 4FLPA 2DWWA 4LYIA 4QSXA 4NYVA 4TZ2A 5H1UA 5I3LA 4RVRA 3JVJA 5E9VA 5LKXA 4QF2A 5AIUA 1WEMA 4BW4A 4LYSA 4BJXA 1WILA 2PNXA 5B79A 5EV9A 4FO9A 5D3LA 5B8DA 4YY6A 2H60A 4F3IA 1WE9A 4FIPA 2WP1A 4HBYA 5CP5A 2E3KA 3L1XA 5DBMA 1MM2A 1F62A 4QC3A 3HTKC 5TBNA 3SOXA 3O34A 3U5JA 5DLZA 2LDRA 3ZPV1 5F36A 2YQLA 3Q2FA 4NUDA 5DX4A 4A9LA 4LZ2A 3U5PA 4QBMA 2DX8A 5EWVA 2MA5A 3Q2EA 2YDWA 5D3NA 3SVFA 3TLPA 5CU8A 2JMIA 5D25A 2K4DA 5D1LB 3LQJA 5D1MB 2VP7A 3AQAA 5HCLA 4NS5A 3MB3A 4J0RA 5DKCA 5B78A 5LKTA 5TRBA 2L84A 5JI8A 5CQ3A 4IR6A 5IIDA 5DY7A 4A9KA 5I1QA 4YBMA 1WUGA 2OO1A 2ZETC 5C11A 5CQ6A 2LGLA 3LQHA 2KREA 3SOUA 2ECTA 5AMFA 2DVQA 4A9MA 5E9IA 4OGIA 3QZVA 4C66A 4CUUA 5CUCA 4CUPA 3G0LA 2FSAA 5TB6A 2FUUA 2Y1NA 4Z1QA 2LRIC 5CUGA 3IU5A 4QR4A 5J3XA 2MNZA 5FERA 5EISA 4QSPA 1HYJA 4UYGA 5FB0A 4J3IA 5TABA 4XYAA 1N87A 4O7CA 5A83A 2R0VA 3D7CA 3ZTGA 2MJVB 4YH3A 4IOQA 5CZGA 2RO1A 2DVVA 3HCUA 3PURA 4YYHA 1X4IA 5F5ZA 4N4FA 1WEOA 2G4AA 4TZ8A 4Z93A 4ZQLA 4TT2A 2LQ6A 4QSSA 3JVMA 5AITA 4PTBA 4QSTA 3N9OA 4UIZA 4MR5A 4IOOA 3QZTA 2D8SA 5CY9A 2JMDA 2LGVA 4HBVA 2ECIA 4L58A 4HXRA 4TS8A 4O70A 5CQTA 4UIYA 2PUYA 4ZDTA 4XUAA 5IGNA 4GB0A 1JSPB 3V43A 3P1CA 2MT5A 4A4BA 5ENCA 2BAYA 2KGGA 3DAIA 4NYXA 5ETBA 2LN0A 5DKAA 1WEUA 5I80A 3RTRB 4PKLA 4QSRA 5HFQA 5DW2A 5EK9A 2ECVA 4WZ2A 2LXHC 5DYUA 5E9YA 2LSPB 1WUMA 4DONA 4O64A 4YBSA 3C5KA 3KV6A 5ENEA 4WZ0A 1MM3A 2F42A 5LCWB 4HXNA 5B76A 5L8TA 3L1ZB 3ZPVE 4CA1A 3HMEA 3UVWA 5C89A 4QSUA 5KHMA 1JOCA 2RS9B 1WEVA 4YYJA 5BT4A 4CURA 3I3JA 4A9NA 2MNYA 3RCWA 4MVTA 2E6RA 5G04B 3GL6A 4NR8A 3N9PA 2R10A 4NRCA 5F2PA 5KU3A 5C85A 4LK9A 3DPLR 3EB6A 5C7NA 4W4UA 4O7AA 5HM0A 2KU3A 4XI1A 4L7XA 2G6QA 2VNFA 1BORA 5DFDA 5KH9A 4C67A 3LRQA 2ECJA 4WA6A 2R0SA 3RPGB 2F6NA 1V87A 5II2A 5D26A 4A0CD 5D3RA 2F6JA 2UZGA 3C6WA 3UVXA 4X3GA 3P5OA 5BT3A 1X4JA 5ENJA 5E3DA 2HYED 5E74A 3U5MA 4CFKA 4Q0OA 5EVAA 5G05B 4ZC9A 5A5QA 4TYLA 1VFYA 4A9IA 5H1TA 5IGMA 5L96A 2LV9A 4E96A 5G4RA 5EPSA 5CS8A 5D3SA 2QJ0A 3FL2A 4LKAA 5FE9A 5IGKA 2KWOA 3S92A 2L43A 5DLXA 1FBVA 5H85A 5FDZA 5EWWA 4AYCA 4O7EA 5I40A 5AD2A 4UIXA 5DW1A 5K29A 4I7BA 4LR6A 2YHOA 4NR7A 4IC3A 4C9ZA 3O37A 2YHNA 5C87A 5DYCA 1EQFA 4AVXA 5FH6A 5FH8A 4ALHA 1ZBDB 4UP0A 4CUSA 4AYCB 2NXBA 5F60A 2KFTA 4B7YC 5G4SA 2R0YA 5E0RA 2LGGA 2YYRA 1ZS5A 3GG3A 3MXFA 3MHHA 1LDKC 4LJNA 4NRAA 4YYDA 5FFYA 3UVYA 3U5NA 1WFKA 2YU4A 2OXQC 5CQ8A 2VJFA 5FG5A 3M63A 2EA6A 3KNVA 3K2JA 4XUBA 2MD7B 2RNWA 4HXOA 5E3GA 2RI7A 4XY9A 2DVSA 5D24A 1Z6UA 5ENFA 5HELA 2VJFB 4YATA 4BW1A 2VPEA 4CUQA 3PUQA 4TKPB 4MEOA 4NQNA 4O78A 4YADA 4LRGA 2N9GA 5DYXA 3UV5A 2KR4A 4LDFA 5CRMA 4R7EA 5FG4A 2WP2A 2C2LA 2G45A 5LJ0A 4HBXA 1VYXA 2M3HA 4MEQA 3N9MA 4V3LC 5FE5A 4R8PK 4NXJA 4A9HA 5FE1A 1JM4B 2AN6A 3HCTA 3NG2A 4BBQA 4N3WA 4QSWA 5A5NA 4UIWA 5HQ6A 5CUEA 4S3OB 3KQIA 3DWYA 5HRWA 4YAXA 4UYEA 5A5RA 2KTBB 4ALGA 2YELA 5E9MA 2IDAA 2VPDA 5DINA 4QYDA 5LUUA 3ZNIA 2YQDA 3KV5A 5A82A 4UIUA 1Z2QA 3I2DA 4HXPA 3HCSA 4LLBA 4B86C 5D1KB 2M85A 1WEPA 3SHBA 4A49A 4O74A 4Z6IA 5E7DA 5ENGA 2K1JA 5A5PA 2K17A 4HXLA 4HXKA 1WENA 4YYKA 2I7KA 1U6GB 2KYUA 2L5UA 4KV1A 4GNEA 2L85A 2QIZA 5ENIA 4O76A 4YYNA 4QEVA 5TCMA 4TU6A 2JRJA 4WIVA 5EWDA 4A9JA 3LXJA 4NUEA 4IR5A 2FUIA 2H0DA 5IG6A 4LYWA 2CKLA 5CQAA 4Y03A 5DFBA 3ZVZB 5J0DA 2YSMA 4FK5A 4UYDA 4CUTA 4Z1SA 2H0DB 2CT2A 4UYHA 5EM3A 5E9LA 2CKLB 4HXMA 5CQ7A 5FE7A 3SVGA 4YABA 3NXBA 2HDPA 2YSJA 5HQ5A 5JWMA 2ECGA 4YYGA 5COIA 1CHCA 1VD4A 3G0JA 5B77A 4I7CA 5II1A 3M99A 2JMJA 5CPEA 5E9KA 5L8UA 5D3PA 2GRCA 1E6IA 5KTWA 4NYWA 5DYAA 5F1LA 3JVLA 4GNGA 5LKUA 2MA6A 4UP5A 2YT5A 1X4UA 2VPGA 5FG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGI A;  3N9Q A;  5E73 A;  4PCE A;  3RPG C;  4NRB A;  4O75 A;  5CUD A;  3LJW A;  5I29 A;  5D3J A;  4Q0N A;  5EP7 A;  5CUA A;  5CTL A;  5F3A A;  4NR6 A;  2DAT A;  5I83 A;  