5H1VA

Complex structure of trim24 phd-bromodomain and inhibitor 6
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
169
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQESMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 169
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1vA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1vA01
4YYIA 4TS8A 2KTBB 3ONIA 5F63A 3HCSA 2YW5A 2DKWA 3FL2A 4WZ2A 4A4BA 4MR5A 5L99A 2L84A 4WA6A 3U5MA 3P1EA 5HELA 5D1KB 5FE8A 4CA1A 2I8NA 5D24A 4YYGA 2MD7B 2DVRA 1N87A 4HXLA 4O77A 3EB5A 3O36A 4NQMA 2XEUA 3RPGC 4NRBA 2MT5A 3LQIA 4IC3A 5AMEA 5B78A 4A9KA 5FFYA 4UIXA 4HXKA 4Z93A 2E6RA 2PUYA 5IGMA 1WEWA 2K16A 5L97A 5DW2A 2YELA 4MR6A 5G0FA 4MVTA 4A9IA 2D82A 4YBTA 4R8PK 3L11A 5I80A 5BT5A 5DLZA 5H1TA 1WFKA 4N4GA 4QSVA 2ECJA 3EB6A 2KREA 4NYWA 2KE1A 5FG6A 2KFTA 5EICA 2R0YA 1JOCA 4MEPA 4QYDA 4YATA 2L43A 4ALGA 2L5UA 4QF3A 2NXBA 2DVVA 5EM3A 4AKNA 1JM4B 5C13A 2OUOA 2JMIA 5D3JA 2RNYA 5ENFA 5F25A 4FK5A 3GV4A 1EQFA 3O34A 4YK0A 3U5KA 1BORA 3M63A 3UVXA 5CQ5A 5ENGA 2LRIC 4UIWA 2MJVB 5I89A 5KH3A 5AMFA 5I88A 5EWCA 2E3KA 5EU1A 5I29A 5KTXA 5CZGA 5CQTA 5E3GA 3LXJA 5D1LB 4UYHA 4Z6IA 5A83A 4QYLA 5IGLA 5CQ6A 1LDJB 1HYIA 5CQ3A 4CUQA 4ZQLA 5A82A 2YSJA 5L98A 5CQ4A 4IOQA 4HBYA 4TZ8A 2VNFA 5BT4A 3QZSA 5C85A 4IC2A 3P1DA 4N4IA 2G45A 4QEVA 3S92A 2KIZA 5F5ZA 4YAXA 4R2YA 2VJFA 3MB4A 4O74A 5IGNA 2AN6A 1WESA 3QZTA 2MNZA 1WEMA 4KV1A 4IOOA 1V87A 5IIDA 4AP4A 4O71A 5TDWA 4YADA 4O70A 5DKDA 5D7XA 2WP2A 1X4IA 4QSTA 5FG5A 1Z60A 4YYDA 2ECGA 5ENEA 5A5PA 2H0DB 1WEPA 2MUMA 5HENA 4UIZA 4I7DA 5AIUA 1T1HA 3IU5A 4Q0OA 3DAIA 5D3PA 5CP5A 4GNDA 5J3XA 5D25A 4L7XA 4BW2A 5CUEA 5DX4A 4A9NA 4UYFB 5E9VA 1E6IA 4GB0A 3SOUA 4GPJA 2LGVA 2ECIA 3I2DA 1VYXA 4UIUA 3HCTA 5TB6A 3P5OA 3ZVZB 2LGKA 2M3HA 2LSPB 4CUTA 5CQAA 5F3AA 5F1HA 5L96A 3MB3A 2LQ6A 2FUUA 5E74A 4NYXA 5JWMA 2YDWA 5DBMA 4QC1A 5FB1A 5FE9A 5TRBA 5I3LA 5DFDA 3U5OA 2QICA 5EWWA 5DYAA 1WEQA 5IG6A 4A9FA 2YQLA 4AYCB 4QEUA 4LR6A 5F36A 5DYUA 2YURA 4A9MA 3G0LA 4IR3A 5FE0A 5G4RA 4NN2A 4WIVA 3KQIA 2JRJA 4Q6FA 5G05B 4Q0NA 1U6GB 4QF2A 4A4CA 2HYED 4CUSA 4E96A 2K1JA 2MD8C 3O70A 5B77A 2RSDA 4LK9A 5B76A 4S3OB 3VK6A 4PKLA 5C4QA 2LDRA 4UIYA 2ECWA 2KWJA 4WZ3B 1N72A 5CQ7A 5E9IA 2L75A 3T6RA 4NQNA 2M1RA 3HMFA 3N9NA 2LXPC 4NUCA 5E9LA 4N4FA 4LZSA 4BW3A 3QZVA 3GL6A 5FEYA 4TKPB 1G25A 1ZS5A 2R0SA 5LJ2A 2DWWA 5DKCA 5II2A 2F6JA 5HQ5A 4LKAA 2EODA 5KH9A 4YYJA 4QBMA 3U5JA 2KWOA 4O76A 5EWHA 3AQAA 5EP7A 5LUUA 5L8UA 5ENHA 2ECVA 4OUFA 2KR4A 1K2FA 1X0JA 3UVDA 5C7NA 5TDRA 5LJ0A 4BW1A 5FFWA 4TT4A 3RCWA 2YHNA 5B79A 5L8TA 5G04B 5HRXA 4I7BA 5CS8A 4C66A 4W4UA 4B7YC 2KGIA 4O7EA 2JMJA 3UVWA 5CRZA 2YREA 3ZVYA 4A49A 5B75A 1MM2A 4YH3A 4UP0A 4CUPA 4QSXA 2VJEB 4NRAA 4LYWA 2WP1A 4NR7A 5E3DA 3L1XA 2E7NA 2VPGA 3MUKA 5LCWB 4FIPA 1VFYA 4LJNA 3SOXA 4IORA 4PTBA 4UIVA 4UYDA 5KHMA 5CUAA 5CY9A 2C2LA 4QSPA 4CL9A 4CFKA 4FO9A 3UW9A 5EGUA 5E73A 5FDZA 5G4SA 5F60A 2L80A 3UV5A 2MA5A 4PS5A 2G43A 1WGMA 2L85A 2RNXA 4QC3A 5DFCA 5A81A 5LKUA 2ECTA 2QJ0A 3MHSA 3RTRB 5FG4A 4TU4A 5CUDA 4QUUA 3MQMA 2LGGA 5A7CA 3KV6A 4F52B 5E9KA 3HMHA 4QB3A 2R0VA 3S91A 5KO4A 5D1MB 2Y1NA 4Y03A 2OXQC 2YW8A 5FE2A 5E7DA 5H1UA 4P5OB 4LRGA 5DINA 5EPBA 1VD4A 4HXOA 4BBQA 3L1ZB 2FUIA 4HBXA 5HRWA 5K29A 2KWNA 4QNSA 4F3IA 5ENBA 2YHOA 2F6NA 4OGJA 5DFBA 4YYNA 4A9OA 2ECNA 4CFLA 5H9MA 1WEEA 3NG2A 5F62A 1CHCA 2H0DA 4CURA 3DQVR 5A5RA 3JVJA 2KU3A 2DVQA 1WEVA 4LZRA 4QSQA 2M6MA 5H85A 5IBNA 2RI7A 3IHPA 4Z1SA 5LKXA 4CCGX 4QY4A 3LJWA 5AD3A 5D3HA 5FE1A 5CFWA 4UYFA 2G6QA 5EK9A 1FP0A 3PURA 4BW4A 5KTUA 4MR3A 5ETDA 4LADB 1WUMA 2C2VS 3PUQA 2EGPA 4J1PA 5ENJA 5C89A 4PCEA 4R7EA 4TZ2A 5LVRA 4HXNA 4QR5A 5BT3A 5EQ1A 2YUCA 3DPLR 4QSSA 2YQDA 4LC2A 5I7YA 1LDKC 1WEUA 4AYCA 2K4DA 5EPRA 4YBMA 3N9MA 5D3RA 4NRCA 5HCLA 4O7AA 5DKHA 5FB0A 2KWKA 3P1FA 3M99A 5AITA 3O7AA 2RFJA 2I50A 1JM7B 3M62A 3O35A 4QUTA 5LVQA 3SHBA 2E7OA 4V3KC 1RMDA 2L5EA 3V43A 5EISA 4YYMA 4WZ0A 2YEKA 2RNWA 5D3LA 5A85A 1FBVA 4MEQA 4MR4A 5LKTA 4S3OC 4FJCA 4NR6A 4CUUA 1Z2QA 5EVAA 3JVLA 5II1A 3T7LA 3SVGA 2YYRA 4BHWA 5KTWA 2CKLA 4MENA 1X4JA 2LN0A 4NR9A 3ASLA 4O75A 3O33A 2CKLB 5CRMA 5ETBA 4OGIA 4UYGA 4C9ZA 4QSWA 5DYCA 5LJ1A 1WEOA 3Q2EA 4GNEA 5C11A 5FE5A 4XY8A 4X3GA 3ZPV1 1MM3A 5COIA 3PHDA 3LQJA 5EYAF 1WE9A 3ZYQA 3HMEA 4NS5A 5IGKA 5FERA 4TT2A 5EPSA 2KYUA 5A5NA 3MXFA 5D26A 4O64A 3IU6A 5F1LA 2DVSA 3I3JA 2YT5A 2F42A 2Y43A 5EI4A 5CUBA 3U5NA 2OO1A 4B86C 2YU4A 4A9LA 4O7FA 2VJEA 2DATA 4J3IA 2HDPA 4QR4A 5I40A 5FE7A 5HJCA 4MEOA 2YQMA 4L58A 4O78A 3SVHA 1XWHA 4NXJA 3TLPA 3RPGB 5TBNA 3SVFA 5HFQA 5D3TA 3LRQA 1HYJA 3N9OA 2MA6A 4QZSA 5CUGA 3G0JA 4A9HA 5LKZA 4XUAA 4GNGA 4LLBA 5HEMA 4LZ2A 1F68A 1WIMA 5CU8A 2FSAA 3MHHA 5D0CA 3NXBA 4RVRA 5CUCA 4YC9A 4IR6A 4TT6A 3N9PA 3HCUA 4O72A 4UP5A 5FE6A 4PCIA 4X2IA 4YY6A 5DLXA 2VPDA 4LYIA 5EWDA 2EA6A 3JVMA 5EWVA 4LDFA 5ENCA 4A0CD 5JI8A 4ZC9A 3FKMX 4NYVA 3GG3A 5C8GA 4J0SA 2Y1MA 4O7BA 2NAAA 1JSPB 4AVXA 5E9YA 2RO1A 5KU3A 4TYLA 5J0DA 4XYAA 2VP7A 4YYHA 4WHUA 5JG6A 5I86A 4I7CA 3KNVA 4PY6A 5ENIA 5C87A 2R10A 5AD2A 5HRVA 3DWYA 2XB1A 4XY9A 5DW1A 3U5PA 3SOWA 5HQ7A 2QIZA 4A9JA 3MULA 4N4HA 3LQHA 4ZDTA 2H60A 5D3NA 4NR8A 2LXHC 4V3LC 1IYMA 2MNYA 1ZBDB 2DX8A 5I83A 4HXPA 4NUEA 3Q2FA 3U5LA 4HBWA 5FH7A 4IR5A 5A5OA 3ZNIA 1F62A 4HXRA 3D7CA 4NR5A 5A5QA 4QSUA 1X4UA 5EA1A 3ZPVE 5CPEA 4CLBA 5D3SA 4QSRA 2D8SA 5F2PA 2UZGA 4ALHA 1WENA 4NUDA 2YYNA 2M85A 5KH7A 5I1QA 4AUQB 4DONA 4IR4A 2CT2A 4QR3A 4O7CA 2VJFB 4HXMA 2G4AA 4YBSA 2D9EA 4TQNA 1Z6UA 4PPEA 5FE3A 4UI9B 4FLPA 4C67A 4YYKA 4N3WA 4KV4A 4UYEA 4XI1A 2CSYA 5FE4A 3C5KA 4LYSA 5HQ6A 4ZUXU 4YABA 2YSMA 1DVPA 5EV9A 5CGPA 4J0RA 4MSXA 5DYXA 3ZTGA 3UV2A 1JM7A 4UITA 2OSSA 2IDAA 3ZYUA 5CQ8A 2L0BA 4KCXA 4A9EA 1WILA 3N9QA 3HTKC 4XUBA 2LV9A 4NR4A 3UV4A 2GRCA 5CTLA 4Z6HA 5E0RA 3N9LA 4GNFA 4HBVA 4YH4A 2E6SA 2VPBA 3KV5A 5DKAA 4Z1QA 1E4UA 3O37A 4WHWA 5H1VA 5TABA 5E9MA 5FBXA 4YY4A 2KGGA 2ZETC 5FH6A 2MIQA 5B8DA 3AADA 2CSZA 4BJXA 5HLSA 5F61A 5HFRA 5TCMA 1WUGA 5ACYA 5HM0A 5I7XA 2RS9B 4QEWA 2K17A 2VPEA 3JVKA 4TTEA 5FH8A 3P1CA 4ZW1A 3UVYA 5DY7A 2LGLA 2BAYA 5FFVA 2YEMA 2JMDA 3K2JA 3C6WA 5A5SA 4TU6A 2PNXA 2N9GA 4HXSA 2I7KA
