5H1VA

Complex structure of trim24 phd-bromodomain and inhibitor 6
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
169
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQESMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
total genus 50
structure length 169
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1vA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1vA01
5COIA 2JMIA 5D3NA 5EVAA 2KE1A 3HCUA 5D7XA 3ASLA 3DWYA 5H1TA 5D3PA 4A9KA 5DYAA 4TZ8A 5EISA 1X4JA 5B76A 2L85A 2HYED 1Z2QA 5EU1A 4CUUA 4AUQB 1E4UA 4X3GA 4BHWA 3P1EA 4NQNA 4QR4A 5HENA 5CRMA 4A9NA 1X4UA 2VPGA 5IGLA 4XI1A 5D1MB 3VK6A 5F61A 4F3IA 4Y03A 4J0RA 5DW2A 3U5OA 5K29A 5EPSA 3P1FA 2VPDA 4FIPA 1WEEA 2LQ6A 4LKAA 3RPGB 2F6JA 2RSDA 2E6SA 2YDWA 2RS9B 4HXPA 4A0CD 1HYIA 5I83A 5FE0A 2L43A 3N9MA 5HFRA 2LV9A 1WUGA 4YH4A 3U5PA 4TS8A 5HQ7A 1WENA 3DQVR 4S3OB 4KV1A 4NR5A 3O70A 5E9IA 5TDRA 5E9YA 4A4CA 5CUGA 3MB4A 1WEOA 5H9MA 3UV4A 4UYFB 5CTLA 2E7NA 4J1PA 4QC3A 4DONA 4PCIA 2Y43A 2KYUA 4WA6A 5L96A 1N72A 4NYXA 5DFDA 2VJEB 4UIWA 5G04B 3TLPA 4I7BA 5CS8A 4NR7A 2OXQC 1VYXA 4O64A 5DFBA 1WFKA 2YW8A 2G45A 4HXOA 4AKNA 2DX8A 5F63A 3G0LA 5HEMA 4Q0NA 4LZSA 2CKLB 5FEYA 5F5ZA 5A5SA 3GL6A 5CQ7A 2LDRA 4YYMA 5C87A 1RMDA 4TTEA 5A82A 4O7CA 5D3SA 4O70A 4YBSA 4YYGA 2EODA 2HDPA 3HCTA 4L7XA 2JRJA 4CCGX 5HJCA 4LLBA 5I3LA 5FH6A 3HTKC 4CA1A 4R2YA 2YHOA 2AN6A 4IR3A 3FKMX 5J3XA 5FH8A 2LGVA 2RI7A 3JVMA 5H1UA 2PUYA 1JM4B 3AQAA 3KV6A 3M63A 3ZVZB 2YREA 3SOUA 1BORA 4YABA 3SVFA 3O37A 2UZGA 4UYDA 5C11A 5E9MA 2R0VA 2QJ0A 5FDZA 2OO1A 3IU5A 2YQLA 3EB5A 5B77A 2VP7A 4O7EA 4I7DA 4HXMA 1WILA 2YYRA 5B8DA 5FE4A 2M1RA 3UW9A 3L11A 5E3DA 2ECJA 4TT4A 4UP0A 5DYCA 3JVLA 1LDJB 1JM7B 4IOOA 5KTWA 4YY6A 2IDAA 2K17A 2DVVA 2YQMA 3D7CA 4GB0A 4QUTA 5ENBA 4HBVA 4QF2A 1MM2A 5IBNA 5EM3A 4QUUA 4GNGA 3AADA 4BW2A 4PS5A 3U5LA 4AP4A 2R10A 5A5NA 2KWOA 4UYGA 5C89A 5D25A 4QYDA 3O34A 5E73A 5D24A 4YBTA 5I7XA 4QSWA 1CHCA 2CSZA 4WZ0A 3DAIA 3QZSA 5FE3A 2DWWA 2DATA 2LN0A 4MVTA 2LXPC 5E74A 1JM7A 2FUIA 3MHSA 5FE8A 2L80A 4X2IA 4C67A 4W4UA 4AVXA 4FO9A 2F6NA 4LRGA 4CURA 5EPBA 3EB6A 5DKHA 3K2JA 2QICA 5DKAA 3U5NA 5KO4A 5A83A 3NG2A 5KH9A 2RO1A 5LKZA 2KGIA 4PY6A 5DLZA 4Z1SA 4GNDA 1VD4A 5CP5A 4QSTA 1XWHA 5LUUA 4CFLA 2MNZA 2M6MA 5LJ1A 2KWJA 3U5MA 4LZRA 5CUDA 4NR6A 2LGGA 3FL2A 4C66A 4FK5A 5CQ3A 5DW1A 5FH7A 2BAYA 5DBMA 4YH3A 5EWCA 5EQ1A 4YADA 5L97A 3UV5A 2CSYA 5TBNA 2VNFA 4MR6A 3MHHA 3ZPVE 4ZW1A 3LQHA 4NUDA 5EA1A 5LKXA 4A9FA 5I1QA 5ENGA 3N9NA 2D8SA 3ZNIA 4UYHA 1WEQA 2MD7B 4Z1QA 2YEKA 3KQIA 5EWDA 5FERA 4QF3A 3T6RA 5CQ6A 5HELA 2FUUA 1DVPA 2DVSA 3MB3A 5L98A 2DVQA 3C6WA 4Q0OA 5F36A 5ENJA 3LXJA 5D26A 5CQAA 3IU6A 4WZ2A 5FE6A 4YYKA 4NYVA 2E3KA 4QBMA 4NXJA 5HRVA 1VFYA 5F1LA 5A5PA 5F2PA 4WZ3B 4O77A 4GNFA 4IC3A 2RNYA 4IORA 4NQMA 4UIYA 5TCMA 1JSPB 5BT4A 2L84A 5AD2A 1N87A 2LGLA 4BBQA 5FFWA 2M85A 3N9QA 3RCWA 4IR6A 5EK9A 4TT6A 1WEMA 5TDWA 4QEWA 3ZPV1 4HXSA 5DYXA 3P1CA 4N4HA 4HXKA 4RVRA 5A5QA 4CFKA 5H85A 5ENEA 2ECWA 3N9LA 2G4AA 5II1A 5DKCA 5ENFA 1V87A 3JVKA 4QR3A 4BJXA 1Z60A 4BW3A 2KR4A 5LKUA 4J0SA 4N4FA 4UITA 2NAAA 5CRZA 4LADB 5KTXA 5CU8A 3PUQA 3MXFA 4UIZA 3T7LA 4NRCA 4TZ2A 4A9MA 4WHWA 5FE1A 5L8UA 3ONIA 3C5KA 5TRBA 2RFJA 5FB1A 4IOQA 2ECTA 2KIZA 4J3IA 2MT5A 4CUSA 4QZSA 2RNXA 5C8GA 4V3KC 3GG3A 4YYJA 4MR3A 5ENCA 5C7NA 2VPEA 5FB0A 5TABA 5A81A 5B78A 5II2A 3RTRB 4QSRA 5F3AA 5FE9A 5KH7A 5HM0A 4AYCA 2KWNA 5FE5A 4KCXA 5DLXA 5LVQA 4QC1A 5D1KB 4BW4A 2ECIA 2JMDA 2MD8C 1Z6UA 3Q2EA 4PKLA 3UVDA 2EA6A 3ZTGA 3SHBA 4ZUXU 4A9LA 3MUKA 5AIUA 5ETDA 1MM3A 2VJFB 4YYNA 5L99A 2DKWA 2QIZA 4N4IA 4LR6A 4HXNA 2MJVB 4NUCA 2FSAA 4NUEA 5CQ4A 4Z93A 5I88A 3IHPA 5C4QA 5F60A 4L58A 4LYSA 4YAXA 1IYMA 4QEVA 4QSUA 2H0DB 5AD3A 3UV2A 5E0RA 2VPBA 2MA5A 5CUBA 4QSVA 4UIXA 5CUAA 5I40A 2VJEA 4GPJA 5F1HA 4YYDA 5HRXA 5JI8A 5FE7A 5TB6A 5EWVA 5IGKA 3U5JA 2WP2A 4QNSA 3M99A 4P5OB 4LJNA 3UVWA 5FFYA 1WEVA 5KTUA 5CUCA 5EGUA 2OSSA 1X0JA 3Q2FA 4HBYA 4A9IA 5E9VA 5LVRA 5D1LB 2I7KA 2YYNA 2XB1A 