3MQM A;  4OUF A;  5CGP A;  4UIV A;  5EWH A;  3AAD A;  5L99 A;  5LVQ A;  3VK6 A;  5AME A;  3UW9 A;  3P1E A;  4LZS A;  4O7B A;  4XY8 A;  5EA1 A;  3SVH A;  2YUR A;  2VJE A;  5EPB A;  5HQ7 A;  5I7X A;  4MR6 A;  5A81 A;  4BW3 A;  2YW5 A;  4Q6F A;  5C8G A;  4QB3 A;  5BT5 A;  4WHW A;  5FE4 A;  4NUC A;  2C2V S;  2K16 A;  4BW2 A;  1WIM A;  2G43 A;  4NQM A;  4O71 A;  5ENH A;  2VJE B;  2EOD A;  2RNX A;  4QUT A;  3MHS A;  5LJ1 A;  4YK0 A;  4CCG X;  2ECW A;  2Y43 A;  2YUC A;  5HJC A;  4QC1 A;  3N9L A;  4GNF A;  4QUU A;  2RSD A;  3MUK A;  3M62 A;  4O77 A;  3HMF A;  1DVP A;  2E7O A;  2I50 A;  4CFL A;  5FE2 A;  2L5E A;  5IBN A;  5I89 A;  5AD3 A;  4TU4 A;  3DQV R;  2E7N A;  4MSX A;  4QEU A;  2YEM A;  4OGJ A;  4A9O A;  3MB4 A;  5F61 A;  4KCX A;  4IR4 A;  5EU1 A;  5ETD A;  3N9N A;  4TQN A;  3UV2 A;  3ONI A;  1IYM A;  5CUB A;  3U5L A;  4O72 A;  3U5K A;  3P1D A;  4A9E A;  5F63 A;  2L75 A;  3U5O A;  5KO4 A;  4V3K C;  5EI4 A;  3ZVY A;  4QNS A;  5F25 A;  5D7X A;  5I88 A;  3GV4 A;  4UI9 B;  4FJC A;  1G25 A;  3O70 A;  2ECN A;  2MIQ A;  2YRE A;  5FFV A;  4Z6H A;  2YW8 A;  2KE1 A;  4MEN A;  5HEM A;  4PPE A;  1WEQ A;  4TTE A;  1WGM A;  1Z60 A;  3T7L A;  5CFW A;  5JG6 A;  4ZW1 A;  3ZYQ A;  4QYL A;  4MR3 A;  3P1F A;  2M6M A;  3MUL A;  2MUM A;  4QF3 A;  3S91 A;  5KTX A;  5LJ2 A;  4LC2 A;  4PCI A;  2VPB A;  2DVR A;  2M1R A;  1T1H A;  4LZR A;  5KTU A;  3L11 A;  3IHP A;  5TDW A;  3QZS A;  5FE0 A;  4S3O C;  5DKD A;  2OUO A;  2RNY A;  5HLS A;  5CQ4 A;  1RMD A;  4QR3 A;  1F68 A;  2XEU A;  2MD8 C;  4GPJ A;  5HEN A;  3UV4 A;  2KWJ A;  4MEP A;  1K2F A;  4AUQ B;  4N4H A;  4X2I A;  1WES A;  5FBX A;  4NR5 A;  4QSQ A;  4AP4 A;  2EGP A;  5EIC A;  4PY6 A;  4NR4 A;  2RFJ A;  3O7A A;  5FE8 A;  2KWK A;  4TT4 A;  5L98 A;  4I7D A;  2CSZ A;  5DFC A;  4QEW A;  4HBW A;  5D3T A;  2OSS A;  3ASL A;  4N4I A;  4NN2 A;  4QY4 A;  5A85 A;  4AKN A;  5A7C A;  4CL9 A;  4A4C A;  5FH7 A;  5ACY A;  2E6S A;  5FFW A;  2XB1 A;  2KIZ A;  2YEK A;  1WEW A;  2CSY A;  2DKW A;  4YC9 A;  5D3H A;  5FEY A;  5F1H A;  5EWC A;  5L97 A;  3EB5 A;  4QSV A;  5F62 A;  4YH4 A;  5HFR A;  3T6R A;  3SOW A;  3LQI A;  4WZ3 B;  5TDR A;  5H1V A;  5KH3 A;  5D0C A;  4UIT A;  5EGU A;  2D82 A;  4R2Y A;  4IOR A;  5LVR A;  1LDJ B;  4YY4 A;  4P5O B;  2LGK A;  4YYI A;  4F52 B;  4HXS A;  4LAD B;  5EYA F;  3O33 A;  5B75 A;  5IGL A;  3O35 A;  3UVD A;  5CQ5 A;  4J1P A;  3PHD A;  4IC2 A;  4GND A;  4UYF A;  4A9F A;  3ZYU A;  5KH7 A;  1X0J A;  5FE3 A;  1E4U A;  2YYN A;  3JVK A;  3FKM X;  4J0S A;  2QIC A;  5C13 A;  2LXP C;  4ZUX U;  4BHW A;  2D9E A;  2L0B A;  5H9M A;  5FB1 A;  5FE6 A;  5I7Y A;  2KWN A;  4TT6 A;  5CRZ A;  4KV4 A;  4UYF B;  3HMH A;  1N72 A;  2I8N A;  5A5S A;  4O7F A;  4NR9 A;  3O36 A;  4YYM A;  1HYI A;  1WEE A;  1JM7 A;  4N4G A;  2YQM A;  2L80 A;  4PS5 A;  4YBT A;  5EPR A;  5G0F A;  1XWH A;  5HRX A;  5C4Q A;  3IU6 A;  4QZS A;  5LKZ A;  5DKH A;  4QR5 A;  4WHU A;  1JM7 B;  4CLB A;  4MR4 A;  2Y1M A;  5A5O A;  2NAA A;  5I86 A;  5EQ1 A;  4IR3 A;  5HRV A;  1FP0 A;  5ENB A;  4FLP A;  2DWW A;  4LYI A;  4QSX A;  4NYV A;  4TZ2 A;  5H1U A;  5I3L A;  4RVR A;  3JVJ A;  5E9V A;  5LKX A;  4QF2 A;  5AIU A;  1WEM A;  4BW4 A;  4LYS A;  4BJX A;  1WIL A;  2PNX A;  5B79 A;  5EV9 A;  4FO9 A;  5D3L A;  5B8D A;  4YY6 A;  2H60 A;  4F3I A;  1WE9 A;  4FIP A;  2WP1 A;  4HBY A;  5CP5 A;  2E3K A;  3L1X A;  5DBM A;  1MM2 A;  1F62 A;  4QC3 A;  3HTK C;  5TBN A;  3SOX A;  3O34 A;  3U5J A;  5DLZ A;  2LDR A;  3ZPV 1;  5F36 A;  2YQL A;  3Q2F A;  4NUD A;  5DX4 A;  4A9L A;  4LZ2 A;  3U5P A;  4QBM A;  2DX8 A;  5EWV A;  2MA5 A;  3Q2E A;  2YDW A;  5D3N A;  3SVF A;  3TLP A;  5CU8 A;  2JMI A;  5D25 A;  2K4D A;  5D1L B;  3LQJ A;  5D1M B;  2VP7 A;  3AQA A;  5HCL A;  4NS5 A;  