chains in the Genus database with same CATH superfamily
4QQ4A 4YYIA 4TS8A 2KTBB 3ONIA 2JUNA 5F63A 3HCSA 3MDBC 2YW5A 2DKWA 3FL2A 4WZ2A 4A4BA 4MR5A 5L99A 2L84A 4WA6A 3U5MA 3P1EA 5HELA 5D1KB 5FE8A 4CA1A 2I8NA 1MBMA 5D24A 4YYGA 2MD7B 2DVRA 1N87A 4HXLA 4O77A 3EB5A 3O36A 4NQMA 2XEUA 3RPGC 4NRBA 2MT5A 3LQIA 4IC3A 5AMEA 5B78A 4A9KA 5FFYA 4UIXA 4HXKA 4Z93A 2E6RA 2PUYA 5IGMA 1WEWA 2K16A 5L97A 5DW2A 2YELA 4MR6A 2MKEA 5G0FA 4MVTA 4A9IA 2D82A 4YBTA 4R8PK 3L11A 5I80A 5BT5A 3T9KA 5DLZA 5H1TA 1WFKA 4N4GA 4QSVA 2ECJA 3EB6A 2IQJA 2KREA 4NYWA 2KE1A 5FG6A 2KFTA 5EICA 2R0YA 1JOCA 4MEPA 4QYDA 4YATA 2L43A 4ALGA 3VKHA 2L5UA 3DWDA 4QF3A 2NXBA 2DVVA 5EM3A 4AKNA 1JM4B 5C13A 2OUOA 3JUEA 2EJNA 2JMIA 5D3JA 2RNYA 5ENFA 5F25A 2JM3A 4FK5A 3GV4A 1EQFA 3O34A 4YK0A 3U5KA 2M13A 1BORA 3M63A 3UVXA 2YVRA 5CQ5A 5ENGA 2LRIC 4UIWA 2MJVB 5I89A 5KH3A 5AMFA 5I88A 5EWCA 2E3KA 5EU1A 5I29A 5KTXA 5CZGA 5CQTA 5E3GA 3FEHA 3LXJA 5D1LB 4UYHA 4Z6IA 5A83A 2KKYA 4QYLA 5IGLA 5CQ6A 1LDJB 1HYIA 5CQ3A 4CUQA 4ZQLA 5A82A 2YSJA 5L98A 5CQ4A 4IOQA 4HBYA 4TZ8A 2VNFA 5BT4A 3QZSA 5C85A 4IC2A 3P1DA 4N4IA 2G45A 4QEVA 3S92A 2KIZA 5F5ZA 4YAXA 4R2YA 2VJFA 3MB4A 4O74A 5IGNA 2AN6A 1WESA 3QZTA 2MNZA 1WEMA 4KV1A 4IOOA 1V87A 5IIDA 4AP4A 4O71A 5TDWA 4YADA 4O70A 5DKDA 5D7XA 2WP2A 1X4IA 4QSTA 5FG5A 1Z60A 4YYDA 2ECGA 5ENEA 5A5PA 2H0DB 1WEPA 2MUMA 1PUOA 5HENA 4UIZA 3LJUX 4I7DA 5AIUA 2CONA 1T1HA 3IU5A 4Q0OA 3DAIA 5D3PA 5CP5A 4GNDA 5J3XA 5D25A 4L7XA 2P57A 4BW2A 5CUEA 5DX4A 4A9NA 2FFWA 4UYFB 5E9VA 1E6IA 4GB0A 3SOUA 4GPJA 2LGVA 2ECIA 3I2DA 1VYXA 4UIUA 3HCTA 5TB6A 3P5OA 2CSVA 2LGKA 2M3HA 3ZVZB 2LSPB 2LAUA 4CUTA 5CQAA 5F3AA 5F1HA 5L96A 3MB3A 2E61A 2LQ6A 2XOCA 2FUUA 5E74A 4NYXA 5JWMA 2YDWA 5DBMA 4QC1A 5FB1A 5FE9A 5TRBA 5I3LA 5DFDA 3U5OA 2QICA 3D1BA 5EWWA 5DYAA 1WEQA 5IG6A 4A9FA 2YQLA 4AYCB 4QEUA 4LR6A 5F36A 5DYUA 2YURA 4A9MA 3G0LA 4IR3A 5FE0A 5G4RA 4NN2A 4WIVA 3KQIA 2JRJA 4Q6FA 5G05B 4Q0NA 1U6GB 4QF2A 3DDTA 4A4CA 2HYED 4CUSA 4E96A 2K1JA 2MD8C 3O70A 5B77A 2RSDA 4LK9A 5B76A 4S3OB 3VK6A 4PKLA 5C4QA 2LDRA 4UIYA 2ECWA 2KWJA 4AI6A 4WZ3B 1N72A 5CQ7A 5E9IA 2L75A 3T6RA 4NQNA 2M1RA 3HMFA 3N9NA 2LXPC 4NUCA 5E9LA 4N4FA 4LZSA 4BW3A 3QZVA 3GL6A 5FEYA 4TKPB 1G25A 1ZS5A 2R0SA 5LJ2A 2DWWA 5DKCA 5II2A 2F6JA 5HQ5A 3PLWA 2EODA 4LKAA 5KH9A 4YYJA 4QBMA 3U5JA 2KWOA 4O76A 5EWHA 3AQAA 5EP7A 5LUUA 5L8UA 5ENHA 2ECVA 3Q1DA 4OUFA 2KR4A 2FD4A 1K2FA 1X0JA 3UVDA 5C7NA 2VJEB 5TDRA 5LJ0A 4BW1A 5FFWA 4TT4A 5K3QA 3RCWA 2YHNA 5B79A 5L8TA 5G04B 5HRXA 4I7BA 5CS8A 4C66A 4W4UA 4B7YC 2KGIA 4O7EA 2JMJA 3UVWA 5CRZA 2YREA 3ZVYA 4A49A 5B75A 1MM2A 4YH3A 4UP0A 4CUPA 4QSXA 2CRWA 4NRAA 4LYWA 2WP1A 4NR7A 5E3DA 2DJAA 2E7NA 2VPGA 3MUKA 5LCWB 4AKHA 4FIPA 1VFYA 4LJNA 3SOXA 4IORA 4AKGA 1DCQA 4PTBA 4UIVA 4UYDA 5KHMA 5CUAA 5CY9A 2C2LA 4QSPA 4CL9A 4CFKA 4FO9A 3UW9A 5EGUA 5E73A 5FDZA 5G4SA 5F60A 2L80A 3LDYA 3UV5A 2MA5A 4PS5A 2G43A 4O62A 1WGMA 2L85A 2RNXA 4QC3A 5DFCA 5A81A 5LKUA 2ECTA 2QJ0A 3MHSA 2L7PA 3RTRB 5FG4A 2RR4A 4TU4A 1ZKRA 5CUDA 4QUUA 3O47A 3MQMA 2LGGA 5A7CA 3KV6A 4F52B 5E9KA 3HMHA 4QB3A 2R0VA 2XOYA 3S91A 5KO4A 5D1MB 2Y1NA 3KDEC 4Y03A 2OXQC 2YW8A 5FE2A 5E7DA 5H1UA 4P5OB 4LRGA 5DINA 5EPBA 1VD4A 4HXOA 4BBQA 3L1ZB 2FUIA 4HBXA 5HRWA 5K29A 2KWNA 4QNSA 4F3IA 5ENBA 2YHOA 2F6NA 4OGJA 5DFBA 4YYNA 4A9OA 2ECNA 4CFLA 5H9MA 1WEEA 3NG2A 5F62A 1CHCA 2H0DA 4CURA 3DQVR 3H7HA 5A5RA 3JVJA 2KU3A 2DVQA 1WEVA 4LZRA 4QSQA 2M6MA 5H85A 5IBNA 2RI7A 3IHPA 4Z1SA 5LKXA 4CCGX 4QY4A 3LJWA 5AD3A 5D3HA 5FE1A 4OGEA 5CFWA 4UYFA 2G6QA 2CRRA 5EK9A 1FP0A 3PURA 4BW4A 2D8UA 5KTUA 3L1XA 4MR3A 5ETDA 4LADB 5SVIB 1WUMA 2C2VS 3FANA 3PUQA 2EGPA 4J1PA 5ENJA 5C89A 4PCEA 4R7EA 4TZ2A 5LVRA 4HXNA 4QR5A 5BT3A 5EQ1A 2YUCA 3DPLR 4QSSA 3VKGA 2YQDA 4LC2A 5I7YA 1LDKC 1WEUA 4AYCA 2K4DA 5EPRA 4YBMA 2XP0A 3N9MA 5D3RA 4NRCA 5HCLA 4O7AA 5DKHA 2KKXA 5FB0A 2KWKA 3P1FA 3M99A 5AITA 3FAOA 3O7AA 2RFJA 2I50A 1JM7B 3M62A 3O35A 4QUTA 5LVQA 3SHBA 2E7OA 4V3KC 1RMDA 2L5EA 3V43A 5EISA 4YYMA 4WZ0A 2YEKA 2RNWA 5D3LA 5A85A 1FBVA 4MEQA 4MR4A 5LKTA 4S3OC 4FJCA 4NR6A 4CUUA 1Z2QA 5EVAA 3JVLA 5II1A 3T7LA 3SVGA 2YYRA 4BHWA 5KTWA 2CKLA 4MENA 1X4JA 2LN0A 4NR9A 3ASLA 4O75A 3O33A 2CKLB 5CRMA 5ETBA 4OGIA 4UYGA 4C9ZA 4QSWA 5DYCA 5LJ1A 4OGCA 1WEOA 3Q2EA 4GNEA 5C11A 5FE5A 4XY8A 4X3GA 3ZPV1 1MM3A 5COIA 3PHDA 3LQJA 5EYAF 1WE9A 3ZYQA 3HMEA 4NS5A 5IGKA 5FERA 4TT2A 2OWAA 5EPSA 2KYUA 5A5NA 3MXFA 5D26A 4O64A 3IU6A 5F1LA 2DVSA 3I3JA 2YT5A 2F42A 2Y43A 5EI4A 5CUBA 3U5NA 2OO1A 4B86C 2YU4A 4A9LA 4O7FA 2VJEA 2DATA 4J3IA 2HDPA 4QR4A 5I40A 5FE7A 5HJCA 4MEOA 2YQMA 3FJUB 4L58A 4AKIA 4O78A 3SVHA 1XWHA 4NXJA 3TLPA 3RPGB 5TBNA 3SVFA 5HFQA 5D3TA 3LRQA 1HYJA 3N9OA 2MA6A 4QZSA 5CUGA 3G0JA 4A9HA 5LKZA 4XUAA 4GNGA 4LLBA 5HEMA 4LZ2A 4Z0RA 1F68A 1WIMA 5CU8A 2FSAA 3E2DA 3LVQE 3MHHA 5D0CA 3NXBA 4RVRA 5CUCA 4YC9A 4IR6A 4TT6A 3N9PA 3HCUA 4O72A 4UP5A 5FE6A 4PCIA 4X2IA 4YY6A 4F1PA 5DLXA 2VPDA 4LYIA 5EWDA 2EA6A 3JVMA 5EWVA 4LDFA 5ENCA 4A0CD 5JI8A 4ZC9A 2B0OE 3FKMX 4NYVA 3D1DA 3GG3A 5C8GA 4J0SA 2Y1MA 4O7BA 4Z0OA 2NAAA 1JSPB 4AVXA 5E9YA 2RO1A 5KU3A 5SVXA 4TYLA 2EXUA 5J0DA 4XYAA 3LVRE 2VP7A 4YYHA 4WHUA 5JG6A 5I86A 4I7CA 3KNVA 4PY6A 5ENIA 5C87A 