2K1JA 4OGJA 2DVRA 2H60A 2CT2A 2LRIC 2M3HA 4MSXA 3QZTA 4QYLA 4NR4A 4ALGA 5I86A 2YEMA 4QSQA 5C13A 4TQNA 4IR4A 4QR5A 4XY9A 2WP1A 5IGNA 2H0DA 4QSPA 2VJFA 2Y1NA 4MENA 4ZDTA 4R8PK 5CGPA 4XYAA 5EPRA 2Y1MA 5DKDA 5G4RA 4A9JA 4MEPA 2YURA 2K4DA 3O7AA 5D3JA 5EI4A 4CUPA 2L0BA 2I50A 1WESA 4XUBA 3LRQA 5D0CA 2NXBA 3S92A 5I89A 5KHMA 2LXHC 2MUMA 3S91A 4LYWA 5A5OA 2ECVA 2YUCA 3NXBA 4O7BA 2GRCA 2YELA 5EV9A 2CKLA 1G25A 2D82A 4O74A 3UVYA 4HBWA 5IIDA 1LDKC 3O35A 2ECNA 4V3LC 2YHNA 5BT5A 4PPEA 5CUEA 2LGKA 5I80A 5DFCA 5E7DA 4ZC9A 4HBXA 2K16A 4B86C 4A9HA 5B79A 5DY7A 5IGMA 1E6IA 2ECGA 4A9OA 5G4SA 3SVGA 4UIVA 5HRWA 5L8TA 2MNYA 3DPLR 4LDFA 5BT3A 5AMFA 2R0SA 5FFVA 1F62A 5HQ5A 5E9KA 4NYWA 2G43A 4MEQA 4O7FA 5A85A 1WEPA 4ALHA 5B75A 5ENIA 5IG6A 4OUFA 2KREA 4R7EA 5CQTA 4LC2A 4TYLA 5FE2A 3M62A 4IR5A 4CUQA 5JWMA 1FP0A 4NR8A 4LZ2A 1WEUA 4BW1A 3MQMA 5FG5A 2C2VS 5E3GA 2MA6A 4UI9B 4QY4A 2YU4A 3O33A 5CQ5A 2KWKA 3ZVYA 4A49A 5D3RA 5A5RA 5H1VA 3SVHA 3P1DA 5A7CA 4WHUA 4TU6A 2XEUA 5ETBA 5J0DA 4E96A 3N9PA 5I29A 5F62A 2KFTA 3KNVA 5CZGA 3V43A 4CL9A 4S3OC 3U5KA 2L75A 4NRBA 4UYEA 2YT5A 4YY4A 2RNWA 5CPEA 3L1ZB 3SOWA 3LQJA 1EQFA 4UYFA 4ZQLA 5HQ6A 1HYJA 4YYHA 3RPGC 3I2DA 3HMEA 1K2FA 2L5EA 3N9OA 5LJ0A 1X4IA 4N3WA 4MR5A 4QB3A 3G0JA 3GV4A 3ZYUA 2KTBB 1WUMA 1U6GB 5DYUA 4WIVA 2JMJA 3HCSA 4O72A 1WE9A 2EGPA 2E7OA 2OUOA 1WGMA 4YK0A 2ZETC 4TU4A 5AMEA 4FLPA 5F25A 4FJCA 4MR4A 4PTBA 2L5UA 5ENHA 1ZBDB 3PURA 2PNXA 5FBXA 5E9LA 5FG6A 5DX4A 5I7YA 2YSMA 4XUAA 4LK9A 2LSPB 2I8NA 1FBVA 4IC2A 3SOXA 5HFQA 4N4GA 3ZYQA 2F42A 3MULA 1ZS5A 4NRAA 4MEOA 5DINA 4CUTA 4YYIA 4Q6FA 5LKTA 5EICA 3LQIA 4NS5A 2YQDA 1JOCA 5FG4A 2KU3A 5LCWB 4QSXA 3P5OA 5D3LA 4LYIA 2G6QA 2KGGA 5G05B 1T1HA 4KV4A 4O71A 4Z6IA 1WIMA 4O75A 4UP5A 5ACYA 5CFWA 3LJWA 5CY9A 4B7YC 5D3HA 3KV5A 3JVJA 3I3JA 1WEWA 4YC9A 5KH3A 3HMHA 4C9ZA 5CQ8A 4NN2A 5C85A 4O78A 3L1XA 2R0YA 4A9EA 4TKPB 4AYCB 4XY8A 4UIUA 3PHDA 2D9EA 4OGIA 2YSJA 5JG6A 4PCEA 4HXRA 5EWHA 5LJ2A 5G0FA 3HMFA 4NR9A 4F52B 4GNEA 5EYAF 4O76A 4HXLA 5D3TA 4Z6HA 2C2LA 2YW5A 5EWWA 4QEUA 5KU3A 4CLBA 4YATA 4I7CA 5EP7A 2E6RA 4TT2A 4O7AA 4YBMA 5HCLA 5HLSA 2N9GA 4QSSA 3O36A 3UVXA 4A4BA 5AITA 2MIQA 1F68A 3QZVA
chains in the Genus database with same CATH superfamily
5COIA 2JMIA 5D3NA 5EVAA 2KE1A 3HCUA 5D7XA 3ASLA 3DWYA 5H1TA 5D3PA 4A9KA 5DYAA 4TZ8A 5EISA 1X4JA 5B76A 2L85A 2HYED 1Z2QA 5EU1A 4CUUA 4AUQB 1E4UA 4OGEA 4X3GA 4BHWA 3P1EA 4NQNA 4QR4A 5HENA 5CRMA 4A9NA 1X4UA 2VPGA 5IGLA 4XI1A 5D1MB 3VK6A 5F61A 4F3IA 4Y03A 4J0RA 5DW2A 3U5OA 5K29A 5EPSA 3P1FA 2VPDA 4FIPA 1WEEA 2LQ6A 4LKAA 3RPGB 2F6JA 2RSDA 2E6SA 2YDWA 2RS9B 4HXPA 4A0CD 1HYIA 5I83A 5FE0A 2L43A 3N9MA 5HFRA 2LV9A 1WUGA 4YH4A 3U5PA 4TS8A 5HQ7A 1WENA 3DQVR 4S3OB 4KV1A 4NR5A 3O70A 5E9IA 5TDRA 5E9YA 4A4CA 5CUGA 3MB4A 1WEOA 5H9MA 3UV4A 4UYFB 5CTLA 4H9DA 2E7NA 4J1PA 4QC3A 4DONA 4PCIA 4R8PK 2Y43A 2KYUA 4WA6A 5L96A 1N72A 4NYXA 5DFDA 2VJEB 4UIWA 2XOYA 3TLPA 4I7BA 5CS8A 4NR7A 5G04B 2LAUA 2OXQC 1VYXA 4O64A 5DFBA 1WFKA 2YW8A 2G45A 4HXOA 4AKNA 2DX8A 5F63A 3G0LA 5HEMA 2DJAA 4Q0NA 4LZSA 2CKLB 5FEYA 5F5ZA 5A5SA 3GL6A 5CQ7A 2LDRA 3VKHA 4YYMA 5C87A 1RMDA 4TTEA 5A82A 4O7CA 5D3SA 4O70A 4YBSA 4YYGA 2EODA 2HDPA 3HCTA 4L7XA 2JRJA 4CCGX 5HJCA 4LLBA 5I3LA 5FH6A 3HTKC 4CA1A 4R2YA 2YHOA 2AN6A 4IR3A 3FKMX 5J3XA 5FH8A 2LGVA 2RI7A 3JVMA 5H1UA 2PUYA 1JM4B 3AQAA 3KV6A 3M63A 3ZVZB 2YREA 3SOUA 1BORA 4YABA 3SVFA 3O37A 2UZGA 4UYDA 5C11A 5E9MA 2R0VA 2QJ0A 3FM8C 5FDZA 2OO1A 3IU5A 2YQLA 3EB5A 5B77A 2VP7A 4O7EA 2IQJA 4I7DA 4HXMA 1WILA 2YYRA 5B8DA 5FE4A 2M1RA 3UW9A 3L11A 5E3DA 2ECJA 4TT4A 4UP0A 5DYCA 3JVLA 1LDJB 1JM7B 4O62A 4IOOA 5KTWA 3O47A 4YY6A 2IDAA 2K17A 3FANA 2DVVA 2YQMA 3D7CA 4GB0A 4QUTA 5ENBA 4HBVA 4QF2A 1MM2A 5IBNA 5EM3A 4QUUA 2RR4A 4GNGA 3AADA 2XP0A 4BW2A 4PS5A 3U5LA 4AP4A 2R10A 5A5NA 2KWOA 4UYGA 5C89A 5D25A 4QYDA 3O34A 5E73A 5D24A 4YBTA 5I7XA 4QSWA 2XOZA 1CHCA 2CSZA 4WZ0A 3DAIA 3QZSA 5FE3A 2KKYA 2DWWA 2DATA 2LN0A 4MVTA 2LXPC 5E74A 1JM7A 2FUIA 3MHSA 5FE8A 