3MB3 A;  4J0R A;  5DKC A;  5B78 A;  5LKT A;  5TRB A;  2L84 A;  5JI8 A;  5CQ3 A;  4IR6 A;  5IID A;  5DY7 A;  4A9K A;  5I1Q A;  4YBM A;  1WUG A;  2OO1 A;  2ZET C;  5C11 A;  5CQ6 A;  2LGL A;  3LQH A;  2KRE A;  3SOU A;  2ECT A;  5AMF A;  2DVQ A;  4A9M A;  5E9I A;  4OGI A;  3QZV A;  4C66 A;  4CUU A;  5CUC A;  4CUP A;  3G0L A;  2FSA A;  5TB6 A;  2FUU A;  2Y1N A;  4Z1Q A;  2LRI C;  5CUG A;  3IU5 A;  4QR4 A;  5J3X A;  2MNZ A;  5FER A;  5EIS A;  4QSP A;  1HYJ A;  4UYG A;  5FB0 A;  4J3I A;  5TAB A;  4XYA A;  1N87 A;  4O7C A;  5A83 A;  2R0V A;  3D7C A;  3ZTG A;  2MJV B;  4YH3 A;  4IOQ A;  5CZG A;  2RO1 A;  2DVV A;  3HCU A;  3PUR A;  4YYH A;  1X4I A;  5F5Z A;  4N4F A;  1WEO A;  2G4A A;  4TZ8 A;  4Z93 A;  4ZQL A;  4TT2 A;  2LQ6 A;  4QSS A;  3JVM A;  5AIT A;  4PTB A;  4QST A;  3N9O A;  4UIZ A;  4MR5 A;  4IOO A;  3QZT A;  2D8S A;  5CY9 A;  2JMD A;  2LGV A;  4HBV A;  2ECI A;  4L58 A;  4HXR A;  4TS8 A;  4O70 A;  5CQT A;  4UIY A;  2PUY A;  4ZDT A;  4XUA A;  5IGN A;  4GB0 A;  1JSP B;  3V43 A;  3P1C A;  2MT5 A;  4A4B A;  5ENC A;  2BAY A;  2KGG A;  3DAI A;  4NYX A;  5ETB A;  2LN0 A;  5DKA A;  1WEU A;  5I80 A;  3RTR B;  4PKL A;  4QSR A;  5HFQ A;  5DW2 A;  5EK9 A;  2ECV A;  4WZ2 A;  2LXH C;  5DYU A;  5E9Y A;  2LSP B;  1WUM A;  4DON A;  4O64 A;  4YBS A;  3C5K A;  3KV6 A;  5ENE A;  4WZ0 A;  1MM3 A;  2F42 A;  5LCW B;  4HXN A;  5B76 A;  5L8T A;  3L1Z B;  3ZPV E;  4CA1 A;  3HME A;  3UVW A;  5C89 A;  4QSU A;  5KHM A;  1JOC A;  2RS9 B;  1WEV A;  4YYJ A;  5BT4 A;  4CUR A;  3I3J A;  4A9N A;  2MNY A;  3RCW A;  4MVT A;  2E6R A;  5G04 B;  3GL6 A;  4NR8 A;  3N9P A;  2R10 A;  4NRC A;  5F2P A;  5KU3 A;  5C85 A;  4LK9 A;  3DPL R;  3EB6 A;  5C7N A;  4W4U A;  4O7A A;  5HM0 A;  2KU3 A;  4XI1 A;  4L7X A;  2G6Q A;  2VNF A;  1BOR A;  5DFD A;  5KH9 A;  4C67 A;  3LRQ A;  2ECJ A;  4WA6 A;  2R0S A;  3RPG B;  2F6N A;  1V87 A;  5II2 A;  5D26 A;  4A0C D;  5D3R A;  2F6J A;  2UZG A;  3C6W A;  3UVX A;  4X3G A;  3P5O A;  5BT3 A;  1X4J A;  5ENJ A;  5E3D A;  2HYE D;  5E74 A;  3U5M A;  4CFK A;  4Q0O A;  5EVA A;  5G05 B;  4ZC9 A;  5A5Q A;  4TYL A;  1VFY A;  4A9I A;  5H1T A;  5IGM A;  5L96 A;  2LV9 A;  4E96 A;  5G4R A;  5EPS A;  5CS8 A;  5D3S A;  2QJ0 A;  3FL2 A;  4LKA A;  5FE9 A;  5IGK A;  2KWO A;  3S92 A;  2L43 A;  5DLX A;  1FBV A;  5H85 A;  5FDZ A;  5EWW A;  4AYC A;  4O7E A;  5I40 A;  5AD2 A;  4UIX A;  5DW1 A;  5K29 A;  4I7B A;  4LR6 A;  2YHO A;  4NR7 A;  4IC3 A;  4C9Z A;  3O37 A;  2YHN A;  5C87 A;  5DYC A;  1EQF A;  4AVX A;  5FH6 A;  5FH8 A;  4ALH A;  1ZBD B;  4UP0 A;  4CUS A;  4AYC B;  2NXB A;  5F60 A;  2KFT A;  4B7Y C;  5G4S A;  2R0Y A;  5E0R A;  2LGG A;  2YYR A;  1ZS5 A;  3GG3 A;  3MXF A;  3MHH A;  1LDK C;  4LJN A;  4NRA A;  4YYD A;  5FFY A;  3UVY A;  3U5N A;  1WFK A;  2YU4 A;  2OXQ C;  5CQ8 A;  2VJF A;  5FG5 A;  3M63 A;  2EA6 A;  3KNV A;  3K2J A;  4XUB A;  2MD7 B;  2RNW A;  4HXO A;  5E3G A;  2RI7 A;  4XY9 A;  2DVS A;  5D24 A;  1Z6U A;  5ENF A;  5HEL A;  2VJF B;  4YAT A;  4BW1 A;  2VPE A;  4CUQ A;  3PUQ A;  4TKP B;  4MEO A;  4NQN A;  4O78 A;  4YAD A;  4LRG A;  2N9G A;  5DYX A;  3UV5 A;  2KR4 A;  4LDF A;  5CRM A;  4R7E A;  5FG4 A;  2WP2 A;  2C2L A;  2G45 A;  5LJ0 A;  4HBX A;  1VYX A;  2M3H A;  4MEQ A;  3N9M A;  4V3L C;  5FE5 A;  4R8P K;  4NXJ A;  4A9H A;  5FE1 A;  1JM4 B;  2AN6 A;  3HCT A;  3NG2 A;  4BBQ A;  4N3W A;  4QSW A;  5A5N A;  4UIW A;  5HQ6 A;  5CUE A;  4S3O B;  3KQI A;  3DWY A;  5HRW A;  4YAX A;  4UYE A;  5A5R A;  2KTB B;  4ALG A;  2YEL A;  5E9M A;  2IDA A;  2VPD A;  5DIN A;  4QYD A;  5LUU A;  3ZNI A;  2YQD A;  3KV5 A;  5A82 A;  4UIU A;  1Z2Q A;  3I2D A;  4HXP A;  3HCS A;  4LLB A;  4B86 C;  5D1K B;  2M85 A;  1WEP A;  3SHB A;  4A49 A;  4O74 A;  4Z6I A;  5E7D A;  5ENG A;  2K1J