2R10A 5AD2A 5HRVA 3DWYA 2XB1A 4XY9A 5DW1A 3U5PA 2XOZA 3SOWA 5HQ7A 2QIZA 4A9JA 3MULA 4N4HA 3LQHA 4ZDTA 2H60A 5D3NA 4NR8A 2LXHC 4V3LC 1IYMA 2MNYA 1ZBDB 2DX8A 5I83A 4HXPA 4NUEA 3Q2FA 3U5LA 4HBWA 5FH7A 4IR5A 5A5OA 3ZNIA 2EGMA 1F62A 4HXRA 3D7CA 4NR5A 5A5QA 4QSUA 1X4UA 5EA1A 3ZPVE 5CPEA 4CLBA 5D3SA 4QSRA 2D8SA 3FM8C 5F2PA 2UZGA 4ALHA 1WENA 4NUDA 2YYNA 2M85A 5KH7A 5I1QA 4AUQB 4DONA 4IR4A 2CT2A 4QR3A 4O7CA 2VJFB 4HXMA 5SVIA 2G4AA 4YBSA 2D9EA 4TQNA 1Z6UA 4PPEA 3SUBA 5FE3A 4UI9B 4FLPA 4C67A 4YYKA 4N3WA 4KV4A 4UYEA 4XI1A 2CSYA 5FE4A 3C5KA 4LYSA 5HQ6A 4ZUXU 4YABA 2YSMA 1DVPA 5EV9A 5CGPA 4J0RA 2DSMA 4MSXA 5DYXA 3ZTGA 3UV2A 1JM7A 4UITA 2OSSA 2IDAA 3ZYUA 5CQ8A 2L0BA 4KCXA 4A9EA 3ERRA 1WILA 3HTKC 4XUBA 2LV9A 4NR4A 3UV4A 3N9QA 2GRCA 5CTLA 4Z6HA 5E0RA 4H9DA 3N9LA 4GNFA 4HBVA 4YH4A 2E6SA 2VPBA 3KV5A 5DKAA 4Z1QA 1E4UA 3O37A 4WHWA 5H1VA 5TABA 5E9MA 5FBXA 4YY4A 2KGGA 2ZETC 5FH6A 2MIQA 5B8DA 3AADA 2CSZA 4BJXA 5HLSA 5F61A 5HFRA 5TCMA 1WUGA 5ACYA 5SVYA 5HM0A 5I7XA 2RS9B 4QEWA 2K17A 2VPEA 3JVKA 4TTEA 5FH8A 3P1CA 4ZW1A 3UVYA 5DY7A 2LGLA 3M7KA 2BAYA 5FFVA 2YEMA 2JMDA 3K2JA 3C6WA 5A5SA 4TU6A 2PNXA 2N9GA 4HXSA 2I7KA
chains in the Genus database with same CATH topology
4YYIA 4TS8A 2KTBB 3ONIA 5F63A 3HCSA 2YW5A 2DKWA 3FL2A 4WZ2A 4A4BA 4MR5A 5L99A 2L84A 4WA6A 3U5MA 3P1EA 5HELA 5D1KB 5FE8A 4CA1A 2I8NA 5D24A 4YYGA 2MD7B 2DVRA 1N87A 4HXLA 4O77A 3EB5A 3O36A 4NQMA 2XEUA 3RPGC 4NRBA 2MT5A 3LQIA 4IC3A 5AMEA 5B78A 4A9KA 5FFYA 4UIXA 4HXKA 4Z93A 2E6RA 2PUYA 5IGMA 1WEWA 2K16A 5L97A 5DW2A 2YELA 4MR6A 5G0FA 4MVTA 4A9IA 2D82A 4YBTA 4R8PK 3L11A 5I80A 5BT5A 5DLZA 5H1TA 1WFKA 4N4GA 4QSVA 2ECJA 3EB6A 2KREA 4NYWA 2KE1A 5FG6A 2KFTA 5EICA 2R0YA 1JOCA 4MEPA 4QYDA 4YATA 2L43A 4ALGA 2L5UA 4QF3A 2NXBA 2DVVA 5EM3A 4AKNA 1JM4B 5C13A 2OUOA 2JMIA 5D3JA 2RNYA 5ENFA 5F25A 4FK5A 3GV4A 1EQFA 3O34A 4YK0A 3U5KA 1BORA 3M63A 3UVXA 5CQ5A 5ENGA 2LRIC 4UIWA 2MJVB 5I89A 5KH3A 5AMFA 5I88A 5EWCA 2E3KA 5EU1A 5I29A 5KTXA 5CZGA 5CQTA 5E3GA 3LXJA 5D1LB 4UYHA 4Z6IA 5A83A 4QYLA 5IGLA 5CQ6A 1LDJB 1HYIA 5CQ3A 4CUQA 4ZQLA 5A82A 2YSJA 5L98A 5CQ4A 4IOQA 4HBYA 4TZ8A 2VNFA 5BT4A 3QZSA 5C85A 4IC2A 3P1DA 4N4IA 2G45A 4QEVA 3S92A 2KIZA 5F5ZA 4YAXA 4R2YA 2VJFA 3MB4A 4O74A 5IGNA 2AN6A 1WESA 3QZTA 2MNZA 1WEMA 4KV1A 4IOOA 1V87A 5IIDA 4AP4A 4O71A 5TDWA 4YADA 4O70A 5DKDA 5D7XA 2WP2A 1X4IA 4QSTA 5FG5A 1Z60A 4YYDA 2ECGA 5ENEA 5A5PA 2H0DB 1WEPA 2MUMA 5HENA 4UIZA 4I7DA 5AIUA 1T1HA 3IU5A 4Q0OA 3DAIA 5D3PA 5CP5A 4GNDA 5J3XA 5D25A 4L7XA 4BW2A 5CUEA 5DX4A 4A9NA 4UYFB 5E9VA 1E6IA 4GB0A 3SOUA 4GPJA 2LGVA 2ECIA 3I2DA 1VYXA 4UIUA 3HCTA 5TB6A 3P5OA 3ZVZB 2LGKA 2M3HA 2LSPB 4CUTA 5CQAA 5F3AA 5F1HA 5L96A 3MB3A 2LQ6A 2FUUA 5E74A 4NYXA 5JWMA 2YDWA 5DBMA 4QC1A 5FB1A 5FE9A 5TRBA 5I3LA 5DFDA 3U5OA 2QICA 5EWWA 5DYAA 1WEQA 5IG6A 4A9FA 2YQLA 4AYCB 4QEUA 4LR6A 5F36A 5DYUA 2YURA 4A9MA 3G0LA 4IR3A 5FE0A 5G4RA 4NN2A 4WIVA 3KQIA 2JRJA 4Q6FA 5G05B 4Q0NA 1U6GB 4QF2A 4A4CA 2HYED 4CUSA 4E96A 2K1JA 2MD8C 3O70A 5B77A 2RSDA 4LK9A 5B76A 4S3OB 3VK6A 4PKLA 5C4QA 2LDRA 4UIYA 2ECWA 2KWJA 4WZ3B 1N72A 5CQ7A 5E9IA 2L75A 3T6RA 4NQNA 2M1RA 3HMFA 3N9NA 2LXPC 4NUCA 5E9LA 4N4FA 4LZSA 4BW3A 3QZVA 3GL6A 5FEYA 4TKPB 1G25A 1ZS5A 2R0SA 5LJ2A 2DWWA 5DKCA 5II2A 2F6JA 5HQ5A 4LKAA 2EODA 5KH9A 4YYJA 4QBMA 3U5JA 2KWOA 4O76A 5EWHA 3AQAA 5EP7A 5LUUA 5L8UA 5ENHA 2ECVA 4OUFA 2KR4A 1K2FA 1X0JA 3UVDA 5C7NA 5TDRA 5LJ0A 4BW1A 5FFWA 4TT4A 3RCWA 2YHNA 5B79A 5L8TA 5G04B 5HRXA 4I7BA 5CS8A 4C66A 4W4UA 4B7YC 2KGIA 4O7EA 2JMJA 3UVWA 5CRZA 2YREA 3ZVYA 4A49A 5B75A 1MM2A 4YH3A 4UP0A 4CUPA 4QSXA 2VJEB 4NRAA 4LYWA 2WP1A 4NR7A 5E3DA 3L1XA 2E7NA 2VPGA 3MUKA 5LCWB 4FIPA 1VFYA 4LJNA 3SOXA 4IORA 4PTBA 4UIVA 4UYDA 5KHMA 5CUAA 5CY9A 2C2LA 4QSPA 4CL9A 4CFKA 4FO9A 3UW9A 5EGUA 5E73A 5FDZA 5G4SA 5F60A 2L80A 3UV5A 2MA5A 4PS5A 2G43A 1WGMA 2L85A 2RNXA 4QC3A 5DFCA 5A81A 5LKUA 2ECTA 2QJ0A 3MHSA 3RTRB 5FG4A 4TU4A 5CUDA 4QUUA 3MQMA 2LGGA 5A7CA 3KV6A 4F52B 5E9KA 3HMHA 4QB3A 2R0VA 3S91A 5KO4A 5D1MB 2Y1NA 4Y03A 2OXQC 2YW8A 5FE2A 5E7DA 5H1UA 4P5OB 4LRGA 5DINA 5EPBA 1VD4A 4HXOA 4BBQA 3L1ZB 2FUIA 4HBXA 5HRWA 5K29A 2KWNA 4QNSA 4F3IA 5ENBA 2YHOA 2F6NA 4OGJA 5DFBA 4YYNA 4A9OA 2ECNA 4CFLA 5H9MA 1WEEA 3NG2A 5F62A 1CHCA 2H0DA 4CURA 3DQVR 5A5RA 3JVJA 2KU3A 2DVQA 1WEVA 4LZRA 4QSQA 2M6MA 5H85A 5IBNA 2RI7A 3IHPA 4Z1SA 5LKXA 4CCGX 4QY4A 3LJWA 5AD3A 5D3HA 5FE1A 5CFWA 4UYFA 2G6QA 5EK9A 1FP0A 3PURA 4BW4A 5KTUA 4MR3A 5ETDA 4LADB 1WUMA 2C2VS 3PUQA 2EGPA 4J1PA 5ENJA 5C89A 4PCEA 4R7EA 4TZ2A 5LVRA 4HXNA 4QR5A 5BT3A 5EQ1A 2YUCA 3DPLR 4QSSA 2YQDA 4LC2A 5I7YA 1LDKC 1WEUA 4AYCA 2K4DA 5EPRA 4YBMA 3N9MA 5D3RA 4NRCA 5HCLA 4O7AA 5DKHA 5FB0A 2KWKA 3P1FA 3M99A 5AITA 3O7AA 2RFJA 2I50A 1JM7B 3M62A 3O35A 4QUTA 5LVQA 3SHBA 2E7OA 4V3KC 1RMDA 2L5EA 3V43A 5EISA 4YYMA 4WZ0A 2YEKA 2RNWA 5D3LA 5A85A 1FBVA 4MEQA 4MR4A 5LKTA 4S3OC 4FJCA 4NR6A 4CUUA 1Z2QA 5EVAA 3JVLA 5II1A 3T7LA 3SVGA 2YYRA 4BHWA 5KTWA 2CKLA 4MENA 1X4JA 2LN0A 4NR9A 3ASLA 4O75A 3O33A 2CKLB 5CRMA 5ETBA 4OGIA 4UYGA 4C9ZA 4QSWA 5DYCA 5LJ1A 1WEOA 3Q2EA 4GNEA 5C11A 5FE5A 4XY8A 4X3GA 3ZPV1 1MM3A 5COIA 3PHDA 3LQJA 5EYAF 1WE9A 3ZYQA 3HMEA 4NS5A 5IGKA 5FERA 4TT2A 5EPSA 2KYUA 5A5NA 3MXFA 5D26A 4O64A 3IU6A 5F1LA 2DVSA 3I3JA 2YT5A 2F42A 2Y43A 5EI4A 5CUBA 3U5NA 2OO1A 4B86C 2YU4A 4A9LA 4O7FA 2VJEA 2DATA 4J3IA 2HDPA 4QR4A 5I40A 5FE7A 5HJCA 4MEOA 2YQMA 4L58A 4O78A 3SVHA 1XWHA 4NXJA 3TLPA 3RPGB 5TBNA 3SVFA 5HFQA 5D3TA 3LRQA 1HYJA 3N9OA 2MA6A 4QZSA 5CUGA 3G0JA 4A9HA 5LKZA 4XUAA 4GNGA 4LLBA 5HEMA 4LZ2A 1F68A 1WIMA 5CU8A 2FSAA 3MHHA 5D0CA 3NXBA 4RVRA 5CUCA 4YC9A 4IR6A 4TT6A 3N9PA 3HCUA 4O72A 4UP5A 5FE6A 4PCIA 4X2IA 4YY6A 5DLXA 2VPDA 