2L80A 4X2IA 4C67A 4W4UA 4AVXA 4FO9A 2F6NA 4LRGA 4CURA 5EPBA 3EB6A 5DKHA 3K2JA 1DCQA 2QICA 5DKAA 5SVIA 3U5NA 5KO4A 5A83A 3NG2A 5KH9A 2RO1A 5LKZA 2KGIA 4PY6A 5DLZA 4Z1SA 4GNDA 1VD4A 5CP5A 4QSTA 1XWHA 5LUUA 4CFLA 2MNZA 2M6MA 5LJ1A 2KWJA 3FEHA 3U5MA 4LZRA 5CUDA 4NR6A 2LGGA 3FL2A 4C66A 4FK5A 5CQ3A 5DW1A 5FH7A 2BAYA 2FFWA 5DBMA 4YH3A 5EWCA 5EQ1A 2JM3A 4YADA 5L97A 3UV5A 2CSYA 3PLWA 5TBNA 2VNFA 4MR6A 3MHHA 3ZPVE 4ZW1A 3ERRA 3LQHA 4NUDA 5EA1A 5LKXA 5SVIB 4A9FA 5I1QA 5ENGA 3E2DA 2D8SA 3N9NA 3ZNIA 4UYHA 1WEQA 2MD7B 4Z1QA 2YEKA 3KQIA 5EWDA 5FERA 4QF3A 3T6RA 5CQ6A 5HELA 2FUUA 1DVPA 2DVSA 3MB3A 5L98A 2DVQA 2D8UA 2XOCA 3C6WA 4Q0OA 5F36A 3FAOA 5ENJA 3LXJA 5D26A 5CQAA 3IU6A 4WZ2A 5FE6A 5SVXA 3D1DA 4YYKA 4NYVA 3DWDA 2E3KA 4QBMA 4NXJA 5HRVA 1VFYA 5F1LA 5A5PA 5F2PA 4WZ3B 4O77A 4GNFA 4IC3A 2RNYA 4IORA 4NQMA 4UIYA 5TCMA 1JSPB 5BT4A 2L84A 5AD2A 1N87A 2LGLA 4BBQA 5FFWA 2M85A 3N9QA 3RCWA 4IR6A 5EK9A 4TT6A 1WEMA 5TDWA 4QEWA 3ZPV1 4HXSA 5DYXA 3P1CA 4N4HA 4HXKA 4RVRA 5A5QA 2M13A 4CFKA 5H85A 5ENEA 2ECWA 3N9LA 2G4AA 5II1A 5DKCA 5ENFA 1V87A 3JVKA 4QR3A 4BJXA 1Z60A 4BW3A 2KR4A 5LKUA 4J0SA 4N4FA 4UITA 2NAAA 5CRZA 2DSMA 4LADB 5KTXA 5CU8A 3PUQA 3MXFA 4UIZA 3T7LA 4NRCA 4TZ2A 4A9MA 4WHWA 5FE1A 5L8UA 3ONIA 3C5KA 5TRBA 2RFJA 5FB1A 4IOQA 2ECTA 2KIZA 2KKXA 4J3IA 2MT5A 4CUSA 4QZSA 2RNXA 5C8GA 4V3KC 3GG3A 4YYJA 4MR3A 5ENCA 5C7NA 2VPEA 5FB0A 5TABA 1ZKRA 5A81A 5B78A 5II2A 3RTRB 4QSRA 5F3AA 5FE9A 5KH7A 5HM0A 2P57A 4AYCA 2KWNA 2E61A 5FE5A 4KCXA 5DLXA 5LVQA 4QC1A 1MBMA 5D1KB 4BW4A 2ECIA 2JMDA 2MD8C 1Z6UA 3Q2EA 4PKLA 3UVDA 2EA6A 3ZTGA 3SHBA 4ZUXU 4A9LA 3MUKA 5AIUA 5ETDA 1MM3A 2VJFB 4YYNA 5L99A 2EGMA 2DKWA 2QIZA 4N4IA 4LR6A 4HXNA 2MJVB 4NUCA 2FSAA 4NUEA 5CQ4A 4Z93A 5I88A 3IHPA 5C4QA 5F60A 4L58A 4LYSA 4YAXA 1IYMA 2FD4A 4QEVA 4QSUA 2CRRA 5AD3A 2H0DB 3UV2A 5E0RA 2VPBA 2MA5A 5CUBA 4QSVA 4UIXA 5CUAA 5I40A 2VJEA 4GPJA 5F1HA 4YYDA 5HRXA 5JI8A 5FE7A 5TB6A 5EWVA 5IGKA 3U5JA 2WP2A 4QNSA 2OWAA 3LJUX 3M99A 4P5OB 4LJNA 3UVWA 5FFYA 1WEVA 2JUNA 5KTUA 5CUCA 5EGUA 2OSSA 1X0JA 3Q2FA 4HBYA 4A9IA 5E9VA 5LVRA 5D1LB 4Z0OA 2I7KA 2YYNA 4AKGA 2K1JA 2XB1A 4OGJA 3M7KA 2DVRA 2H60A 2CT2A 2LRIC 2M3HA 4MSXA 3QZTA 4QYLA 3LDYA 4NR4A 4ALGA 5I86A 2YEMA 4QSQA 5C13A 4TQNA 4IR4A 4QR5A 4XY9A 2WP1A 5IGNA 2CRWA 4QSPA 2H0DA 2VJFA 4MENA 2Y1NA 4ZDTA 5CGPA 4XYAA 5EPRA 2Y1MA 5DKDA 3LVRE 5G4RA 4A9JA 4MEPA 2YURA 2K4DA 3O7AA 5D3JA 5EI4A 4CUPA 2L0BA 2I50A 1WESA 4XUBA 3LRQA 3H7HA 5D0CA 2NXBA 4AI6A 3SUBA 3S92A 5I89A 5KHMA 2LXHC 2MUMA 3S91A 4LYWA 5A5OA 2ECVA 2YUCA 3NXBA 2L7PA 4O7BA 3KDEC 2GRCA 2YELA 5EV9A 2CKLA 1G25A 2D82A 4O74A 3UVYA 4HBWA 5IIDA 1LDKC 3O35A 2ECNA 4V3LC 2YHNA 5BT5A 4PPEA 5CUEA 2EXUA 2LGKA 4QQ4A 5I80A 4AKIA 5DFCA 5E7DA 4ZC9A 4HBXA 2K16A 4B86C 4A9HA 5B79A 5DY7A 5IGMA 1E6IA 2ECGA 4AKHA 4A9OA 5G4SA 3SVGA 4UIVA 5HRWA 5L8TA 2MNYA 3DPLR 4F1PA 4LDFA 5BT3A 5AMFA 2R0SA 5FFVA 1F62A 5HQ5A 5E9KA 4NYWA 2G43A 4MEQA 4O7FA 5A85A 1WEPA 4ALHA 5B75A 5ENIA 5IG6A 4OUFA 2KREA 4R7EA 5CQTA 4LC2A 4TYLA 5FE2A 3M62A 4IR5A 4CUQA 5JWMA 1FP0A 4NR8A 4LZ2A 1WEUA 4BW1A 3MQMA 5FG5A 2C2VS 5E3GA 2MA6A 4UI9B 4QY4A 2YU4A 3O33A 5CQ5A 2KWKA 3ZVYA 4A49A 5D3RA 5A5RA 5H1VA 3SVHA 3P1DA 5A7CA 4WHUA 3D1BA 4TU6A 2XEUA 5ETBA 5J0DA 4E96A 2EJNA 3N9PA 5I29A 5K3QA 5F62A 2KFTA 3KNVA 5CZGA 3V43A 4CL9A 4S3OC 3U5KA 3VKGA 2L75A 3Q1DA 4NRBA 4UYEA 2YT5A 4YY4A 2RNWA 5CPEA 3L1ZB 3SOWA 3LQJA 1EQFA 4UYFA 4ZQLA 5HQ6A 1HYJA 4YYHA 3RPGC 3I2DA 3HMEA 1K2FA 2L5EA 3N9OA 5LJ0A 1X4IA 4N3WA 4MR5A 3MDBC 5SVYA 4QB3A 3G0JA 3GV4A 3ZYUA 2KTBB 1WUMA 1U6GB 5DYUA 4WIVA 2JMJA 3HCSA 4O72A 1WE9A 2EGPA 2E7OA 2OUOA 1WGMA 4YK0A 2B0OE 2ZETC 4TU4A 4Z0RA 5AMEA 3FJUB 4FLPA 5F25A 4FJCA 4MR4A 4PTBA 2L5UA 5ENHA 1ZBDB 3PURA 2PNXA 5FBXA 5E9LA 5FG6A 5DX4A 5I7YA 2YSMA 4XUAA 4LK9A 2LSPB 2I8NA 1FBVA 4IC2A 3SOXA 5HFQA 4N4GA 3T9KA 3ZYQA 2F42A 3MULA 4OGCA 1ZS5A 4NRAA 4MEOA 5DINA 4CUTA 4YYIA 4Q6FA 5LKTA 5EICA 3LQIA 4NS5A 2YQDA 1JOCA 5FG4A 2KU3A 5LCWB 4QSXA 3P5OA 5D3LA 4LYIA 2CONA 2G6QA 2KGGA 5G05B 1T1HA 4KV4A 4O71A 4Z6IA 1WIMA 3LVQE 4O75A 4UP5A 5ACYA 5CFWA 3LJWA 5CY9A 4B7YC 5D3HA 3KV5A 3JVJA 3I3JA 1WEWA 4YC9A 5KH3A 3HMHA 4C9ZA 5CQ8A 4NN2A 5C85A 4O78A 3L1XA 2R0YA 4A9EA 4TKPB 4AYCB 4XY8A 4UIUA 3PHDA 2D9EA 4OGIA 2YSJA 5JG6A 4PCEA 3JUEA 4HXRA 5EWHA 5LJ2A 5G0FA 3HMFA 4NR9A 4F52B 4GNEA 5EYAF 4O76A 2MKEA 4HXLA 5D3TA 4Z6HA 2C2LA 2YW5A 5EWWA 2CSVA 4QEUA 5KU3A 2YVRA 3DDTA 4CLBA 4YATA 4I7CA 5EP7A 2E6RA 4TT2A 4O7AA 4YBMA 5HCLA 1PUOA 2N9GA 4QSSA 5HLSA 3O36A 3UVXA 4A4BA 5AITA 2MIQA 1F68A 3QZVA