A;  5A5P A;  2K17 A;  4HXL A;  4HXK A;  1WEN A;  4YYK A;  2I7K A;  1U6G B;  2KYU A;  2L5U A;  4KV1 A;  4GNE A;  2L85 A;  2QIZ A;  5ENI A;  4O76 A;  4YYN A;  4QEV A;  5TCM A;  4TU6 A;  2JRJ A;  4WIV A;  5EWD A;  4A9J A;  3LXJ A;  4NUE A;  4IR5 A;  2FUI A;  2H0D A;  5IG6 A;  4LYW A;  2CKL A;  5CQA A;  4Y03 A;  5DFB A;  3ZVZ B;  5J0D A;  2YSM A;  4FK5 A;  4UYD A;  4CUT A;  4Z1S A;  2H0D B;  2CT2 A;  4UYH A;  5EM3 A;  5E9L A;  2CKL B;  4HXM A;  5CQ7 A;  5FE7 A;  3SVG A;  4YAB A;  3NXB A;  2HDP A;  2YSJ A;  5HQ5 A;  5JWM A;  2ECG A;  4YYG A;  5COI A;  1CHC A;  1VD4 A;  3G0J A;  5B77 A;  4I7C A;  5II1 A;  3M99 A;  2JMJ A;  5CPE A;  5E9K A;  5L8U A;  5D3P A;  2GRC A;  1E6I A;  5KTW A;  4NYW A;  5DYA A;  5F1L A;  3JVL A;  4GNG A;  5LKU A;  2MA6 A;  4UP5 A;  2YT5 A;  1X4U A;  2VPG A;  5FG6 A; 
#chains in the Genus database with same CATH topology
 2KGI A;  3N9Q A;  5E73 A;  4PCE A;  3RPG C;  4NRB A;  4O75 A;  5CUD A;  3LJW A;  5I29 A;  3LDY A;  5D3J A;  4Q0N A;  5EP7 A;  5CUA A;  5CTL A;  5F3A A;  4NR6 A;  2DAT A;  5I83 A;  3MQM A;  4OUF A;  5CGP A;  4UIV A;  5EWH A;  3AAD A;  5L99 A;  5LVQ A;  3VK6 A;  5AME A;  3UW9 A;  5SVX A;  3P1E A;  4LZS A;  4O7B A;  4XY8 A;  5EA1 A;  2JM3 A;  2YVR A;  3SVH A;  2YUR A;  2VJE A;  5EPB A;  5HQ7 A;  5I7X A;  4MR6 A;  5A81 A;  4BW3 A;  2YW5 A;  2CRW A;  4Q6F A;  5C8G A;  4QB3 A;  5BT5 A;  4WHW A;  5FE4 A;  4NUC A;  2C2V S;  2K16 A;  4BW2 A;  1WIM A;  2G43 A;  4NQM A;  4OGE A;  4O71 A;  5ENH A;  2VJE B;  2E61 A;  2EOD A;  2RNX A;  4QUT A;  3MHS A;  5LJ1 A;  4YK0 A;  4CCG X;  2ECW A;  2Y43 A;  3O47 A;  2YUC A;  4AKI A;  5HJC A;  4QC1 A;  3N9L A;  4GNF A;  4QUU A;  4AKG A;  2RSD A;  3MUK A;  3M62 A;  4O77 A;  3HMF A;  1DVP A;  2E7O A;  2I50 A;  4CFL A;  5FE2 A;  2L5E A;  5IBN A;  4O62 A;  5I89 A;  5AD3 A;  4TU4 A;  3DQV R;  2E7N A;  4MSX A;  4QEU A;  2YEM A;  4OGJ A;  4A9O A;  3MB4 A;  5F61 A;  4KCX A;  4IR4 A;  5EU1 A;  5ETD A;  3N9N A;  5SVI A;  4TQN A;  3UV2 A;  3ONI A;  1IYM A;  2XOC A;  5CUB A;  3U5L A;  4O72 A;  3U5K A;  2XP0 A;  3P1D A;  5SVI B;  4A9E A;  5F63 A;  2L75 A;  3U5O A;  5KO4 A;  4V3K C;  5EI4 A;  3ZVY A;  4QNS A;  5F25 A;  5D7X A;  5I88 A;  3GV4 A;  4UI9 B;  4FJC A;  1G25 A;  3O70 A;  2ECN A;  2MIQ A;  2YRE A;  5FFV A;  4Z6H A;  2YW8 A;  2KE1 A;  4MEN A;  4AI6 A;  5HEM A;  4PPE A;  1WEQ A;  4TTE A;  1WGM A;  3JUE A;  1Z60 A;  3T7L A;  5CFW A;  5JG6 A;  4ZW1 A;  4AKH A;  3ZYQ A;  4QYL A;  4MR3 A;  3P1F A;  2M6M A;  3MUL A;  2MUM A;  4QF3 A;  3S91 A;  5KTX A;  5LJ2 A;  4LC2 A;  4PCI A;  2VPB A;  2DVR A;  2M1R A;  1T1H A;  4LZR A;  5KTU A;  3L11 A;  3IHP A;  5TDW A;  3QZS A;  5FE0 A;  2DJA A;  4S3O C;  5DKD A;  1DCQ A;  2OUO A;  2RNY A;  5HLS A;  5CQ4 A;  1RMD A;  4QR3 A;  1F68 A;  2XEU A;  2MD8 C;  4GPJ A;  5HEN A;  3SUB A;  3UV4 A;  2KWJ A;  4MEP A;  1K2F A;  4AUQ B;  4N4H A;  4X2I A;  1WES A;  5FBX A;  4NR5 A;  3D1D A;  4QSQ A;  4AP4 A;  2EGP A;  5EIC A;  4PY6 A;  4NR4 A;  2RFJ A;  3O7A A;  5FE8 A;  2KWK A;  4TT4 A;  5L98 A;  4I7D A;  2CSZ A;  5DFC A;  4QEW A;  4HBW A;  5D3T A;  2OSS A;  3ASL A;  4N4I A;  4NN2 A;  4QY4 A;  5A85 A;  3VKH A;  4AKN A;  5A7C A;  4CL9 A;  4A4C A;  5FH7 A;  5ACY A;  2E6S A;  3Q1D A;  5FFW A;  2XB1 A;  2KIZ A;  2YEK A;  1WEW A;  2CSY A;  2DKW A;  4YC9 A;  5D3H A;  5FEY A;  5F1H A;  5EWC A;  5L97 A;  3EB5 A;  4QSV A;  5F62 A;  4YH4 A;  5HFR A;  3T6R A;  3SOW A;  3LQI A;  3T9K A;  4WZ3 B;  5TDR A;  5H1V A;  5KH3 A;  5D0C A;  4UIT A;  5EGU A;  2D82 A;  4R2Y A;  4IOR A;  5LVR A;  1LDJ B;  4YY4 A;  4P5O B;  2LGK A;  4YYI A;  4F52 B;  4HXS A;  4LAD B;  5EYA F;  3O33 A;  5B75 A;  2CSV A;  2DSM A;  5IGL A;  3O35 A;  3UVD A;  5CQ5 A;  4J1P A;  3PHD A;  4IC2 A;  4GND A;  4UYF