4LYIA 5EWDA 2EA6A 3JVMA 5EWVA 4LDFA 5ENCA 4A0CD 5JI8A 4ZC9A 3FKMX 4NYVA 3GG3A 5C8GA 4J0SA 2Y1MA 4O7BA 2NAAA 1JSPB 4AVXA 5E9YA 2RO1A 5KU3A 4TYLA 5J0DA 4XYAA 2VP7A 4YYHA 4WHUA 5JG6A 5I86A 4I7CA 3KNVA 4PY6A 5ENIA 5C87A 2R10A 5AD2A 5HRVA 3DWYA 2XB1A 4XY9A 5DW1A 3U5PA 3SOWA 5HQ7A 2QIZA 4A9JA 3MULA 4N4HA 3LQHA 4ZDTA 2H60A 5D3NA 4NR8A 2LXHC 4V3LC 1IYMA 2MNYA 1ZBDB 2DX8A 5I83A 4HXPA 4NUEA 3Q2FA 3U5LA 4HBWA 5FH7A 4IR5A 5A5OA 3ZNIA 1F62A 4HXRA 3D7CA 4NR5A 5A5QA 4QSUA 1X4UA 5EA1A 3ZPVE 5CPEA 4CLBA 5D3SA 4QSRA 2D8SA 5F2PA 2UZGA 4ALHA 1WENA 4NUDA 2YYNA 2M85A 5KH7A 5I1QA 4AUQB 4DONA 4IR4A 2CT2A 4QR3A 4O7CA 2VJFB 4HXMA 2G4AA 4YBSA 2D9EA 4TQNA 1Z6UA 4PPEA 5FE3A 4UI9B 4FLPA 4C67A 4YYKA 4N3WA 4KV4A 4UYEA 4XI1A 2CSYA 5FE4A 3C5KA 4LYSA 5HQ6A 4ZUXU 4YABA 2YSMA 1DVPA 5EV9A 5CGPA 4J0RA 4MSXA 5DYXA 3ZTGA 3UV2A 1JM7A 4UITA 2OSSA 2IDAA 3ZYUA 5CQ8A 2L0BA 4KCXA 4A9EA 1WILA 3N9QA 3HTKC 4XUBA 2LV9A 4NR4A 3UV4A 2GRCA 5CTLA 4Z6HA 5E0RA 3N9LA 4GNFA 4HBVA 4YH4A 2E6SA 2VPBA 3KV5A 5DKAA 4Z1QA 1E4UA 3O37A 4WHWA 5H1VA 5TABA 5E9MA 5FBXA 4YY4A 2KGGA 2ZETC 5FH6A 2MIQA 5B8DA 3AADA 2CSZA 4BJXA 5HLSA 5F61A 5HFRA 5TCMA 1WUGA 5ACYA 5HM0A 5I7XA 2RS9B 4QEWA 2K17A 2VPEA 3JVKA 4TTEA 5FH8A 3P1CA 4ZW1A 3UVYA 5DY7A 2LGLA 2BAYA 5FFVA 2YEMA 2JMDA 3K2JA 3C6WA 5A5SA 4TU6A 2PNXA 2N9GA 4HXSA 2I7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYI A;  4TS8 A;  2KTB B;  3ONI A;  5F63 A;  3HCS A;  2YW5 A;  2DKW A;  3FL2 A;  4WZ2 A;  4A4B A;  4MR5 A;  5L99 A;  2L84 A;  4WA6 A;  3U5M A;  3P1E A;  5HEL A;  5D1K B;  5FE8 A;  4CA1 A;  2I8N A;  5D24 A;  4YYG A;  2MD7 B;  2DVR A;  1N87 A;  4HXL A;  4O77 A;  3EB5 A;  3O36 A;  4NQM A;  2XEU A;  3RPG C;  4NRB A;  2MT5 A;  3LQI A;  4IC3 A;  5AME A;  5B78 A;  4A9K A;  5FFY A;  4UIX A;  4HXK A;  4Z93 A;  2E6R A;  2PUY A;  5IGM A;  1WEW A;  2K16 A;  5L97 A;  5DW2 A;  2YEL A;  4MR6 A;  5G0F A;  4MVT A;  4A9I A;  2D82 A;  4YBT A;  4R8P K;  3L11 A;  5I80 A;  5BT5 A;  5DLZ A;  5H1T A;  1WFK A;  4N4G A;  4QSV A;  2ECJ A;  3EB6 A;  2KRE A;  4NYW A;  2KE1 A;  5FG6 A;  2KFT A;  5EIC A;  2R0Y A;  1JOC A;  4MEP A;  4QYD A;  4YAT A;  2L43 A;  4ALG A;  2L5U A;  4QF3 A;  2NXB A;  2DVV A;  5EM3 A;  4AKN A;  1JM4 B;  5C13 A;  2OUO A;  2JMI A;  5D3J A;  2RNY A;  5ENF A;  5F25 A;  4FK5 A;  3GV4 A;  1EQF A;  3O34 A;  4YK0 A;  3U5K A;  1BOR A;  3M63 A;  3UVX A;  5CQ5 A;  5ENG A;  2LRI C;  4UIW A;  2MJV B;  5I89 A;  5KH3 A;  5AMF A;  5I88 A;  5EWC A;  2E3K A;  5EU1 A;  5I29 A;  5KTX A;  5CZG A;  5CQT A;  5E3G A;  3LXJ A;  5D1L B;  4UYH A;  4Z6I A;  5A83 A;  4QYL A;  5IGL A;  5CQ6 A;  1LDJ B;  1HYI A;  5CQ3 A;  4CUQ A;  4ZQL A;  5A82 A;  2YSJ A;  5L98 A;  5CQ4 A;  4IOQ A;  4HBY A;  4TZ8 A;  2VNF A;  5BT4 A;  3QZS A;  5C85 A;  4IC2 A;  3P1D A;  4N4I A;  2G45 A;  4QEV A;  3S92 A;  2KIZ A;  5F5Z A;  4YAX A;  4R2Y A;  2VJF A;  3MB4 A;  4O74 A;  5IGN A;  2AN6 A;  1WES A;  3QZT A;  2MNZ A;  1WEM A;  4KV1 A;  4IOO A;  1V87 A;  5IID A;  4AP4 A;  4O71 A;  5TDW A;  4YAD A;  4O70 A;  5DKD A;  5D7X A;  2WP2 A;  1X4I A;  4QST A;  5FG5 A;  1Z60 A;  4YYD A;  2ECG A;  5ENE A;  5A5P A;  2H0D B;  1WEP A;  2MUM A;  5HEN A;  4UIZ A;  4I7D A;  5AIU A;  1T1H A;  3IU5 A;  4Q0O A;  3DAI A;  5D3P A;  5CP5 A;  4GND A;  5J3X A;  5D25 A;  4L7X A;  4BW2 A;  5CUE A;  5DX4 A;  4A9N A;  4UYF B;  5E9V A;  1E6I A;  4GB0 A;  3SOU A;  4GPJ A;  2LGV A;  2ECI A;  3I2D A;  1VYX A;  4UIU A;  3HCT A;  5TB6 A;  3P5O A;  3ZVZ B;  2LGK A;  2M3H A;  2LSP B;  4CUT A;  5CQA A;  5F3A A;  5F1H A;  5L96 A;  3MB3 A;  2LQ6 A;  2FUU A;  5E74 A;  4NYX A;  5JWM A;  2YDW A;  5DBM A;  4QC1 A;  5FB1 A;  5FE9 A;  5TRB A;  5I3L A;  5DFD A;  3U5O A;  2QIC A;  5EWW A;  5DYA A;  1WEQ A;  5IG6 A;  4A9F A;  2YQL A;  4AYC B;  4QEU A;  4LR6 A;  5F36 A;  5DYU A;  2YUR A;  4A9M A;  3G0L A;  4IR3 A;  5FE0 A;  5G4R A;  4NN2 A;  4WIV A;  3KQI A;  2JRJ A;  4Q6F A;  5G05 B;  4Q0N A;  1U6G B;  4QF2 A;  4A4C A;  2HYE D;  4CUS A;  4E96 A;  2K1J A;  2MD8 C;  3O70 A;  5B77 A;  2RSD A;  4LK9 A;  5B76 A;  4S3O B;  3VK6 A;  4PKL A;  5C4Q A;  2LDR A;  4UIY A;  2ECW A;  2KWJ A;  4WZ3 B;  1N72 A;  5CQ7 A;  5E9I A;  2L75 A;  3T6R A;  4NQN A;  2M1R A;  3HMF A;  3N9N A;  2LXP C;  4NUC A;  5E9L A;  4N4F A;  4LZS A;  4BW3 A;  3QZV A;  3GL6 A;  5FEY A;  4TKP B;  1G25 A;  1ZS5 A;  2R0S A;  5LJ2 A;  2DWW A;  5DKC A;  5II2 A;  2F6J A;  5HQ5 A;  4LKA A;  2EOD A;  5KH9 A;  4YYJ A;  4QBM A;  3U5J A;  2KWO A;  4O76 A;  5EWH A;  3AQA A;  5EP7 A;  5LUU A;  5L8U A;  5ENH A;  2ECV A;  4OUF A;  2KR4 A;  1K2F A;  1X0J A;  3UVD A;  5C7N A;  5TDR A;  5LJ0 A;  4BW1 A;  5FFW A;  4TT4 A;  3RCW A;  2YHN A;  5B79 A;  5L8T A;  5G04 B;  5HRX A;  4I7B A;  5CS8 A;  4C66 A;  4W4U A;  4B7Y C;  2KGI A;  4O7E A;  2JMJ A;  3UVW A;  5CRZ A;  2YRE A;  3ZVY A;  4A49 A;  5B75 A;  1MM2 A;  4YH3 A;  4UP0 A;  4CUP A;  4QSX A;  2VJE B;  4NRA A;  4LYW A;  2WP1 A;  4NR7 A;  5E3D A;  3L1X A;  2E7N A;  2VPG A;  3MUK A;  5LCW B;  4FIP A;  1VFY A;  4LJN A;  3SOX A;  4IOR A;  4PTB A;  4UIV A;  4UYD A;  5KHM A;  5CUA A;  5CY9 A;  2C2L A;  4QSP A;  4CL9 A;  4CFK A;  4FO9 A;  3UW9 A;  5EGU A;  5E73 A;  5FDZ A;  5G4S A;  5F60 A;  2L80 A;  3UV5 A;  2MA5 A;  4PS5 A;  2G43 A;  1WGM A;  2L85 A;  2RNX A;  4QC3 A;  5DFC A;  5A81 A;  5LKU A;  2ECT A;  2QJ0 A;  3MHS A;  3RTR B;  5FG4 A;  4TU4 A;  5CUD A;  4QUU A;  3MQM A;  2LGG A;  5A7C A;  3KV6 A;  4F52 B;  5E9K A;  3HMH A;  4QB3 A;  2R0V A;  3S91 A;  5KO4 A;  5D1M B;  2Y1N A;  4Y03 A;  2OXQ C;  2YW8 A;  5FE2 A;  5E7D A;  5H1U A;  4P5O B;  4LRG A;  5DIN A;  5EPB A;  