chains in the Genus database with same CATH topology
5COIA 2JMIA 5D3NA 5EVAA 2KE1A 3HCUA 5D7XA 3ASLA 3DWYA 5H1TA 5D3PA 4A9KA 5DYAA 4TZ8A 5EISA 1X4JA 5B76A 2L85A 2HYED 1Z2QA 5EU1A 4CUUA 4AUQB 1E4UA 4X3GA 4BHWA 3P1EA 4NQNA 4QR4A 5HENA 5CRMA 4A9NA 1X4UA 2VPGA 5IGLA 4XI1A 5D1MB 3VK6A 5F61A 4F3IA 4Y03A 4J0RA 5DW2A 3U5OA 5K29A 5EPSA 3P1FA 2VPDA 4FIPA 1WEEA 2LQ6A 4LKAA 3RPGB 2F6JA 2RSDA 2E6SA 2YDWA 2RS9B 4HXPA 4A0CD 1HYIA 5I83A 5FE0A 2L43A 3N9MA 5HFRA 2LV9A 1WUGA 4YH4A 3U5PA 4TS8A 5HQ7A 1WENA 3DQVR 4S3OB 4KV1A 4NR5A 3O70A 5E9IA 5TDRA 5E9YA 4A4CA 5CUGA 3MB4A 1WEOA 5H9MA 3UV4A 4UYFB 5CTLA 2E7NA 4J1PA 4QC3A 4DONA 4PCIA 2Y43A 2KYUA 4WA6A 5L96A 1N72A 4NYXA 5DFDA 2VJEB 4UIWA 5G04B 3TLPA 4I7BA 5CS8A 4NR7A 2OXQC 1VYXA 4O64A 5DFBA 1WFKA 2YW8A 2G45A 4HXOA 4AKNA 2DX8A 5F63A 3G0LA 5HEMA 4Q0NA 4LZSA 2CKLB 5FEYA 5F5ZA 5A5SA 3GL6A 5CQ7A 2LDRA 4YYMA 5C87A 1RMDA 4TTEA 5A82A 4O7CA 5D3SA 4O70A 4YBSA 4YYGA 2EODA 2HDPA 3HCTA 4L7XA 2JRJA 4CCGX 5HJCA 4LLBA 5I3LA 5FH6A 3HTKC 4CA1A 4R2YA 2YHOA 2AN6A 4IR3A 3FKMX 5J3XA 5FH8A 2LGVA 2RI7A 3JVMA 5H1UA 2PUYA 1JM4B 3AQAA 3KV6A 3M63A 3ZVZB 2YREA 3SOUA 1BORA 4YABA 3SVFA 3O37A 2UZGA 4UYDA 5C11A 5E9MA 2R0VA 2QJ0A 5FDZA 2OO1A 3IU5A 2YQLA 3EB5A 5B77A 2VP7A 4O7EA 4I7DA 4HXMA 1WILA 2YYRA 5B8DA 5FE4A 2M1RA 3UW9A 3L11A 5E3DA 2ECJA 4TT4A 4UP0A 5DYCA 3JVLA 1LDJB 1JM7B 4IOOA 5KTWA 4YY6A 2IDAA 2K17A 2DVVA 2YQMA 3D7CA 4GB0A 4QUTA 5ENBA 4HBVA 4QF2A 1MM2A 5IBNA 5EM3A 4QUUA 4GNGA 3AADA 4BW2A 4PS5A 3U5LA 4AP4A 2R10A 5A5NA 2KWOA 4UYGA 5C89A 5D25A 4QYDA 3O34A 5E73A 5D24A 4YBTA 5I7XA 4QSWA 1CHCA 2CSZA 4WZ0A 3DAIA 3QZSA 5FE3A 2DWWA 2DATA 2LN0A 4MVTA 2LXPC 5E74A 1JM7A 2FUIA 3MHSA 5FE8A 2L80A 4X2IA 4C67A 4W4UA 4AVXA 4FO9A 2F6NA 4LRGA 4CURA 5EPBA 3EB6A 5DKHA 3K2JA 2QICA 5DKAA 3U5NA 5KO4A 5A83A 3NG2A 5KH9A 2RO1A 5LKZA 2KGIA 4PY6A 5DLZA 4Z1SA 4GNDA 1VD4A 5CP5A 4QSTA 1XWHA 5LUUA 4CFLA 2MNZA 2M6MA 5LJ1A 2KWJA 3U5MA 4LZRA 5CUDA 4NR6A 2LGGA 3FL2A 4C66A 4FK5A 5CQ3A 5DW1A 5FH7A 2BAYA 5DBMA 4YH3A 5EWCA 5EQ1A 4YADA 5L97A 3UV5A 2CSYA 5TBNA 2VNFA 4MR6A 3MHHA 3ZPVE 4ZW1A 3LQHA 4NUDA 5EA1A 5LKXA 4A9FA 5I1QA 5ENGA 3N9NA 2D8SA 3ZNIA 4UYHA 1WEQA 2MD7B 4Z1QA 2YEKA 3KQIA 5EWDA 5FERA 4QF3A 3T6RA 5CQ6A 5HELA 2FUUA 1DVPA 2DVSA 3MB3A 5L98A 2DVQA 3C6WA 4Q0OA 5F36A 5ENJA 3LXJA 5D26A 5CQAA 3IU6A 4WZ2A 5FE6A 4YYKA 4NYVA 2E3KA 4QBMA 4NXJA 5HRVA 1VFYA 5F1LA 5A5PA 5F2PA 4WZ3B 4O77A 4GNFA 4IC3A 2RNYA 4IORA 4NQMA 4UIYA 5TCMA 1JSPB 5BT4A 2L84A 5AD2A 1N87A 2LGLA 4BBQA 5FFWA 2M85A 3N9QA 3RCWA 4IR6A 5EK9A 4TT6A 1WEMA 5TDWA 4QEWA 3ZPV1 4HXSA 5DYXA 3P1CA 4N4HA 4HXKA 4RVRA 5A5QA 4CFKA 5H85A 5ENEA 2ECWA 3N9LA 2G4AA 5II1A 5DKCA 5ENFA 1V87A 3JVKA 4QR3A 4BJXA 1Z60A 4BW3A 2KR4A 5LKUA 4J0SA 4N4FA 4UITA 2NAAA 5CRZA 4LADB 5KTXA 5CU8A 3PUQA 3MXFA 4UIZA 3T7LA 4NRCA 4TZ2A 4A9MA 4WHWA 5FE1A 5L8UA 3ONIA 3C5KA 5TRBA 2RFJA 5FB1A 4IOQA 2ECTA 2KIZA 4J3IA 2MT5A 4CUSA 4QZSA 2RNXA 5C8GA 4V3KC 3GG3A 4YYJA 4MR3A 5ENCA 5C7NA 2VPEA 5FB0A 5TABA 5A81A 5B78A 5II2A 3RTRB 4QSRA 5F3AA 5FE9A 5KH7A 5HM0A 4AYCA 2KWNA 5FE5A 4KCXA 5DLXA 5LVQA 4QC1A 5D1KB 4BW4A 2ECIA 2JMDA 2MD8C 1Z6UA 3Q2EA 4PKLA 3UVDA 2EA6A 3ZTGA 3SHBA 4ZUXU 4A9LA 3MUKA 5AIUA 5ETDA 1MM3A 2VJFB 4YYNA 5L99A 2DKWA 2QIZA 4N4IA 4LR6A 4HXNA 2MJVB 4NUCA 2FSAA 4NUEA 5CQ4A 4Z93A 5I88A 3IHPA 5C4QA 5F60A 4L58A 4LYSA 4YAXA 1IYMA 4QEVA 4QSUA 2H0DB 5AD3A 3UV2A 5E0RA 2VPBA 2MA5A 5CUBA 4QSVA 4UIXA 5CUAA 5I40A 2VJEA 4GPJA 5F1HA 