A;  4A9F A;  3ZYU A;  5KH7 A;  1X0J A;  5FE3 A;  1E4U A;  2YYN A;  3FKM X;  3JVK A;  4J0S A;  2QIC A;  2MKE A;  2LXP C;  5C13 A;  4ZUX U;  4BHW A;  2D9E A;  2L0B A;  5H9M A;  5FB1 A;  5FE6 A;  5I7Y A;  2KWN A;  4TT6 A;  5CRZ A;  3H7H A;  4KV4 A;  4UYF B;  3HMH A;  1N72 A;  2I8N A;  5A5S A;  4O7F A;  4NR9 A;  3O36 A;  4YYM A;  1HYI A;  1WEE A;  1JM7 A;  4N4G A;  2YQM A;  2L80 A;  4PS5 A;  2CRR A;  4YBT A;  5EPR A;  5G0F A;  1XWH A;  5HRX A;  5C4Q A;  3IU6 A;  4QZS A;  5LKZ A;  5DKH A;  4QR5 A;  4WHU A;  1JM7 B;  4CLB A;  4MR4 A;  2Y1M A;  3LVR E;  5A5O A;  2NAA A;  5I86 A;  5EQ1 A;  4IR3 A;  5HRV A;  1FP0 A;  1ZKR A;  5ENB A;  4FLP A;  2DWW A;  4LYI A;  4QSX A;  4NYV A;  4TZ2 A;  5H1U A;  5I3L A;  4RVR A;  3JVJ A;  5E9V A;  2EGM A;  5LKX A;  4QF2 A;  5AIU A;  1WEM A;  4BW4 A;  4LYS A;  4BJX A;  1WIL A;  2PNX A;  5B79 A;  5EV9 A;  4FO9 A;  5D3L A;  5B8D A;  4YY6 A;  2H60 A;  4F3I A;  1WE9 A;  4FIP A;  4F1P A;  2WP1 A;  4HBY A;  5CP5 A;  2E3K A;  3L1X A;  5DBM A;  1MM2 A;  1F62 A;  4QC3 A;  3HTK C;  5TBN A;  3SOX A;  3O34 A;  3U5J A;  5DLZ A;  2LDR A;  3ZPV 1;  5F36 A;  2YQL A;  3Q2F A;  4NUD A;  5DX4 A;  4A9L A;  4LZ2 A;  2XOZ A;  3U5P A;  4QBM A;  2DX8 A;  5EWV A;  2MA5 A;  3Q2E A;  2YDW A;  5D3N A;  3SVF A;  3TLP A;  5CU8 A;  2JMI A;  5D25 A;  2K4D A;  5D1L B;  3LQJ A;  5D1M B;  2VP7 A;  3AQA A;  5HCL A;  4NS5 A;  3MB3 A;  4J0R A;  5DKC A;  5B78 A;  5LKT A;  3MDB C;  5TRB A;  2L84 A;  5JI8 A;  5CQ3 A;  4IR6 A;  5IID A;  3FAN A;  5DY7 A;  4A9K A;  5I1Q A;  4YBM A;  2FFW A;  1WUG A;  2OO1 A;  2ZET C;  5C11 A;  5CQ6 A;  2LGL A;  3ERR A;  3LQH A;  2KRE A;  3SOU A;  2ECT A;  2L7P A;  5AMF A;  2DVQ A;  4A9M A;  5E9I A;  4OGI A;  3QZV A;  4C66 A;  4CUU A;  5CUC A;  4CUP A;  3G0L A;  4OGC A;  2FSA A;  5TB6 A;  2FUU A;  2Y1N A;  4Z1Q A;  2LRI C;  5CUG A;  3IU5 A;  4QR4 A;  5J3X A;  2MNZ A;  5FER A;  5EIS A;  4QSP A;  2XOY A;  1HYJ A;  4UYG A;  5FB0 A;  4J3I A;  5TAB A;  2CON A;  4XYA A;  1N87 A;  4O7C A;  5A83 A;  2R0V A;  4Z0O A;  3D7C A;  3ZTG A;  2MJV B;  4YH3 A;  4IOQ A;  5CZG A;  2EJN A;  2RO1 A;  2DVV A;  3HCU A;  3PUR A;  4YYH A;  1X4I A;  5F5Z A;  3KDE C;  4N4F A;  1WEO A;  2G4A A;  4TZ8 A;  4Z93 A;  4ZQL A;  4TT2 A;  2LQ6 A;  4QSS A;  3JVM A;  5AIT A;  4PTB A;  4QST A;  3N9O A;  4UIZ A;  4MR5 A;  4IOO A;  3QZT A;  2D8S A;  5CY9 A;  2JMD A;  2LGV A;  4HBV A;  3FEH A;  2ECI A;  4L58 A;  4HXR A;  4TS8 A;  4O70 A;  5CQT A;  4UIY A;  2PUY A;  4ZDT A;  4XUA A;  5IGN A;  4GB0 A;  1JSP B;  3V43 A;  3P1C A;  2MT5 A;  4A4B A;  5ENC A;  2BAY A;  2KGG A;  3DAI A;  4NYX A;  5ETB A;  2LN0 A;  5DKA A;  1WEU A;  5I80 A;  3RTR B;  4PKL A;  4QSR A;  5HFQ A;  5DW2 A;  5EK9 A;  2ECV A;  3FAO A;  4WZ2 A;  2LXH C;  5DYU A;  5E9Y A;  2LSP B;  1WUM A;  4DON A;  4O64 A;  4YBS A;  3C5K A;  3KV6 A;  5ENE A;  4WZ0 A;  1MM3 A;  2F42 A;  5LCW B;  4HXN A;  5B76 A;  5L8T A;  3L1Z B;  3ZPV E;  2RR4 A;  4CA1 A;  3HME A;  3UVW A;  5C89 A;  4QSU A;  5KHM A;  1JOC A;  2RS9 B;  1WEV A;  4YYJ A;  5BT4 A;  4CUR A;  3I3J A;  4A9N A;  2MNY A;  3RCW A;  4MVT A;  2E6R A;  5G04 B;  3GL6 A;  4NR8 A;  3N9P A;  2B0O E;  2R10 A;  4NRC A;  5F2P A;  5KU3 A;  5C85 A;  4LK9 A;  5SVY A;  3DPL R;  3EB6 A;  5C7N A;  4W4U A;  4O7A A;  5HM0 A;  2KU3 A;  4XI1 A;  4L7X A;  2G6Q A;  2VNF A;  1BOR A;  2M13 A;  5DFD A;  5KH9 A;  4C67 A;  3LRQ A;  2ECJ A;  4WA6 A;  2R0S A;  3RPG B;  2F6N A;  1V87 A;  5II2 A;  5D26 A;  4A0C D;  5D3R A;  2F6J A;  2UZG A;  3C6W A;  3UVX A;  4X3G A;  3P5O A;  5BT3 A;  1X4J A;  2KKY A;  5ENJ A;  5E3D A;  2HYE D;  3E2D A;  5E74 A;  3U5M A;  4CFK A;  4Q0O A;  5EVA A;  5G05 B;  4ZC9 A;  5A5Q A;  4TYL A;  1VFY A;  4A9I A;  5H1T A;  5IGM A;  5L96 A;  2LV9 A;  4E96 A;  