1VD4 A;  4HXO A;  4BBQ A;  3L1Z B;  2FUI A;  4HBX A;  5HRW A;  5K29 A;  2KWN A;  4QNS A;  4F3I A;  5ENB A;  2YHO A;  2F6N A;  4OGJ A;  5DFB A;  4YYN A;  4A9O A;  2ECN A;  4CFL A;  5H9M A;  1WEE A;  3NG2 A;  5F62 A;  1CHC A;  2H0D A;  4CUR A;  3DQV R;  5A5R A;  3JVJ A;  2KU3 A;  2DVQ A;  1WEV A;  4LZR A;  4QSQ A;  2M6M A;  5H85 A;  5IBN A;  2RI7 A;  3IHP A;  4Z1S A;  5LKX A;  4CCG X;  4QY4 A;  3LJW A;  5AD3 A;  5D3H A;  5FE1 A;  5CFW A;  4UYF A;  2G6Q A;  5EK9 A;  1FP0 A;  3PUR A;  4BW4 A;  5KTU A;  4MR3 A;  5ETD A;  4LAD B;  1WUM A;  2C2V S;  3PUQ A;  2EGP A;  4J1P A;  5ENJ A;  5C89 A;  4PCE A;  4R7E A;  4TZ2 A;  5LVR A;  4HXN A;  4QR5 A;  5BT3 A;  5EQ1 A;  2YUC A;  3DPL R;  4QSS A;  2YQD A;  4LC2 A;  5I7Y A;  1LDK C;  1WEU A;  4AYC A;  2K4D A;  5EPR A;  4YBM A;  3N9M A;  5D3R A;  4NRC A;  5HCL A;  4O7A A;  5DKH A;  5FB0 A;  2KWK A;  3P1F A;  3M99 A;  5AIT A;  3O7A A;  2RFJ A;  2I50 A;  1JM7 B;  3M62 A;  3O35 A;  4QUT A;  5LVQ A;  3SHB A;  2E7O A;  4V3K C;  1RMD A;  2L5E A;  3V43 A;  5EIS A;  4YYM A;  4WZ0 A;  2YEK A;  2RNW A;  5D3L A;  5A85 A;  1FBV A;  4MEQ A;  4MR4 A;  5LKT A;  4S3O C;  4FJC A;  4NR6 A;  4CUU A;  1Z2Q A;  5EVA A;  3JVL A;  5II1 A;  3T7L A;  3SVG A;  2YYR A;  4BHW A;  5KTW A;  2CKL A;  4MEN A;  1X4J A;  2LN0 A;  4NR9 A;  3ASL A;  4O75 A;  3O33 A;  2CKL B;  5CRM A;  5ETB A;  4OGI A;  4UYG A;  4C9Z A;  4QSW A;  5DYC A;  5LJ1 A;  1WEO A;  3Q2E A;  4GNE A;  5C11 A;  5FE5 A;  4XY8 A;  4X3G A;  3ZPV 1;  1MM3 A;  5COI A;  3PHD A;  3LQJ A;  5EYA F;  1WE9 A;  3ZYQ A;  3HME A;  4NS5 A;  5IGK A;  5FER A;  4TT2 A;  5EPS A;  2KYU A;  5A5N A;  3MXF A;  5D26 A;  4O64 A;  3IU6 A;  5F1L A;  2DVS A;  3I3J A;  2YT5 A;  2F42 A;  2Y43 A;  5EI4 A;  5CUB A;  3U5N A;  2OO1 A;  4B86 C;  2YU4 A;  4A9L A;  4O7F A;  2VJE A;  2DAT A;  4J3I A;  2HDP A;  4QR4 A;  5I40 A;  5FE7 A;  5HJC A;  4MEO A;  2YQM A;  4L58 A;  4O78 A;  3SVH A;  1XWH A;  4NXJ A;  3TLP A;  3RPG B;  5TBN A;  3SVF A;  5HFQ A;  5D3T A;  3LRQ A;  1HYJ A;  3N9O A;  2MA6 A;  4QZS A;  5CUG A;  3G0J A;  4A9H A;  5LKZ A;  4XUA A;  4GNG A;  4LLB A;  5HEM A;  4LZ2 A;  1F68 A;  1WIM A;  5CU8 A;  2FSA A;  3MHH A;  5D0C A;  3NXB A;  4RVR A;  5CUC A;  4YC9 A;  4IR6 A;  4TT6 A;  3N9P A;  3HCU A;  4O72 A;  4UP5 A;  5FE6 A;  4PCI A;  4X2I A;  4YY6 A;  5DLX A;  2VPD A;  4LYI A;  5EWD A;  2EA6 A;  3JVM A;  5EWV A;  4LDF A;  5ENC A;  4A0C D;  5JI8 A;  4ZC9 A;  3FKM X;  4NYV A;  3GG3 A;  5C8G A;  4J0S A;  2Y1M A;  4O7B A;  2NAA A;  1JSP B;  4AVX A;  5E9Y A;  2RO1 A;  5KU3 A;  4TYL A;  5J0D A;  4XYA A;  2VP7 A;  4YYH A;  4WHU A;  5JG6 A;  5I86 A;  4I7C A;  3KNV A;  4PY6 A;  5ENI A;  5C87 A;  2R10 A;  5AD2 A;  5HRV A;  3DWY A;  2XB1 A;  4XY9 A;  5DW1 A;  3U5P A;  3SOW A;  5HQ7 A;  2QIZ A;  4A9J A;  3MUL A;  4N4H A;  3LQH A;  4ZDT A;  2H60 A;  5D3N A;  4NR8 A;  2LXH C;  4V3L C;  1IYM A;  2MNY A;  1ZBD B;  2DX8 A;  5I83 A;  4HXP A;  4NUE A;  3Q2F A;  3U5L A;  4HBW A;  5FH7 A;  4IR5 A;  5A5O A;  3ZNI A;  1F62 A;  4HXR A;  3D7C A;  4NR5 A;  5A5Q A;  4QSU A;  1X4U A;  5EA1 A;  3ZPV E;  5CPE A;  4CLB A;  5D3S A;  4QSR A;  2D8S A;  5F2P A;  2UZG A;  4ALH A;  1WEN A;  4NUD A;  2YYN A;  2M85 A;  5KH7 A;  5I1Q A;  4AUQ B;  4DON A;  4IR4 A;  2CT2 A;  4QR3 A;  4O7C A;  2VJF B;  4HXM A;  2G4A A;  4YBS A;  2D9E A;  4TQN A;  1Z6U A;  4PPE A;  5FE3 A;  4UI9 B;  4FLP A;  4C67 A;  4YYK A;  4N3W A;  4KV4 A;  4UYE A;  4XI1 A;  2CSY A;  5FE4 A;  3C5K A;  4LYS A;  5HQ6 A;  4ZUX U;  4YAB A;  2YSM A;  1DVP A;  5EV9 A;  5CGP A;  4J0R A;  4MSX A;  5DYX A;  3ZTG A;  3UV2 A;  1JM7 A;  4UIT A;  2OSS A;  2IDA A;  3ZYU A;  5CQ8 A;  2L0B A;  4KCX A;  4A9E A;  1WIL A;  3N9Q A;  3HTK C;  4XUB A;  2LV9 A;  4NR4 A;  3UV4 A;  2GRC A;  5CTL A;  4Z6H A;  5E0R A;  3N9L A;  4GNF A;  4HBV A;  4YH4 A;  2E6S A;  2VPB A;  3KV5 A;  5DKA A;  4Z1Q A;  1E4U A;  3O37 A;  4WHW A;  5H1V A;  5TAB A;  5E9M A;  5FBX A;  4YY4 A;  2KGG A;  2ZET C;  5FH6 A;  2MIQ A;  5B8D A;  3AAD A;  2CSZ A;  4BJX A;  5HLS A;  5F61 A;  5HFR A;  5TCM A;  1WUG A;  5ACY A;  5HM0 A;  5I7X A;  2RS9 B;  4QEW A;  2K17 A;  2VPE A;  3JVK A;  4TTE A;  5FH8 A;  3P1C A;  4ZW1 A;  3UVY A;  5DY7 A;  2LGL A;  2BAY A;  5FFV A;  2YEM A;  2JMD A;  3K2J A;  3C6W A;  5A5S A;  4TU6 A;  2PNX A;  2N9G A;  4HXS A;  2I7K A; 
#chains in the Genus database with same CATH topology
 4QQ4 A;  4YYI A;  4TS8 A;  2KTB B;  3ONI A;  2JUN A;  5F63 A;  3HCS A;  3MDB C;  2YW5 A;  2DKW A;  3FL2 A;  4WZ2 A;  4A4B A;  4MR5 A;  5L99 A;  2L84 A;  4WA6 A;  3U5M A;  3P1E A;  5HEL A;  5D1K B;  5FE8 A;  4CA1 A;  2I8N A;  1MBM A;  5D24 A;  4YYG A;  2MD7 B;  2DVR A;  1N87 A;  4HXL A;  4O77 A;  3EB5 A;  3O36 A;  4NQM A;  2XEU A;  3RPG C;  4NRB A;  2MT5 A;  3LQI A;  4IC3 A;  5AME A;  5B78 A;  4A9K A;  5FFY A;  4UIX A;  4HXK A;  4Z93 A;  2E6R A;  2PUY A;  5IGM A;  1WEW A;  2K16 A;  5L97 A;  5DW2 A;  2YEL A;  4MR6 A;  2MKE A;  5G0F A;  4MVT A;  4A9I A;  2D82 A;  4YBT A;  4R8P K;  3L11 A;  5I80 A;  5BT5 A;  3T9K A;  5DLZ A;  5H1T A;  1WFK A;  4N4G A;  4QSV A;  2ECJ A;  3EB6 A;  2IQJ A;  2KRE A;  4NYW A;  2KE1 A;  5FG6 A;  2KFT A;  5EIC A;  2R0Y A;  1JOC A;  4MEP A;  4QYD A;  4YAT A;  2L43 A;  4ALG A;  3VKH A;  2L5U A;  3DWD A;  4QF3 A;  2NXB A;  2DVV A;  5EM3 A;  4AKN A;  1JM4 B;  5C13 A;  2OUO A;  3JUE A;  2EJN A;  2JMI A;  5D3J A;  2RNY A;  5ENF A;  5F25 A;  2JM3 A;  4FK5 A;  3GV4 A;  1EQF A;  3O34 A;  4YK0 A;  3U5K A;  2M13 A;  1BOR A;  3M63 A;  3UVX A;  2YVR A;  5CQ5 A;  5ENG A;  2LRI C;  4UIW A;  2MJV B;  5I89 A;  5KH3 