4YYDA 5HRXA 5JI8A 5FE7A 5TB6A 5EWVA 5IGKA 3U5JA 2WP2A 4QNSA 3M99A 4P5OB 4LJNA 3UVWA 5FFYA 1WEVA 5KTUA 5CUCA 5EGUA 2OSSA 1X0JA 3Q2FA 4HBYA 4A9IA 5E9VA 5LVRA 5D1LB 2I7KA 2YYNA 2XB1A 2K1JA 4OGJA 2DVRA 2H60A 2CT2A 2LRIC 2M3HA 4MSXA 3QZTA 4QYLA 4NR4A 4ALGA 5I86A 2YEMA 4QSQA 5C13A 4TQNA 4IR4A 4QR5A 4XY9A 2WP1A 5IGNA 2H0DA 4QSPA 2VJFA 2Y1NA 4MENA 4ZDTA 4R8PK 5CGPA 4XYAA 5EPRA 2Y1MA 5DKDA 5G4RA 4A9JA 4MEPA 2YURA 2K4DA 3O7AA 5D3JA 5EI4A 4CUPA 2L0BA 2I50A 1WESA 4XUBA 3LRQA 5D0CA 2NXBA 3S92A 5I89A 5KHMA 2LXHC 2MUMA 3S91A 4LYWA 5A5OA 2ECVA 2YUCA 3NXBA 4O7BA 2GRCA 2YELA 5EV9A 2CKLA 1G25A 2D82A 4O74A 3UVYA 4HBWA 5IIDA 1LDKC 3O35A 2ECNA 4V3LC 2YHNA 5BT5A 4PPEA 5CUEA 2LGKA 5I80A 5DFCA 5E7DA 4ZC9A 4HBXA 2K16A 4B86C 4A9HA 5B79A 5DY7A 5IGMA 1E6IA 2ECGA 4A9OA 5G4SA 3SVGA 4UIVA 5HRWA 5L8TA 2MNYA 3DPLR 4LDFA 5BT3A 5AMFA 2R0SA 5FFVA 1F62A 5HQ5A 5E9KA 4NYWA 2G43A 4MEQA 4O7FA 5A85A 1WEPA 4ALHA 5B75A 5ENIA 5IG6A 4OUFA 2KREA 4R7EA 5CQTA 4LC2A 4TYLA 5FE2A 3M62A 4IR5A 4CUQA 5JWMA 1FP0A 4NR8A 4LZ2A 1WEUA 4BW1A 3MQMA 5FG5A 2C2VS 5E3GA 2MA6A 4UI9B 4QY4A 2YU4A 3O33A 5CQ5A 2KWKA 3ZVYA 4A49A 5D3RA 5A5RA 5H1VA 3SVHA 3P1DA 5A7CA 4WHUA 4TU6A 2XEUA 5ETBA 5J0DA 4E96A 3N9PA 5I29A 5F62A 2KFTA 3KNVA 5CZGA 3V43A 4CL9A 4S3OC 3U5KA 2L75A 4NRBA 4UYEA 2YT5A 4YY4A 2RNWA 5CPEA 3L1ZB 3SOWA 3LQJA 1EQFA 4UYFA 4ZQLA 5HQ6A 1HYJA 4YYHA 3RPGC 3I2DA 3HMEA 1K2FA 2L5EA 3N9OA 5LJ0A 1X4IA 4N3WA 4MR5A 4QB3A 3G0JA 3GV4A 3ZYUA 2KTBB 1WUMA 1U6GB 5DYUA 4WIVA 2JMJA 3HCSA 4O72A 1WE9A 2EGPA 2E7OA 2OUOA 1WGMA 4YK0A 2ZETC 4TU4A 5AMEA 4FLPA 5F25A 4FJCA 4MR4A 4PTBA 2L5UA 5ENHA 1ZBDB 3PURA 2PNXA 5FBXA 5E9LA 5FG6A 5DX4A 5I7YA 2YSMA 4XUAA 4LK9A 2LSPB 2I8NA 1FBVA 4IC2A 3SOXA 5HFQA 4N4GA 3ZYQA 2F42A 3MULA 1ZS5A 4NRAA 4MEOA 5DINA 4CUTA 4YYIA 4Q6FA 5LKTA 5EICA 3LQIA 4NS5A 2YQDA 1JOCA 5FG4A 2KU3A 5LCWB 4QSXA 3P5OA 5D3LA 4LYIA 2G6QA 2KGGA 5G05B 1T1HA 4KV4A 4O71A 4Z6IA 1WIMA 4O75A 4UP5A 5ACYA 5CFWA 3LJWA 5CY9A 4B7YC 5D3HA 3KV5A 3JVJA 3I3JA 1WEWA 4YC9A 5KH3A 3HMHA 4C9ZA 5CQ8A 4NN2A 5C85A 4O78A 3L1XA 2R0YA 4A9EA 4TKPB 4AYCB 4XY8A 4UIUA 3PHDA 2D9EA 4OGIA 2YSJA 5JG6A 4PCEA 4HXRA 5EWHA 5LJ2A 5G0FA 3HMFA 4NR9A 4F52B 4GNEA 5EYAF 4O76A 4HXLA 5D3TA 4Z6HA 2C2LA 2YW5A 5EWWA 4QEUA 5KU3A 4CLBA 4YATA 4I7CA 5EP7A 2E6RA 4TT2A 4O7AA 4YBMA 5HCLA 5HLSA 2N9GA 4QSSA 3O36A 3UVXA 4A4BA 5AITA 2MIQA 1F68A 3QZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COI A;  2JMI A;  5D3N A;  5EVA A;  2KE1 A;  3HCU A;  5D7X A;  3ASL A;  3DWY A;  5H1T A;  5D3P A;  4A9K A;  5DYA A;  4TZ8 A;  5EIS A;  1X4J A;  5B76 A;  2L85 A;  2HYE D;  1Z2Q A;  5EU1 A;  4CUU A;  4AUQ B;  1E4U A;  4X3G A;  4BHW A;  3P1E A;  4NQN A;  4QR4 A;  5HEN A;  5CRM A;  4A9N A;  1X4U A;  2VPG A;  5IGL A;  4XI1 A;  5D1M B;  3VK6 A;  5F61 A;  4F3I A;  4Y03 A;  4J0R A;  5DW2 A;  3U5O A;  5K29 A;  5EPS A;  3P1F A;  2VPD A;  4FIP A;  1WEE A;  2LQ6 A;  4LKA A;  3RPG B;  2F6J A;  2RSD A;  2E6S A;  2YDW A;  2RS9 B;  4HXP A;  4A0C D;  1HYI A;  5I83 A;  5FE0 A;  2L43 A;  3N9M A;  5HFR A;  2LV9 A;  1WUG A;  4YH4 A;  3U5P A;  4TS8 A;  5HQ7 A;  1WEN A;  3DQV R;  4S3O B;  4KV1 A;  4NR5 A;  3O70 A;  5E9I A;  5TDR A;  5E9Y A;  4A4C A;  5CUG A;  3MB4 A;  1WEO A;  5H9M A;  3UV4 A;  4UYF B;  5CTL A;  2E7N A;  4J1P A;  4QC3 A;  4DON A;  4PCI A;  2Y43 A;  2KYU A;  4WA6 A;  5L96 A;  1N72 A;  4NYX A;  5DFD A;  2VJE B;  4UIW A;  5G04 B;  3TLP A;  4I7B A;  5CS8 A;  4NR7 A;  2OXQ C;  1VYX A;  4O64 A;  5DFB A;  1WFK A;  2YW8 A;  2G45 A;  4HXO A;  4AKN A;  2DX8 A;  5F63 A;  3G0L A;  5HEM A;  4Q0N A;  4LZS A;  2CKL B;  5FEY A;  5F5Z A;  5A5S A;  3GL6 A;  5CQ7 A;  2LDR A;  4YYM A;  5C87 A;  1RMD A;  4TTE A;  5A82 A;  4O7C A;  5D3S A;  4O70 A;  4YBS A;  4YYG A;  2EOD A;  2HDP A;  3HCT A;  4L7X A;  2JRJ A;  4CCG X;  5HJC A;  4LLB A;  5I3L A;  5FH6 A;  3HTK C;  4CA1 A;  4R2Y A;  2YHO A;  2AN6 A;  4IR3 A;  3FKM X;  5J3X A;  5FH8 A;  2LGV A;  2RI7 A;  3JVM A;  5H1U A;  2PUY