5G4R A;  5EPS A;  5CS8 A;  5D3S A;  2QJ0 A;  3FL2 A;  4LKA A;  5FE9 A;  5IGK A;  2KWO A;  3S92 A;  2L43 A;  5K3Q A;  5DLX A;  1FBV A;  5H85 A;  5FDZ A;  5EWW A;  4AYC A;  4O7E A;  5I40 A;  5AD2 A;  4UIX A;  5DW1 A;  5K29 A;  4I7B A;  4LR6 A;  2YHO A;  4NR7 A;  3D1B A;  3VKG A;  4IC3 A;  4C9Z A;  3O37 A;  3DWD A;  2YHN A;  5C87 A;  5DYC A;  1EQF A;  4AVX A;  5FH6 A;  5FH8 A;  4ALH A;  1ZBD B;  4UP0 A;  4CUS A;  2OWA A;  4QQ4 A;  4AYC B;  2NXB A;  5F60 A;  2KFT A;  4B7Y C;  5G4S A;  2R0Y A;  5E0R A;  2LGG A;  2YYR A;  1ZS5 A;  3GG3 A;  3MXF A;  3MHH A;  1LDK C;  4LJN A;  4NRA A;  4YYD A;  5FFY A;  3UVY A;  3U5N A;  1WFK A;  2YU4 A;  2OXQ C;  5CQ8 A;  2VJF A;  5FG5 A;  3M63 A;  2EA6 A;  3KNV A;  3K2J A;  4XUB A;  2MD7 B;  2RNW A;  4HXO A;  5E3G A;  2RI7 A;  4XY9 A;  2DVS A;  5D24 A;  1Z6U A;  5ENF A;  3FJU B;  3FM8 C;  5HEL A;  2VJF B;  4YAT A;  4BW1 A;  2VPE A;  4CUQ A;  3PUQ A;  4TKP B;  4MEO A;  4NQN A;  4O78 A;  4YAD A;  4LRG A;  2N9G A;  5DYX A;  3UV5 A;  2KR4 A;  4LDF A;  5CRM A;  4R7E A;  2LAU A;  5FG4 A;  2WP2 A;  2C2L A;  2G45 A;  5LJ0 A;  4HBX A;  1VYX A;  2M3H A;  4MEQ A;  3N9M A;  4V3L C;  5FE5 A;  4R8P K;  4NXJ A;  4A9H A;  5FE1 A;  1JM4 B;  2AN6 A;  3HCT A;  3NG2 A;  4BBQ A;  4N3W A;  4QSW A;  5A5N A;  4UIW A;  5HQ6 A;  3PLW A;  5CUE A;  4S3O B;  3KQI A;  3DWY A;  5HRW A;  4YAX A;  4UYE A;  5A5R A;  2KTB B;  4ALG A;  2YEL A;  5E9M A;  2IDA A;  2VPD A;  5DIN A;  4QYD A;  5LUU A;  3ZNI A;  2YQD A;  3KV5 A;  5A82 A;  4UIU A;  1Z2Q A;  3I2D A;  4HXP A;  3HCS A;  4LLB A;  4B86 C;  5D1K B;  2M85 A;  1WEP A;  3SHB A;  4A49 A;  4O74 A;  4Z6I A;  5E7D A;  5ENG A;  2K1J A;  5A5P A;  2K17 A;  4HXL A;  4HXK A;  1PUO A;  1WEN A;  2JUN A;  4YYK A;  2FD4 A;  2I7K A;  1U6G B;  2KYU A;  2L5U A;  4KV1 A;  3LJU X;  4GNE A;  2L85 A;  2QIZ A;  1MBM A;  5ENI A;  4O76 A;  4YYN A;  4QEV A;  5TCM A;  4H9D A;  4TU6 A;  2JRJ A;  4WIV A;  5EWD A;  4A9J A;  3LXJ A;  4NUE A;  4IR5 A;  2FUI A;  2H0D A;  5IG6 A;  2D8U A;  4LYW A;  2CKL A;  5CQA A;  4Y03 A;  5DFB A;  3ZVZ B;  5J0D A;  2YSM A;  4FK5 A;  4UYD A;  2EXU A;  3DDT A;  4CUT A;  4Z1S A;  2H0D B;  2CT2 A;  4UYH A;  5EM3 A;  5E9L A;  2CKL B;  3M7K A;  4HXM A;  5CQ7 A;  5FE7 A;  3SVG A;  4Z0R A;  4YAB A;  3NXB A;  2HDP A;  2YSJ A;  5HQ5 A;  5JWM A;  2ECG A;  4YYG A;  5COI A;  1CHC A;  1VD4 A;  3G0J A;  5B77 A;  4I7C A;  5II1 A;  3M99 A;  2JMJ A;  2KKX A;  5CPE A;  5E9K A;  5L8U A;  2IQJ A;  5D3P A;  2GRC A;  1E6I A;  5KTW A;  4NYW A;  5DYA A;  5F1L A;  3JVL A;  2P57 A;  5LKU A;  2MA6 A;  4GNG A;  4UP5 A;  2YT5 A;  1X4U A;  3LVQ E;  2VPG A;  5FG6 A; 
#chains in the Genus database with same CATH homology
 2KGI A;  3N9Q A;  5E73 A;  4PCE A;  3RPG C;  4NRB A;  4O75 A;  5CUD A;  3LJW A;  5I29 A;  5D3J A;  4Q0N A;  5EP7 A;  5CUA A;  5CTL A;  5F3A A;  4NR6 A;  2DAT A;  5I83 A;  3MQM A;  4OUF A;  5CGP A;  4UIV A;  5EWH A;  3AAD A;  5L99 A;  5LVQ A;  3VK6 A;  5AME A;  3UW9 A;  3P1E A;  4LZS A;  4O7B A;  4XY8 A;  5EA1 A;  3SVH A;  2YUR A;  2VJE A;  5EPB A;  5HQ7 A;  5I7X A;  4MR6 A;  5A81 A;  4BW3 A;  2YW5 A;  4Q6F A;  5C8G A;  4QB3 A;  5BT5 A;  4WHW A;  5FE4 A;  4NUC A;  2C2V S;  2K16 A;  4BW2 A;  1WIM A;  2G43 A;  4NQM A;  4O71 A;  5ENH A;  2VJE B;  2EOD A;  2RNX A;  4QUT A;  3MHS A;  5LJ1 A;  4YK0 A;  4CCG X;  2ECW A;  2Y43 A;  2YUC A;  5HJC A;  4QC1 A;  3N9L A;  4GNF A;  4QUU A;  2RSD A;  3MUK A;  3M62 A;  4O77 A;  3HMF A;  1DVP A;  2E7O A;  2I50 A;  4CFL A;  5FE2 A;  2L5E A;  5IBN A;  5I89 A;  5AD3 A;  4TU4 A;  3DQV R;  2E7N A;  4MSX A;  4QEU A;  2YEM A;  4OGJ A;  4A9O A;  3MB4 A;  5F61 A;  4KCX A;  4IR4 A;  5EU1 A;  5ETD A;  3N9N A;  4TQN A;  3UV2 A;  3ONI A;  1IYM A;  5CUB A;  3U5L A;  4O72 A;  3U5K A;  