A;  5AMF A;  5I88 A;  5EWC A;  2E3K A;  5EU1 A;  5I29 A;  5KTX A;  5CZG A;  5CQT A;  5E3G A;  3FEH A;  3LXJ A;  5D1L B;  4UYH A;  4Z6I A;  5A83 A;  2KKY A;  4QYL A;  5IGL A;  5CQ6 A;  1LDJ B;  1HYI A;  5CQ3 A;  4CUQ A;  4ZQL A;  5A82 A;  2YSJ A;  5L98 A;  5CQ4 A;  4IOQ A;  4HBY A;  4TZ8 A;  2VNF A;  5BT4 A;  3QZS A;  5C85 A;  4IC2 A;  3P1D A;  4N4I A;  2G45 A;  4QEV A;  3S92 A;  2KIZ A;  5F5Z A;  4YAX A;  4R2Y A;  2VJF A;  3MB4 A;  4O74 A;  5IGN A;  2AN6 A;  1WES A;  3QZT A;  2MNZ A;  1WEM A;  4KV1 A;  4IOO A;  1V87 A;  5IID A;  4AP4 A;  4O71 A;  5TDW A;  4YAD A;  4O70 A;  5DKD A;  5D7X A;  2WP2 A;  1X4I A;  4QST A;  5FG5 A;  1Z60 A;  4YYD A;  2ECG A;  5ENE A;  5A5P A;  2H0D B;  1WEP A;  2MUM A;  1PUO A;  5HEN A;  4UIZ A;  3LJU X;  4I7D A;  5AIU A;  2CON A;  1T1H A;  3IU5 A;  4Q0O A;  3DAI A;  5D3P A;  5CP5 A;  4GND A;  5J3X A;  5D25 A;  4L7X A;  2P57 A;  4BW2 A;  5CUE A;  5DX4 A;  4A9N A;  2FFW A;  4UYF B;  5E9V A;  1E6I A;  4GB0 A;  3SOU A;  4GPJ A;  2LGV A;  2ECI A;  3I2D A;  1VYX A;  4UIU A;  3HCT A;  5TB6 A;  3P5O A;  2CSV A;  2LGK A;  2M3H A;  3ZVZ B;  2LSP B;  2LAU A;  4CUT A;  5CQA A;  5F3A A;  5F1H A;  5L96 A;  3MB3 A;  2E61 A;  2LQ6 A;  2XOC A;  2FUU A;  5E74 A;  4NYX A;  5JWM A;  2YDW A;  5DBM A;  4QC1 A;  5FB1 A;  5FE9 A;  5TRB A;  5I3L A;  5DFD A;  3U5O A;  2QIC A;  3D1B A;  5EWW A;  5DYA A;  1WEQ A;  5IG6 A;  4A9F A;  2YQL A;  4AYC B;  4QEU A;  4LR6 A;  5F36 A;  5DYU A;  2YUR A;  4A9M A;  3G0L A;  4IR3 A;  5FE0 A;  5G4R A;  4NN2 A;  4WIV A;  3KQI A;  2JRJ A;  4Q6F A;  5G05 B;  4Q0N A;  1U6G B;  4QF2 A;  3DDT A;  4A4C A;  2HYE D;  4CUS A;  4E96 A;  2K1J A;  2MD8 C;  3O70 A;  5B77 A;  2RSD A;  4LK9 A;  5B76 A;  4S3O B;  3VK6 A;  4PKL A;  5C4Q A;  2LDR A;  4UIY A;  2ECW A;  2KWJ A;  4AI6 A;  4WZ3 B;  1N72 A;  5CQ7 A;  5E9I A;  2L75 A;  3T6R A;  4NQN A;  2M1R A;  3HMF A;  3N9N A;  2LXP C;  4NUC A;  5E9L A;  4N4F A;  4LZS A;  4BW3 A;  3QZV A;  3GL6 A;  5FEY A;  4TKP B;  1G25 A;  1ZS5 A;  2R0S A;  5LJ2 A;  2DWW A;  5DKC A;  5II2 A;  2F6J A;  5HQ5 A;  3PLW A;  2EOD A;  4LKA A;  5KH9 A;  4YYJ A;  4QBM A;  3U5J A;  2KWO A;  4O76 A;  5EWH A;  3AQA A;  5EP7 A;  5LUU A;  5L8U A;  5ENH A;  2ECV A;  3Q1D A;  4OUF A;  2KR4 A;  2FD4 A;  1K2F A;  1X0J A;  3UVD A;  5C7N A;  2VJE B;  5TDR A;  5LJ0 A;  4BW1 A;  5FFW A;  4TT4 A;  5K3Q A;  3RCW A;  2YHN A;  5B79 A;  5L8T A;  5G04 B;  5HRX A;  4I7B A;  5CS8 A;  4C66 A;  4W4U A;  4B7Y C;  2KGI A;  4O7E A;  2JMJ A;  3UVW A;  5CRZ A;  2YRE A;  3ZVY A;  4A49 A;  5B75 A;  1MM2 A;  4YH3 A;  4UP0 A;  4CUP A;  4QSX A;  2CRW A;  4NRA A;  4LYW A;  2WP1 A;  4NR7 A;  5E3D A;  2DJA A;  2E7N A;  2VPG A;  3MUK A;  5LCW B;  4AKH A;  4FIP A;  1VFY A;  4LJN A;  3SOX A;  4IOR A;  4AKG A;  1DCQ A;  4PTB A;  4UIV A;  4UYD A;  5KHM A;  5CUA A;  5CY9 A;  2C2L A;  4QSP A;  4CL9 A;  4CFK A;  4FO9 A;  3UW9 A;  5EGU A;  5E73 A;  5FDZ A;  5G4S A;  5F60 A;  2L80 A;  3LDY A;  3UV5 A;  2MA5 A;  4PS5 A;  2G43 A;  4O62 A;  1WGM A;  2L85 A;  2RNX A;  4QC3 A;  5DFC A;  5A81 A;  5LKU A;  2ECT A;  2QJ0 A;  3MHS A;  2L7P A;  3RTR B;  5FG4 A;  2RR4 A;  4TU4 A;  1ZKR A;  5CUD A;  4QUU A;  3O47 A;  3MQM A;  2LGG A;  5A7C A;  3KV6 A;  4F52 B;  5E9K A;  3HMH A;  4QB3 A;  2R0V A;  2XOY A;  3S91 A;  5KO4 A;  5D1M B;  2Y1N A;  3KDE C;  4Y03 A;  2OXQ C;  2YW8 A;  5FE2 A;  5E7D A;  5H1U A;  4P5O B;  4LRG A;  5DIN A;  5EPB A;  1VD4 A;  4HXO A;  4BBQ A;  3L1Z B;  2FUI A;  4HBX A;  5HRW A;  5K29 A;  2KWN A;  4QNS A;  4F3I A;  5ENB A;  2YHO A;  2F6N A;  4OGJ A;  5DFB A;  4YYN A;  4A9O A;  2ECN A;  4CFL A;  5H9M A;  1WEE A;  3NG2 A;  5F62 A;  1CHC A;  2H0D A;  4CUR A;  3DQV R;  3H7H A;  5A5R A;  3JVJ A;  2KU3 A;  2DVQ A;  1WEV A;  4LZR A;  4QSQ A;  2M6M A;  5H85 A;  5IBN A;  2RI7 A;  3IHP A;  4Z1S A;  5LKX A;  4CCG X;  4QY4 A;  3LJW A;  5AD3 A;  5D3H A;  5FE1 A;  4OGE A;  5CFW A;  4UYF A;  2G6Q A;  2CRR A;  5EK9 A;  1FP0 A;  3PUR A;  4BW4 A;  2D8U A;  5KTU A;  3L1X A;  4MR3 A;  5ETD A;  4LAD B;  5SVI B;  1WUM A;  2C2V S;  3FAN A;  3PUQ A;  2EGP A;  4J1P A;  5ENJ A;  5C89 A;  4PCE A;  4R7E A;  4TZ2 A;  5LVR A;  4HXN A;  4QR5 A;  5BT3 A;  5EQ1 A;  2YUC A;  3DPL R;  4QSS A;  3VKG A;  2YQD A;  4LC2 A;  5I7Y A;  1LDK C;  1WEU A;  4AYC A;  2K4D A;  5EPR A;  4YBM A;  2XP0 A;  3N9M A;  5D3R A;  4NRC A;  5HCL A;  4O7A A;  5DKH A;  2KKX A;  5FB0 A;  2KWK A;  3P1F A;  3M99 A;  5AIT A;  3FAO A;  3O7A A;  2RFJ A;  2I50 A;  1JM7 B;  3M62 A;  3O35 A;  4QUT A;  5LVQ A;  3SHB A;  2E7O A;  4V3K C;  1RMD A;  2L5E A;  3V43 A;  5EIS A;  4YYM A;  4WZ0 A;  2YEK A;  2RNW A;  5D3L A;  5A85 A;  1FBV A;  4MEQ A;  4MR4 A;  5LKT A;  4S3O C;  4FJC A;  4NR6 A;  4CUU A;  1Z2Q A;  5EVA A;  3JVL A;  5II1 A;  3T7L A;  3SVG A;  2YYR A;  4BHW A;  5KTW A;  2CKL A;  4MEN A;  1X4J A;  2LN0 A;  4NR9 A;  3ASL A;  4O75 A;  3O33 A;  2CKL B;  5CRM A;  5ETB A;  4OGI A;  4UYG A;  4C9Z A;  4QSW A;  5DYC A;  5LJ1 A;  4OGC A;  1WEO A;  3Q2E A;  4GNE A;  5C11 A;  5FE5 A;  4XY8 A;  4X3G A;  3ZPV 1;  1MM3 A;  5COI A;  3PHD A;  3LQJ A;  5EYA F;  1WE9 A;  3ZYQ A;  3HME A;  4NS5 A;  5IGK A;  5FER A;  4TT2 A;  2OWA A;  5EPS A;  2KYU A;  5A5N A;  3MXF A;  5D26 A;  4O64 A;  3IU6 A;  5F1L A;  2DVS A;  3I3J A;  2YT5 A;  2F42 A;  2Y43 A;  5EI4 A;  5CUB A;  3U5N A;  2OO1 A;  4B86 C;  2YU4 A;  4A9L A;  4O7F A;  2VJE A;  2DAT A;  4J3I A;  2HDP A;  4QR4 A;  5I40 A;  5FE7 A;  5HJC A;  4MEO A;  2YQM A;  3FJU B;  4L58 A;  4AKI A;  4O78 A;  3SVH A;  1XWH A;  4NXJ A;  3TLP A;  3RPG B;  5TBN A;  3SVF A;  5HFQ A;  5D3T