A;  1JM4 B;  3AQA A;  3KV6 A;  3M63 A;  3ZVZ B;  2YRE A;  3SOU A;  1BOR A;  4YAB A;  3SVF A;  3O37 A;  2UZG A;  4UYD A;  5C11 A;  5E9M A;  2R0V A;  2QJ0 A;  5FDZ A;  2OO1 A;  3IU5 A;  2YQL A;  3EB5 A;  5B77 A;  2VP7 A;  4O7E A;  4I7D A;  4HXM A;  1WIL A;  2YYR A;  5B8D A;  5FE4 A;  2M1R A;  3UW9 A;  3L11 A;  5E3D A;  2ECJ A;  4TT4 A;  4UP0 A;  5DYC A;  3JVL A;  1LDJ B;  1JM7 B;  4IOO A;  5KTW A;  4YY6 A;  2IDA A;  2K17 A;  2DVV A;  2YQM A;  3D7C A;  4GB0 A;  4QUT A;  5ENB A;  4HBV A;  4QF2 A;  1MM2 A;  5IBN A;  5EM3 A;  4QUU A;  4GNG A;  3AAD A;  4BW2 A;  4PS5 A;  3U5L A;  4AP4 A;  2R10 A;  5A5N A;  2KWO A;  4UYG A;  5C89 A;  5D25 A;  4QYD A;  3O34 A;  5E73 A;  5D24 A;  4YBT A;  5I7X A;  4QSW A;  1CHC A;  2CSZ A;  4WZ0 A;  3DAI A;  3QZS A;  5FE3 A;  2DWW A;  2DAT A;  2LN0 A;  4MVT A;  2LXP C;  5E74 A;  1JM7 A;  2FUI A;  3MHS A;  5FE8 A;  2L80 A;  4X2I A;  4C67 A;  4W4U A;  4AVX A;  4FO9 A;  2F6N A;  4LRG A;  4CUR A;  5EPB A;  3EB6 A;  5DKH A;  3K2J A;  2QIC A;  5DKA A;  3U5N A;  5KO4 A;  5A83 A;  3NG2 A;  5KH9 A;  2RO1 A;  5LKZ A;  2KGI A;  4PY6 A;  5DLZ A;  4Z1S A;  4GND A;  1VD4 A;  5CP5 A;  4QST A;  1XWH A;  5LUU A;  4CFL A;  2MNZ A;  2M6M A;  5LJ1 A;  2KWJ A;  3U5M A;  4LZR A;  5CUD A;  4NR6 A;  2LGG A;  3FL2 A;  4C66 A;  4FK5 A;  5CQ3 A;  5DW1 A;  5FH7 A;  2BAY A;  5DBM A;  4YH3 A;  5EWC A;  5EQ1 A;  4YAD A;  5L97 A;  3UV5 A;  2CSY A;  5TBN A;  2VNF A;  4MR6 A;  3MHH A;  3ZPV E;  4ZW1 A;  3LQH A;  4NUD A;  5EA1 A;  5LKX A;  4A9F A;  5I1Q A;  5ENG A;  3N9N A;  2D8S A;  3ZNI A;  4UYH A;  1WEQ A;  2MD7 B;  4Z1Q A;  2YEK A;  3KQI A;  5EWD A;  5FER A;  4QF3 A;  3T6R A;  5CQ6 A;  5HEL A;  2FUU A;  1DVP A;  2DVS A;  3MB3 A;  5L98 A;  2DVQ A;  3C6W A;  4Q0O A;  5F36 A;  5ENJ A;  3LXJ A;  5D26 A;  5CQA A;  3IU6 A;  4WZ2 A;  5FE6 A;  4YYK A;  4NYV A;  2E3K A;  4QBM A;  4NXJ A;  5HRV A;  1VFY A;  5F1L A;  5A5P A;  5F2P A;  4WZ3 B;  4O77 A;  4GNF A;  4IC3 A;  2RNY A;  4IOR A;  4NQM A;  4UIY A;  5TCM A;  1JSP B;  5BT4 A;  2L84 A;  5AD2 A;  1N87 A;  2LGL A;  4BBQ A;  5FFW A;  2M85 A;  3N9Q A;  3RCW A;  4IR6 A;  5EK9 A;  4TT6 A;  1WEM A;  5TDW A;  4QEW A;  3ZPV 1;  4HXS A;  5DYX A;  3P1C A;  4N4H A;  4HXK A;  4RVR A;  5A5Q A;  4CFK A;  5H85 A;  5ENE A;  2ECW A;  3N9L A;  2G4A A;  5II1 A;  5DKC A;  5ENF A;  1V87 A;  3JVK A;  4QR3 A;  4BJX A;  1Z60 A;  4BW3 A;  2KR4 A;  5LKU A;  4J0S A;  4N4F A;  4UIT A;  2NAA A;  5CRZ A;  4LAD B;  5KTX A;  5CU8 A;  3PUQ A;  3MXF A;  4UIZ A;  3T7L A;  4NRC A;  4TZ2 A;  4A9M A;  4WHW A;  5FE1 A;  5L8U A;  3ONI A;  3C5K A;  5TRB A;  2RFJ A;  5FB1 A;  4IOQ A;  2ECT A;  2KIZ A;  4J3I A;  2MT5 A;  4CUS A;  4QZS A;  2RNX A;  5C8G A;  4V3K C;  3GG3 A;  4YYJ A;  4MR3 A;  5ENC A;  5C7N A;  2VPE A;  5FB0 A;  5TAB A;  5A81 A;  5B78 A;  5II2 A;  3RTR B;  4QSR A;  5F3A A;  5FE9 A;  5KH7 A;  5HM0 A;  4AYC A;  2KWN A;  5FE5 A;  4KCX A;  5DLX A;  5LVQ A;  4QC1 A;  5D1K B;  4BW4 A;  2ECI A;  2JMD A;  2MD8 C;  1Z6U A;  3Q2E A;  4PKL A;  3UVD A;  2EA6 A;  3ZTG A;  3SHB A;  4ZUX U;  4A9L A;  3MUK A;  5AIU A;  5ETD A;  1MM3 A;  2VJF B;  4YYN A;  5L99 A;  2DKW A;  2QIZ A;  4N4I A;  4LR6 A;  4HXN A;  2MJV B;  4NUC A;  2FSA A;  4NUE A;  5CQ4 A;  4Z93 A;  5I88 A;  3IHP A;  5C4Q A;  5F60 A;  4L58 A;  4LYS A;  4YAX A;  1IYM A;  4QEV A;  4QSU A;  2H0D B;  5AD3 A;  3UV2 A;  5E0R A;  2VPB A;  2MA5 A;  5CUB A;  4QSV A;  4UIX A;  5CUA A;  5I40 A;  2VJE A;  4GPJ A;  5F1H A;  4YYD A;  5HRX A;  5JI8 A;  5FE7 A;  5TB6 A;  5EWV A;  5IGK A;  3U5J A;  2WP2 A;  4QNS A;  3M99 A;  4P5O B;  4LJN A;  3UVW A;  5FFY A;  1WEV A;  5KTU A;  5CUC A;  5EGU A;  2OSS A;  1X0J A;  3Q2F A;  4HBY A;  4A9I A;  5E9V A;  5LVR A;  5D1L B;  2I7K A;  2YYN A;  2XB1 A;  2K1J A;  4OGJ A;  2DVR A;  2H60 A;  2CT2 A;  2LRI C;  2M3H A;  4MSX A;  3QZT A;  4QYL A;  4NR4 A;  4ALG A;  5I86 A;  2YEM A;  4QSQ A;  5C13 A;  4TQN A;  4IR4 A;  4QR5 