3P1D A;  4A9E A;  5F63 A;  2L75 A;  3U5O A;  5KO4 A;  4V3K C;  5EI4 A;  3ZVY A;  4QNS A;  5F25 A;  5D7X A;  5I88 A;  3GV4 A;  4UI9 B;  4FJC A;  1G25 A;  3O70 A;  2ECN A;  2MIQ A;  2YRE A;  5FFV A;  4Z6H A;  2YW8 A;  2KE1 A;  4MEN A;  5HEM A;  4PPE A;  1WEQ A;  4TTE A;  1WGM A;  1Z60 A;  3T7L A;  5CFW A;  5JG6 A;  4ZW1 A;  3ZYQ A;  4QYL A;  4MR3 A;  3P1F A;  2M6M A;  3MUL A;  2MUM A;  4QF3 A;  3S91 A;  5KTX A;  5LJ2 A;  4LC2 A;  4PCI A;  2VPB A;  2DVR A;  2M1R A;  1T1H A;  4LZR A;  5KTU A;  3L11 A;  3IHP A;  5TDW A;  3QZS A;  5FE0 A;  4S3O C;  5DKD A;  2OUO A;  2RNY A;  5HLS A;  5CQ4 A;  1RMD A;  4QR3 A;  1F68 A;  2XEU A;  2MD8 C;  4GPJ A;  5HEN A;  3UV4 A;  2KWJ A;  4MEP A;  1K2F A;  4AUQ B;  4N4H A;  4X2I A;  1WES A;  5FBX A;  4NR5 A;  4QSQ A;  4AP4 A;  2EGP A;  5EIC A;  4PY6 A;  4NR4 A;  2RFJ A;  3O7A A;  5FE8 A;  2KWK A;  4TT4 A;  5L98 A;  4I7D A;  2CSZ A;  5DFC A;  4QEW A;  4HBW A;  5D3T A;  2OSS A;  3ASL A;  4N4I A;  4NN2 A;  4QY4 A;  5A85 A;  4AKN A;  5A7C A;  4CL9 A;  4A4C A;  5FH7 A;  5ACY A;  2E6S A;  5FFW A;  2XB1 A;  2KIZ A;  2YEK A;  1WEW A;  2CSY A;  2DKW A;  4YC9 A;  5D3H A;  5FEY A;  5F1H A;  5EWC A;  5L97 A;  3EB5 A;  4QSV A;  5F62 A;  4YH4 A;  5HFR A;  3T6R A;  3SOW A;  3LQI A;  4WZ3 B;  5TDR A;  5H1V A;  5KH3 A;  5D0C A;  4UIT A;  5EGU A;  2D82 A;  4R2Y A;  4IOR A;  5LVR A;  1LDJ B;  4YY4 A;  4P5O B;  2LGK A;  4YYI A;  4F52 B;  4HXS A;  4LAD B;  5EYA F;  3O33 A;  5B75 A;  5IGL A;  3O35 A;  3UVD A;  5CQ5 A;  4J1P A;  3PHD A;  4IC2 A;  4GND A;  4UYF A;  4A9F A;  3ZYU A;  5KH7 A;  1X0J A;  5FE3 A;  1E4U A;  2YYN A;  3JVK A;  3FKM X;  4J0S A;  2QIC A;  5C13 A;  2LXP C;  4ZUX U;  4BHW A;  2D9E A;  2L0B A;  5H9M A;  5FB1 A;  5FE6 A;  5I7Y A;  2KWN A;  4TT6 A;  5CRZ A;  4KV4 A;  4UYF B;  3HMH A;  1N72 A;  2I8N A;  5A5S A;  4O7F A;  4NR9 A;  3O36 A;  4YYM A;  1HYI A;  1WEE A;  1JM7 A;  4N4G A;  2YQM A;  2L80 A;  4PS5 A;  4YBT A;  5EPR A;  5G0F A;  1XWH A;  5HRX A;  5C4Q A;  3IU6 A;  4QZS A;  5LKZ A;  5DKH A;  4QR5 A;  4WHU A;  1JM7 B;  4CLB A;  4MR4 A;  2Y1M A;  5A5O A;  2NAA A;  5I86 A;  5EQ1 A;  4IR3 A;  5HRV A;  1FP0 A;  5ENB A;  4FLP A;  2DWW A;  4LYI A;  4QSX A;  4NYV A;  4TZ2 A;  5H1U A;  5I3L A;  4RVR A;  3JVJ A;  5E9V A;  5LKX A;  4QF2 A;  5AIU A;  1WEM A;  4BW4 A;  4LYS A;  4BJX A;  1WIL A;  2PNX A;  5B79 A;  5EV9 A;  4FO9 A;  5D3L A;  5B8D A;  4YY6 A;  2H60 A;  4F3I A;  1WE9 A;  4FIP A;  2WP1 A;  4HBY A;  5CP5 A;  2E3K A;  3L1X A;  5DBM A;  1MM2 A;  1F62 A;  4QC3 A;  3HTK C;  5TBN A;  3SOX A;  3O34 A;  3U5J A;  5DLZ A;  2LDR A;  3ZPV 1;  5F36 A;  2YQL A;  3Q2F A;  4NUD A;  5DX4 A;  4A9L A;  4LZ2 A;  3U5P A;  4QBM A;  2DX8 A;  5EWV A;  2MA5 A;  3Q2E A;  2YDW A;  5D3N A;  3SVF A;  3TLP A;  5CU8 A;  2JMI A;  5D25 A;  2K4D A;  5D1L B;  3LQJ A;  5D1M B;  2VP7 A;  3AQA A;  5HCL A;  4NS5 A;  3MB3 A;  4J0R A;  5DKC A;  5B78 A;  5LKT A;  5TRB A;  2L84 A;  5JI8 A;  5CQ3 A;  4IR6 A;  5IID A;  5DY7 A;  4A9K A;  5I1Q A;  4YBM A;  1WUG A;  2OO1 A;  2ZET C;  5C11 A;  5CQ6 A;  2LGL A;  3LQH A;  2KRE A;  3SOU A;  2ECT A;  5AMF A;  2DVQ A;  4A9M A;  5E9I A;  4OGI A;  3QZV A;  4C66 A;  4CUU A;  5CUC A;  4CUP A;  3G0L A;  2FSA A;  5TB6 A;  2FUU A;  2Y1N A;  4Z1Q A;  2LRI C;  5CUG A;  3IU5 A;  4QR4 A;  5J3X A;  2MNZ A;  5FER A;  5EIS A;  4QSP A;  1HYJ A;  4UYG A;  5FB0 A;  4J3I A;  5TAB A;  4XYA A;  1N87 A;  4O7C A;  5A83 A;  2R0V A;  3D7C A;  3ZTG A;  2MJV B;  4YH3 A;  4IOQ A;  5CZG A;  2RO1 A;  2DVV A;  3HCU A;  3PUR A;  4YYH A;  1X4I A;  5F5Z A;  4N4F A;  1WEO A;  2G4A A;  4TZ8 A;  4Z93 A;  4ZQL A;  4TT2 A;  2LQ6 A;  4QSS A;  3JVM A;  5AIT A;  4PTB A;  4QST A;  3N9O A;  4UIZ A;  4MR5 A;  4IOO A;  3QZT A;  2D8S A;  5CY9 A;  2JMD