A;  3LRQ A;  1HYJ A;  3N9O A;  2MA6 A;  4QZS A;  5CUG A;  3G0J A;  4A9H A;  5LKZ A;  4XUA A;  4GNG A;  4LLB A;  5HEM A;  4LZ2 A;  4Z0R A;  1F68 A;  1WIM A;  5CU8 A;  2FSA A;  3E2D A;  3LVQ E;  3MHH A;  5D0C A;  3NXB A;  4RVR A;  5CUC A;  4YC9 A;  4IR6 A;  4TT6 A;  3N9P A;  3HCU A;  4O72 A;  4UP5 A;  5FE6 A;  4PCI A;  4X2I A;  4YY6 A;  4F1P A;  5DLX A;  2VPD A;  4LYI A;  5EWD A;  2EA6 A;  3JVM A;  5EWV A;  4LDF A;  5ENC A;  4A0C D;  5JI8 A;  4ZC9 A;  2B0O E;  3FKM X;  4NYV A;  3D1D A;  3GG3 A;  5C8G A;  4J0S A;  2Y1M A;  4O7B A;  4Z0O A;  2NAA A;  1JSP B;  4AVX A;  5E9Y A;  2RO1 A;  5KU3 A;  5SVX A;  4TYL A;  2EXU A;  5J0D A;  4XYA A;  3LVR E;  2VP7 A;  4YYH A;  4WHU A;  5JG6 A;  5I86 A;  4I7C A;  3KNV A;  4PY6 A;  5ENI A;  5C87 A;  2R10 A;  5AD2 A;  5HRV A;  3DWY A;  2XB1 A;  4XY9 A;  5DW1 A;  3U5P A;  2XOZ A;  3SOW A;  5HQ7 A;  2QIZ A;  4A9J A;  3MUL A;  4N4H A;  3LQH A;  4ZDT A;  2H60 A;  5D3N A;  4NR8 A;  2LXH C;  4V3L C;  1IYM A;  2MNY A;  1ZBD B;  2DX8 A;  5I83 A;  4HXP A;  4NUE A;  3Q2F A;  3U5L A;  4HBW A;  5FH7 A;  4IR5 A;  5A5O A;  3ZNI A;  2EGM A;  1F62 A;  4HXR A;  3D7C A;  4NR5 A;  5A5Q A;  4QSU A;  1X4U A;  5EA1 A;  3ZPV E;  5CPE A;  4CLB A;  5D3S A;  4QSR A;  2D8S A;  3FM8 C;  5F2P A;  2UZG A;  4ALH A;  1WEN A;  4NUD A;  2YYN A;  2M85 A;  5KH7 A;  5I1Q A;  4AUQ B;  4DON A;  4IR4 A;  2CT2 A;  4QR3 A;  4O7C A;  2VJF B;  4HXM A;  5SVI A;  2G4A A;  4YBS A;  2D9E A;  4TQN A;  1Z6U A;  4PPE A;  3SUB A;  5FE3 A;  4UI9 B;  4FLP A;  4C67 A;  4YYK A;  4N3W A;  4KV4 A;  4UYE A;  4XI1 A;  2CSY A;  5FE4 A;  3C5K A;  4LYS A;  5HQ6 A;  4ZUX U;  4YAB A;  2YSM A;  1DVP A;  5EV9 A;  5CGP A;  4J0R A;  2DSM A;  4MSX A;  5DYX A;  3ZTG A;  3UV2 A;  1JM7 A;  4UIT A;  2OSS A;  2IDA A;  3ZYU A;  5CQ8 A;  2L0B A;  4KCX A;  4A9E A;  3ERR A;  1WIL A;  3HTK C;  4XUB A;  2LV9 A;  4NR4 A;  3UV4 A;  3N9Q A;  2GRC A;  5CTL A;  4Z6H A;  5E0R A;  4H9D A;  3N9L A;  4GNF A;  4HBV A;  4YH4 A;  2E6S A;  2VPB A;  3KV5 A;  5DKA A;  4Z1Q A;  1E4U A;  3O37 A;  4WHW A;  5H1V A;  5TAB A;  5E9M A;  5FBX A;  4YY4 A;  2KGG A;  2ZET C;  5FH6 A;  2MIQ A;  5B8D A;  3AAD A;  2CSZ A;  4BJX A;  5HLS A;  5F61 A;  5HFR A;  5TCM A;  1WUG A;  5ACY A;  5SVY A;  5HM0 A;  5I7X A;  2RS9 B;  4QEW A;  2K17 A;  2VPE A;  3JVK A;  4TTE A;  5FH8 A;  3P1C A;  4ZW1 A;  3UVY A;  5DY7 A;  2LGL A;  3M7K A;  2BAY A;  5FFV A;  2YEM A;  2JMD A;  3K2J A;  3C6W A;  5A5S A;  4TU6 A;  2PNX A;  2N9G A;  4HXS A;  2I7K A; 
#chains in the Genus database with same CATH homology
 4YYI A;  4TS8 A;  2KTB B;  3ONI A;  5F63 A;  3HCS A;  2YW5 A;  2DKW A;  3FL2 A;  4WZ2 A;  4A4B A;  4MR5 A;  5L99 A;  2L84 A;  4WA6 A;  3U5M A;  3P1E A;  5HEL A;  5D1K B;  5FE8 A;  4CA1 A;  2I8N A;  5D24 A;  4YYG A;  2MD7 B;  2DVR A;  1N87 A;  4HXL A;  4O77 A;  3EB5 A;  3O36 A;  4NQM A;  2XEU A;  3RPG C;  4NRB A;  2MT5 A;  3LQI A;  4IC3 A;  5AME A;  5B78 A;  4A9K A;  5FFY A;  4UIX A;  4HXK A;  4Z93 A;  2E6R A;  2PUY A;  5IGM A;  1WEW A;  2K16 A;  5L97 A;  5DW2 A;  2YEL A;  4MR6 A;  5G0F A;  4MVT A;  4A9I A;  2D82 A;  4YBT A;  4R8P K;  3L11 A;  5I80 A;  5BT5 A;  5DLZ A;  5H1T A;  1WFK A;  4N4G A;  4QSV A;  2ECJ A;  3EB6 A;  2KRE A;  4NYW A;  2KE1 A;  5FG6 A;  2KFT A;  5EIC A;  2R0Y A;  1JOC A;  4MEP A;  4QYD A;  4YAT A;  2L43 A;  4ALG A;  2L5U A;  4QF3 A;  2NXB A;  2DVV A;  5EM3 A;  4AKN A;  1JM4 B;  5C13 A;  2OUO A;  2JMI A;  5D3J A;  2RNY A;  5ENF A;  5F25 A;  4FK5 A;  3GV4 A;  1EQF A;  3O34 A;  4YK0 A;  3U5K A;  1BOR A;  3M63 A;  3UVX A;  5CQ5 A;  5ENG A;  2LRI C;  4UIW A;  2MJV B;  5I89 A;  5KH3 A;  5AMF A;  5I88 A;  5EWC A;  2E3K A;  5EU1 A;  5I29 A;  5KTX A;  5CZG A;  5CQT A;  5E3G A;  3LXJ A;  5D1L B;  4UYH A;  4Z6I A;  5A83 A;  4QYL A;  5IGL A;  5CQ6 A;  1LDJ B;  1HYI A;  5CQ3 A;  4CUQ A;  4ZQL A;  5A82 A;  2YSJ A;  5L98 A;  5CQ4 A;  4IOQ A;  4HBY A;  4TZ8 A;  2VNF A;  5BT4 A;  3QZS A;  5C85 A;  4IC2 A;  3P1D A;  4N4I A;  2G45 A;  4QEV A;  3S92 A;  2KIZ A;  5F5Z A;  4YAX A;  4R2Y A;  2VJF A;  3MB4 A;  4O74 A;  5IGN A;  2AN6 A;  1WES A;  3QZT A;  2MNZ A;  1WEM A;  4KV1 A;  4IOO A;  1V87 A;  5IID A;  4AP4 A;  4O71 A;  5TDW A;  4YAD A;  4O70 A;  5DKD A;  5D7X A;  2WP2 A;  1X4I A;  4QST A;  5FG5 A;  1Z60 A;  4YYD A;  2ECG A;  5ENE A;  5A5P A;  2H0D B;  1WEP A;  2MUM A;  5HEN A;  4UIZ A;  4I7D A;  5AIU A;  1T1H A;  3IU5 A;  4Q0O A;  3DAI A;  5D3P A;  5CP5 A;  4GND A;  5J3X A;  5D25 A;  4L7X A;  4BW2 A;  5CUE A;  5DX4 A;  4A9N A;  4UYF B;  5E9V A;  1E6I A;  4GB0 A;  3SOU A;  4GPJ A;  2LGV A;  2ECI A;  3I2D A;  1VYX A;  4UIU A;  3HCT A;  5TB6 A;  3P5O A;  3ZVZ B;  2LGK A;  2M3H A;  2LSP B;  4CUT A;  5CQA A;  5F3A A;  5F1H A;  5L96 A;  3MB3 A;  2LQ6 A;  2FUU A;  5E74 A;  4NYX A;  5JWM A;  2YDW A;  5DBM A;  4QC1 A;  5FB1 A;  5FE9 A;  5TRB A;  5I3L A;  5DFD A;  3U5O A;  2QIC A;  5EWW A;  5DYA A;  1WEQ A;  5IG6 A;  4A9F A;  2YQL A;  4AYC B;  4QEU A;  4LR6 A;  5F36 A;  5DYU A;  2YUR A;  4A9M A;  3G0L A;  4IR3 A;  5FE0 A;  5G4R A;  4NN2 A;  4WIV A;  3KQI A;  2JRJ A;  4Q6F A;  5G05 B;  4Q0N A;  1U6G B;  4QF2 A;  4A4C A;  2HYE D;  4CUS A;  4E96 A;  2K1J A;  2MD8 C;  3O70 A;  5B77 A;  2RSD A;  4LK9 A;  5B76 A;  4S3O B;  3VK6 A;  4PKL A;  5C4Q A;  2LDR A;  4UIY A;  2ECW A;  2KWJ A;  4WZ3 B;  1N72 A;  5CQ7 A;  5E9I A;  2L75 A;  3T6R A;  4NQN A;  2M1R A;  3HMF A;  3N9N A;  2LXP C;  4NUC A;  5E9L A;  4N4F A;  4LZS A;  4BW3 A;  3QZV A;  3GL6 A;  5FEY A;  4TKP B;  1G25 A;  1ZS5 A;  2R0S A;  5LJ2 A;  2DWW A;  5DKC A;  5II2 A;  2F6J A;  5HQ5 A;  