A;  4XY9 A;  2WP1 A;  5IGN A;  2H0D A;  4QSP A;  2VJF A;  2Y1N A;  4MEN A;  4ZDT A;  4R8P K;  5CGP A;  4XYA A;  5EPR A;  2Y1M A;  5DKD A;  5G4R A;  4A9J A;  4MEP A;  2YUR A;  2K4D A;  3O7A A;  5D3J A;  5EI4 A;  4CUP A;  2L0B A;  2I50 A;  1WES A;  4XUB A;  3LRQ A;  5D0C A;  2NXB A;  3S92 A;  5I89 A;  5KHM A;  2LXH C;  2MUM A;  3S91 A;  4LYW A;  5A5O A;  2ECV A;  2YUC A;  3NXB A;  4O7B A;  2GRC A;  2YEL A;  5EV9 A;  2CKL A;  1G25 A;  2D82 A;  4O74 A;  3UVY A;  4HBW A;  5IID A;  1LDK C;  3O35 A;  2ECN A;  4V3L C;  2YHN A;  5BT5 A;  4PPE A;  5CUE A;  2LGK A;  5I80 A;  5DFC A;  5E7D A;  4ZC9 A;  4HBX A;  2K16 A;  4B86 C;  4A9H A;  5B79 A;  5DY7 A;  5IGM A;  1E6I A;  2ECG A;  4A9O A;  5G4S A;  3SVG A;  4UIV A;  5HRW A;  5L8T A;  2MNY A;  3DPL R;  4LDF A;  5BT3 A;  5AMF A;  2R0S A;  5FFV A;  1F62 A;  5HQ5 A;  5E9K A;  4NYW A;  2G43 A;  4MEQ A;  4O7F A;  5A85 A;  1WEP A;  4ALH A;  5B75 A;  5ENI A;  5IG6 A;  4OUF A;  2KRE A;  4R7E A;  5CQT A;  4LC2 A;  4TYL A;  5FE2 A;  3M62 A;  4IR5 A;  4CUQ A;  5JWM A;  1FP0 A;  4NR8 A;  4LZ2 A;  1WEU A;  4BW1 A;  3MQM A;  5FG5 A;  2C2V S;  5E3G A;  2MA6 A;  4UI9 B;  4QY4 A;  2YU4 A;  3O33 A;  5CQ5 A;  2KWK A;  3ZVY A;  4A49 A;  5D3R A;  5A5R A;  5H1V A;  3SVH A;  3P1D A;  5A7C A;  4WHU A;  4TU6 A;  2XEU A;  5ETB A;  5J0D A;  4E96 A;  3N9P A;  5I29 A;  5F62 A;  2KFT A;  3KNV A;  5CZG A;  3V43 A;  4CL9 A;  4S3O C;  3U5K A;  2L75 A;  4NRB A;  4UYE A;  2YT5 A;  4YY4 A;  2RNW A;  5CPE A;  3L1Z B;  3SOW A;  3LQJ A;  1EQF A;  4UYF A;  4ZQL A;  5HQ6 A;  1HYJ A;  4YYH A;  3RPG C;  3I2D A;  3HME A;  1K2F A;  2L5E A;  3N9O A;  5LJ0 A;  1X4I A;  4N3W A;  4MR5 A;  4QB3 A;  3G0J A;  3GV4 A;  3ZYU A;  2KTB B;  1WUM A;  1U6G B;  5DYU A;  4WIV A;  2JMJ A;  3HCS A;  4O72 A;  1WE9 A;  2EGP A;  2E7O A;  2OUO A;  1WGM A;  4YK0 A;  2ZET C;  4TU4 A;  5AME A;  4FLP A;  5F25 A;  4FJC A;  4MR4 A;  4PTB A;  2L5U A;  5ENH A;  1ZBD B;  3PUR A;  2PNX A;  5FBX A;  5E9L A;  5FG6 A;  5DX4 A;  5I7Y A;  2YSM A;  4XUA A;  4LK9 A;  2LSP B;  2I8N A;  1FBV A;  4IC2 A;  3SOX A;  5HFQ A;  4N4G A;  3ZYQ A;  2F42 A;  3MUL A;  1ZS5 A;  4NRA A;  4MEO A;  5DIN A;  4CUT A;  4YYI A;  4Q6F A;  5LKT A;  5EIC A;  3LQI A;  4NS5 A;  2YQD A;  1JOC A;  5FG4 A;  2KU3 A;  5LCW B;  4QSX A;  3P5O A;  5D3L A;  4LYI A;  2G6Q A;  2KGG A;  5G05 B;  1T1H A;  4KV4 A;  4O71 A;  4Z6I A;  1WIM A;  4O75 A;  4UP5 A;  5ACY A;  5CFW A;  3LJW A;  5CY9 A;  4B7Y C;  5D3H A;  3KV5 A;  3JVJ A;  3I3J A;  1WEW A;  4YC9 A;  5KH3 A;  3HMH A;  4C9Z A;  5CQ8 A;  4NN2 A;  5C85 A;  4O78 A;  3L1X A;  2R0Y A;  4A9E A;  4TKP B;  4AYC B;  4XY8 A;  4UIU A;  3PHD A;  2D9E A;  4OGI A;  2YSJ A;  5JG6 A;  4PCE A;  4HXR A;  5EWH A;  5LJ2 A;  5G0F A;  3HMF A;  4NR9 A;  4F52 B;  4GNE A;  5EYA F;  4O76 A;  4HXL A;  5D3T A;  4Z6H A;  2C2L A;  2YW5 A;  5EWW A;  4QEU A;  5KU3 A;  4CLB A;  4YAT A;  4I7C A;  5EP7 A;  2E6R A;  4TT2 A;  4O7A A;  4YBM A;  5HCL A;  5HLS A;  2N9G A;  4QSS A;  3O36 A;  3UVX A;  4A4B A;  5AIT A;  2MIQ A;  1F68 A;  3QZV A; 
#chains in the Genus database with same CATH topology
 5COI A;  2JMI A;  5D3N A;  5EVA A;  2KE1 A;  3HCU A;  5D7X A;  3ASL A;  3DWY A;  5H1T A;  5D3P A;  4A9K A;  5DYA A;  4TZ8 A;  5EIS A;  1X4J A;  5B76 A;  2L85 A;  2HYE D;  1Z2Q A;  5EU1 A;  4CUU A;  4AUQ B;  1E4U A;  4OGE A;  4X3G A;  4BHW A;  3P1E A;  4NQN A;  4QR4 A;  5HEN A;  5CRM A;  4A9N A;  1X4U A;  2VPG A;  5IGL A;  4XI1 A;  5D1M B;  3VK6 A;  5F61 A;  4F3I A;  4Y03 A;  4J0R A;  5DW2 A;  3U5O A;  5K29 A;  5EPS A;  3P1F A;  2VPD A;  4FIP A;  1WEE A;  2LQ6 A;  4LKA A;  3RPG B;  2F6J A;  2RSD A;  2E6S A;  2YDW A;  2RS9 B;  4HXP A;  4A0C D;  1HYI A;  5I83 A;  5FE0 A;  2L43 A;  3N9M A;  5HFR A;  2LV9 A;  1WUG A;  4YH4 A;  3U5P A;  4TS8 A;  5HQ7 A;  1WEN A;  3DQV R;  4S3O B;  4KV1 A;  4NR5 A;  3O70 A;  5E9I A;  5TDR A;  5E9Y A;  4A4C A;  5CUG A;  3MB4 A;  1WEO A;  5H9M