A;  2LGV A;  4HBV A;  2ECI A;  4L58 A;  4HXR A;  4TS8 A;  4O70 A;  5CQT A;  4UIY A;  2PUY A;  4ZDT A;  4XUA A;  5IGN A;  4GB0 A;  1JSP B;  3V43 A;  3P1C A;  2MT5 A;  4A4B A;  5ENC A;  2BAY A;  2KGG A;  3DAI A;  4NYX A;  5ETB A;  2LN0 A;  5DKA A;  1WEU A;  5I80 A;  3RTR B;  4PKL A;  4QSR A;  5HFQ A;  5DW2 A;  5EK9 A;  2ECV A;  4WZ2 A;  2LXH C;  5DYU A;  5E9Y A;  2LSP B;  1WUM A;  4DON A;  4O64 A;  4YBS A;  3C5K A;  3KV6 A;  5ENE A;  4WZ0 A;  1MM3 A;  2F42 A;  5LCW B;  4HXN A;  5B76 A;  5L8T A;  3L1Z B;  3ZPV E;  4CA1 A;  3HME A;  3UVW A;  5C89 A;  4QSU A;  5KHM A;  1JOC A;  2RS9 B;  1WEV A;  4YYJ A;  5BT4 A;  4CUR A;  3I3J A;  4A9N A;  2MNY A;  3RCW A;  4MVT A;  2E6R A;  5G04 B;  3GL6 A;  4NR8 A;  3N9P A;  2R10 A;  4NRC A;  5F2P A;  5KU3 A;  5C85 A;  4LK9 A;  3DPL R;  3EB6 A;  5C7N A;  4W4U A;  4O7A A;  5HM0 A;  2KU3 A;  4XI1 A;  4L7X A;  2G6Q A;  2VNF A;  1BOR A;  5DFD A;  5KH9 A;  4C67 A;  3LRQ A;  2ECJ A;  4WA6 A;  2R0S A;  3RPG B;  2F6N A;  1V87 A;  5II2 A;  5D26 A;  4A0C D;  5D3R A;  2F6J A;  2UZG A;  3C6W A;  3UVX A;  4X3G A;  3P5O A;  5BT3 A;  1X4J A;  5ENJ A;  5E3D A;  2HYE D;  5E74 A;  3U5M A;  4CFK A;  4Q0O A;  5EVA A;  5G05 B;  4ZC9 A;  5A5Q A;  4TYL A;  1VFY A;  4A9I A;  5H1T A;  5IGM A;  5L96 A;  2LV9 A;  4E96 A;  5G4R A;  5EPS A;  5CS8 A;  5D3S A;  2QJ0 A;  3FL2 A;  4LKA A;  5FE9 A;  5IGK A;  2KWO A;  3S92 A;  2L43 A;  5DLX A;  1FBV A;  5H85 A;  5FDZ A;  5EWW A;  4AYC A;  4O7E A;  5I40 A;  5AD2 A;  4UIX A;  5DW1 A;  5K29 A;  4I7B A;  4LR6 A;  2YHO A;  4NR7 A;  4IC3 A;  4C9Z A;  3O37 A;  2YHN A;  5C87 A;  5DYC A;  1EQF A;  4AVX A;  5FH6 A;  5FH8 A;  4ALH A;  1ZBD B;  4UP0 A;  4CUS A;  4AYC B;  2NXB A;  5F60 A;  2KFT A;  4B7Y C;  5G4S A;  2R0Y A;  5E0R A;  2LGG A;  2YYR A;  1ZS5 A;  3GG3 A;  3MXF A;  3MHH A;  1LDK C;  4LJN A;  4NRA A;  4YYD A;  5FFY A;  3UVY A;  3U5N A;  1WFK A;  2YU4 A;  2OXQ C;  5CQ8 A;  2VJF A;  5FG5 A;  3M63 A;  2EA6 A;  3KNV A;  3K2J A;  4XUB A;  2MD7 B;  2RNW A;  4HXO A;  5E3G A;  2RI7 A;  4XY9 A;  2DVS A;  5D24 A;  1Z6U A;  5ENF A;  5HEL A;  2VJF B;  4YAT A;  4BW1 A;  2VPE A;  4CUQ A;  3PUQ A;  4TKP B;  4MEO A;  4NQN A;  4O78 A;  4YAD A;  4LRG A;  2N9G A;  5DYX A;  3UV5 A;  2KR4 A;  4LDF A;  5CRM A;  4R7E A;  5FG4 A;  2WP2 A;  2C2L A;  2G45 A;  5LJ0 A;  4HBX A;  1VYX A;  2M3H A;  4MEQ A;  3N9M A;  4V3L C;  5FE5 A;  4R8P K;  4NXJ A;  4A9H A;  5FE1 A;  1JM4 B;  2AN6 A;  3HCT A;  3NG2 A;  4BBQ A;  4N3W A;  4QSW A;  5A5N A;  4UIW A;  5HQ6 A;  5CUE A;  4S3O B;  3KQI A;  3DWY A;  5HRW A;  4YAX A;  4UYE A;  5A5R A;  2KTB B;  4ALG A;  2YEL A;  5E9M A;  2IDA A;  2VPD A;  5DIN A;  4QYD A;  5LUU A;  3ZNI A;  2YQD A;  3KV5 A;  5A82 A;  4UIU A;  1Z2Q A;  3I2D A;  4HXP A;  3HCS A;  4LLB A;  4B86 C;  5D1K B;  2M85 A;  1WEP A;  3SHB A;  4A49 A;  4O74 A;  4Z6I A;  5E7D A;  5ENG A;  2K1J A;  5A5P A;  2K17 A;  4HXL A;  4HXK A;  1WEN A;  4YYK A;  2I7K A;  1U6G B;  2KYU A;  2L5U A;  4KV1 A;  4GNE A;  2L85 A;  2QIZ A;  5ENI A;  4O76 A;  4YYN A;  4QEV A;  5TCM A;  4TU6 A;  2JRJ A;  4WIV A;  5EWD A;  4A9J A;  3LXJ A;  4NUE A;  4IR5 A;  2FUI A;  2H0D A;  5IG6 A;  4LYW A;  2CKL A;  5CQA A;  4Y03 A;  5DFB A;  3ZVZ B;  5J0D A;  2YSM A;  4FK5 A;  4UYD A;  4CUT A;  4Z1S A;  2H0D B;  2CT2 A;  4UYH A;  5EM3 A;  5E9L A;  2CKL B;  4HXM A;  5CQ7 A;  5FE7 A;  3SVG A;  4YAB A;  3NXB A;  2HDP A;  2YSJ A;  5HQ5 A;  5JWM A;  2ECG A;  4YYG A;  5COI A;  1CHC A;  1VD4 A;  3G0J A;  5B77 A;  4I7C A;  5II1 A;  3M99 A;  2JMJ A;  5CPE A;  5E9K A;  5L8U A;  5D3P A;  2GRC A;  1E6I A;  5KTW A;  4NYW A;  5DYA A;  5F1L A;  3JVL A;  4GNG A;  5LKU A;  2MA6 A;  4UP5 A;  2YT5 A;  1X4U A;  2VPG A;  5FG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...