4LKA A;  2EOD A;  5KH9 A;  4YYJ A;  4QBM A;  3U5J A;  2KWO A;  4O76 A;  5EWH A;  3AQA A;  5EP7 A;  5LUU A;  5L8U A;  5ENH A;  2ECV A;  4OUF A;  2KR4 A;  1K2F A;  1X0J A;  3UVD A;  5C7N A;  5TDR A;  5LJ0 A;  4BW1 A;  5FFW A;  4TT4 A;  3RCW A;  2YHN A;  5B79 A;  5L8T A;  5G04 B;  5HRX A;  4I7B A;  5CS8 A;  4C66 A;  4W4U A;  4B7Y C;  2KGI A;  4O7E A;  2JMJ A;  3UVW A;  5CRZ A;  2YRE A;  3ZVY A;  4A49 A;  5B75 A;  1MM2 A;  4YH3 A;  4UP0 A;  4CUP A;  4QSX A;  2VJE B;  4NRA A;  4LYW A;  2WP1 A;  4NR7 A;  5E3D A;  3L1X A;  2E7N A;  2VPG A;  3MUK A;  5LCW B;  4FIP A;  1VFY A;  4LJN A;  3SOX A;  4IOR A;  4PTB A;  4UIV A;  4UYD A;  5KHM A;  5CUA A;  5CY9 A;  2C2L A;  4QSP A;  4CL9 A;  4CFK A;  4FO9 A;  3UW9 A;  5EGU A;  5E73 A;  5FDZ A;  5G4S A;  5F60 A;  2L80 A;  3UV5 A;  2MA5 A;  4PS5 A;  2G43 A;  1WGM A;  2L85 A;  2RNX A;  4QC3 A;  5DFC A;  5A81 A;  5LKU A;  2ECT A;  2QJ0 A;  3MHS A;  3RTR B;  5FG4 A;  4TU4 A;  5CUD A;  4QUU A;  3MQM A;  2LGG A;  5A7C A;  3KV6 A;  4F52 B;  5E9K A;  3HMH A;  4QB3 A;  2R0V A;  3S91 A;  5KO4 A;  5D1M B;  2Y1N A;  4Y03 A;  2OXQ C;  2YW8 A;  5FE2 A;  5E7D A;  5H1U A;  4P5O B;  4LRG A;  5DIN A;  5EPB A;  1VD4 A;  4HXO A;  4BBQ A;  3L1Z B;  2FUI A;  4HBX A;  5HRW A;  5K29 A;  2KWN A;  4QNS A;  4F3I A;  5ENB A;  2YHO A;  2F6N A;  4OGJ A;  5DFB A;  4YYN A;  4A9O A;  2ECN A;  4CFL A;  5H9M A;  1WEE A;  3NG2 A;  5F62 A;  1CHC A;  2H0D A;  4CUR A;  3DQV R;  5A5R A;  3JVJ A;  2KU3 A;  2DVQ A;  1WEV A;  4LZR A;  4QSQ A;  2M6M A;  5H85 A;  5IBN A;  2RI7 A;  3IHP A;  4Z1S A;  5LKX A;  4CCG X;  4QY4 A;  3LJW A;  5AD3 A;  5D3H A;  5FE1 A;  5CFW A;  4UYF A;  2G6Q A;  5EK9 A;  1FP0 A;  3PUR A;  4BW4 A;  5KTU A;  4MR3 A;  5ETD A;  4LAD B;  1WUM A;  2C2V S;  3PUQ A;  2EGP A;  4J1P A;  5ENJ A;  5C89 A;  4PCE A;  4R7E A;  4TZ2 A;  5LVR A;  4HXN A;  4QR5 A;  5BT3 A;  5EQ1 A;  2YUC A;  3DPL R;  4QSS A;  2YQD A;  4LC2 A;  5I7Y A;  1LDK C;  1WEU A;  4AYC A;  2K4D A;  5EPR A;  4YBM A;  3N9M A;  5D3R A;  4NRC A;  5HCL A;  4O7A A;  5DKH A;  5FB0 A;  2KWK A;  3P1F A;  3M99 A;  5AIT A;  3O7A A;  2RFJ A;  2I50 A;  1JM7 B;  3M62 A;  3O35 A;  4QUT A;  5LVQ A;  3SHB A;  2E7O A;  4V3K C;  1RMD A;  2L5E A;  3V43 A;  5EIS A;  4YYM A;  4WZ0 A;  2YEK A;  2RNW A;  5D3L A;  5A85 A;  1FBV A;  4MEQ A;  4MR4 A;  5LKT A;  4S3O C;  4FJC A;  4NR6 A;  4CUU A;  1Z2Q A;  5EVA A;  3JVL A;  5II1 A;  3T7L A;  3SVG A;  2YYR A;  4BHW A;  5KTW A;  2CKL A;  4MEN A;  1X4J A;  2LN0 A;  4NR9 A;  3ASL A;  4O75 A;  3O33 A;  2CKL B;  5CRM A;  5ETB A;  4OGI A;  4UYG A;  4C9Z A;  4QSW A;  5DYC A;  5LJ1 A;  1WEO A;  3Q2E A;  4GNE A;  5C11 A;  5FE5 A;  4XY8 A;  4X3G A;  3ZPV 1;  1MM3 A;  5COI A;  3PHD A;  3LQJ A;  5EYA F;  1WE9 A;  3ZYQ A;  3HME A;  4NS5 A;  5IGK A;  5FER A;  4TT2 A;  5EPS A;  2KYU A;  5A5N A;  3MXF A;  5D26 A;  4O64 A;  3IU6 A;  5F1L A;  2DVS A;  3I3J A;  2YT5 A;  2F42 A;  2Y43 A;  5EI4 A;  5CUB A;  3U5N A;  2OO1 A;  4B86 C;  2YU4 A;  4A9L A;  4O7F A;  2VJE A;  2DAT A;  4J3I A;  2HDP A;  4QR4 A;  5I40 A;  5FE7 A;  5HJC A;  4MEO A;  2YQM A;  4L58 A;  4O78 A;  3SVH A;  1XWH A;  4NXJ A;  3TLP A;  3RPG B;  5TBN A;  3SVF A;  5HFQ A;  5D3T A;  3LRQ A;  1HYJ A;  3N9O A;  2MA6 A;  4QZS A;  5CUG A;  3G0J A;  4A9H A;  5LKZ A;  4XUA A;  4GNG A;  4LLB A;  5HEM A;  4LZ2 A;  1F68 A;  1WIM A;  5CU8 A;  2FSA A;  3MHH A;  5D0C A;  3NXB A;  4RVR A;  5CUC A;  4YC9 A;  4IR6 A;  4TT6 A;  3N9P A;  3HCU A;  4O72 A;  4UP5 A;  5FE6 A;  4PCI A;  4X2I A;  4YY6 A;  5DLX A;  2VPD A;  4LYI A;  5EWD A;  2EA6 A;  3JVM A;  5EWV A;  4LDF A;  5ENC A;  4A0C D;  5JI8 A;  4ZC9 A;  3FKM X;  4NYV A;  3GG3 A;  5C8G A;  4J0S A;  2Y1M A;  4O7B A;  2NAA A;  1JSP B;  4AVX A;  5E9Y A;  2RO1 A;  5KU3 A;  4TYL A;  5J0D A;  4XYA A;  2VP7 A;  4YYH A;  4WHU A;  5JG6 A;  5I86 A;  4I7C A;  3KNV A;  4PY6 A;  5ENI A;  5C87 A;  2R10 A;  5AD2 A;  5HRV A;  3DWY A;  2XB1 A;  4XY9 A;  5DW1 A;  3U5P A;  3SOW A;  5HQ7 A;  2QIZ A;  4A9J A;  3MUL A;  4N4H A;  3LQH A;  4ZDT A;  2H60 A;  5D3N A;  4NR8 A;  2LXH C;  4V3L C;  1IYM A;  2MNY A;  1ZBD B;  2DX8 A;  5I83 A;  4HXP A;  4NUE A;  3Q2F A;  3U5L A;  4HBW A;  5FH7 A;  4IR5 A;  5A5O A;  3ZNI A;  1F62 A;  4HXR A;  3D7C A;  4NR5 A;  5A5Q A;  4QSU A;  1X4U A;  5EA1 A;  3ZPV E;  5CPE A;  4CLB A;  5D3S A;  4QSR A;  2D8S A;  5F2P A;  2UZG A;  4ALH A;  1WEN A;  4NUD A;  2YYN A;  2M85 A;  5KH7 A;  5I1Q A;  4AUQ B;  4DON A;  4IR4 A;  2CT2 A;  4QR3 A;  4O7C A;  2VJF B;  4HXM A;  2G4A A;  4YBS A;  2D9E A;  4TQN A;  1Z6U A;  4PPE A;  5FE3 A;  4UI9 B;  4FLP A;  4C67 A;  4YYK A;  4N3W A;  4KV4 A;  4UYE A;  4XI1 A;  2CSY A;  5FE4 A;  3C5K A;  4LYS A;  5HQ6 A;  4ZUX U;  4YAB A;  2YSM A;  1DVP A;  5EV9 A;  5CGP A;  4J0R A;  4MSX A;  5DYX A;  3ZTG A;  3UV2 A;  1JM7 A;  4UIT A;  2OSS A;  2IDA A;  3ZYU A;  5CQ8 A;  2L0B A;  4KCX A;  4A9E A;  1WIL A;  3N9Q A;  3HTK C;  4XUB A;  2LV9 A;  4NR4 A;  3UV4 A;  2GRC A;  5CTL A;  4Z6H A;  5E0R A;  3N9L A;  4GNF A;  4HBV A;  4YH4 A;  2E6S A;  2VPB A;  3KV5 A;  5DKA A;  4Z1Q A;  1E4U A;  3O37 A;  4WHW A;  5H1V A;  5TAB A;  5E9M A;  5FBX A;  4YY4 A;  2KGG A;  2ZET C;  5FH6 A;  2MIQ A;  5B8D A;  3AAD A;  2CSZ A;  4BJX A;  5HLS A;  5F61 A;  5HFR A;  5TCM A;  1WUG A;  5ACY A;  5HM0 A;  5I7X A;  2RS9 B;  4QEW A;  2K17 A;  2VPE A;  3JVK A;  4TTE A;  5FH8 A;  3P1C A;  4ZW1 A;  3UVY A;  5DY7 A;  2LGL A;  2BAY A;  5FFV A;  2YEM A;  2JMD A;  3K2J A;  3C6W A;  5A5S A;  4TU6 A;  2PNX A;  2N9G A;  4HXS A;  2I7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...