A;  3UV4 A;  4UYF B;  5CTL A;  4H9D A;  2E7N A;  4J1P A;  4QC3 A;  4DON A;  4PCI A;  4R8P K;  2Y43 A;  2KYU A;  4WA6 A;  5L96 A;  1N72 A;  4NYX A;  5DFD A;  2VJE B;  4UIW A;  2XOY A;  3TLP A;  4I7B A;  5CS8 A;  4NR7 A;  5G04 B;  2LAU A;  2OXQ C;  1VYX A;  4O64 A;  5DFB A;  1WFK A;  2YW8 A;  2G45 A;  4HXO A;  4AKN A;  2DX8 A;  5F63 A;  3G0L A;  5HEM A;  2DJA A;  4Q0N A;  4LZS A;  2CKL B;  5FEY A;  5F5Z A;  5A5S A;  3GL6 A;  5CQ7 A;  2LDR A;  3VKH A;  4YYM A;  5C87 A;  1RMD A;  4TTE A;  5A82 A;  4O7C A;  5D3S A;  4O70 A;  4YBS A;  4YYG A;  2EOD A;  2HDP A;  3HCT A;  4L7X A;  2JRJ A;  4CCG X;  5HJC A;  4LLB A;  5I3L A;  5FH6 A;  3HTK C;  4CA1 A;  4R2Y A;  2YHO A;  2AN6 A;  4IR3 A;  3FKM X;  5J3X A;  5FH8 A;  2LGV A;  2RI7 A;  3JVM A;  5H1U A;  2PUY A;  1JM4 B;  3AQA A;  3KV6 A;  3M63 A;  3ZVZ B;  2YRE A;  3SOU A;  1BOR A;  4YAB A;  3SVF A;  3O37 A;  2UZG A;  4UYD A;  5C11 A;  5E9M A;  2R0V A;  2QJ0 A;  3FM8 C;  5FDZ A;  2OO1 A;  3IU5 A;  2YQL A;  3EB5 A;  5B77 A;  2VP7 A;  4O7E A;  2IQJ A;  4I7D A;  4HXM A;  1WIL A;  2YYR A;  5B8D A;  5FE4 A;  2M1R A;  3UW9 A;  3L11 A;  5E3D A;  2ECJ A;  4TT4 A;  4UP0 A;  5DYC A;  3JVL A;  1LDJ B;  1JM7 B;  4O62 A;  4IOO A;  5KTW A;  3O47 A;  4YY6 A;  2IDA A;  2K17 A;  3FAN A;  2DVV A;  2YQM A;  3D7C A;  4GB0 A;  4QUT A;  5ENB A;  4HBV A;  4QF2 A;  1MM2 A;  5IBN A;  5EM3 A;  4QUU A;  2RR4 A;  4GNG A;  3AAD A;  2XP0 A;  4BW2 A;  4PS5 A;  3U5L A;  4AP4 A;  2R10 A;  5A5N A;  2KWO A;  4UYG A;  5C89 A;  5D25 A;  4QYD A;  3O34 A;  5E73 A;  5D24 A;  4YBT A;  5I7X A;  4QSW A;  2XOZ A;  1CHC A;  2CSZ A;  4WZ0 A;  3DAI A;  3QZS A;  5FE3 A;  2KKY A;  2DWW A;  2DAT A;  2LN0 A;  4MVT A;  2LXP C;  5E74 A;  1JM7 A;  2FUI A;  3MHS A;  5FE8 A;  2L80 A;  4X2I A;  4C67 A;  4W4U A;  4AVX A;  4FO9 A;  2F6N A;  4LRG A;  4CUR A;  5EPB A;  3EB6 A;  5DKH A;  3K2J A;  1DCQ A;  2QIC A;  5DKA A;  5SVI A;  3U5N A;  5KO4 A;  5A83 A;  3NG2 A;  5KH9 A;  2RO1 A;  5LKZ A;  2KGI A;  4PY6 A;  5DLZ A;  4Z1S A;  4GND A;  1VD4 A;  5CP5 A;  4QST A;  1XWH A;  5LUU A;  4CFL A;  2MNZ A;  2M6M A;  5LJ1 A;  2KWJ A;  3FEH A;  3U5M A;  4LZR A;  5CUD A;  4NR6 A;  2LGG A;  3FL2 A;  4C66 A;  4FK5 A;  5CQ3 A;  5DW1 A;  5FH7 A;  2BAY A;  2FFW A;  5DBM A;  4YH3 A;  5EWC A;  5EQ1 A;  2JM3 A;  4YAD A;  5L97 A;  3UV5 A;  2CSY A;  3PLW A;  5TBN A;  2VNF A;  4MR6 A;  3MHH A;  3ZPV E;  4ZW1 A;  3ERR A;  3LQH A;  4NUD A;  5EA1 A;  5LKX A;  5SVI B;  4A9F A;  5I1Q A;  5ENG A;  3E2D A;  2D8S A;  3N9N A;  3ZNI A;  4UYH A;  1WEQ A;  2MD7 B;  4Z1Q A;  2YEK A;  3KQI A;  5EWD A;  5FER A;  4QF3 A;  3T6R A;  5CQ6 A;  5HEL A;  2FUU A;  1DVP A;  2DVS A;  3MB3 A;  5L98 A;  2DVQ A;  2D8U A;  2XOC A;  3C6W A;  4Q0O A;  5F36 A;  3FAO A;  5ENJ A;  3LXJ A;  5D26 A;  5CQA A;  3IU6 A;  4WZ2 A;  5FE6 A;  5SVX A;  3D1D A;  4YYK A;  4NYV A;  3DWD A;  2E3K A;  4QBM A;  4NXJ A;  5HRV A;  1VFY A;  5F1L A;  5A5P A;  5F2P A;  4WZ3 B;  4O77 A;  4GNF A;  4IC3 A;  2RNY A;  4IOR A;  4NQM A;  4UIY A;  5TCM A;  1JSP B;  5BT4 A;  2L84 A;  5AD2 A;  1N87 A;  2LGL A;  4BBQ A;  5FFW A;  2M85 A;  3N9Q A;  3RCW A;  4IR6 A;  5EK9 A;  4TT6 A;  1WEM A;  5TDW A;  4QEW A;  3ZPV 1;  4HXS A;  5DYX A;  3P1C A;  4N4H A;  4HXK A;  4RVR A;  5A5Q A;  2M13 A;  4CFK A;  5H85 A;  5ENE A;  2ECW A;  3N9L A;  2G4A A;  5II1 A;  5DKC A;  5ENF A;  1V87 A;  3JVK A;  4QR3 A;  4BJX A;  1Z60 A;  4BW3 A;  2KR4 A;  5LKU A;  4J0S A;  4N4F A;  4UIT A;  2NAA A;  5CRZ A;  2DSM A;  4LAD B;  5KTX A;  5CU8 A;  3PUQ A;  3MXF A;  4UIZ A;  3T7L A;  4NRC A;  4TZ2 A;  4A9M A;  4WHW A;  5FE1 A;  5L8U A;  3ONI A;  3C5K A;  5TRB A;  2RFJ A;  5FB1 A;  4IOQ A;  2ECT A;  2KIZ A;  2KKX A;  4J3I A;  2MT5 A;  4CUS A;  4QZS A;  2RNX A;  5C8G A;  4V3K C;  3GG3 A;  4YYJ A;  4MR3 A;  5ENC A;  5C7N A;  2VPE A;  5FB0 A;  5TAB A;  1ZKR A;  5A81 A;  5B78 A;  5II2 A;  3RTR B;  4QSR A;  5F3A A;  5FE9 A;  5KH7 A;  5HM0 A;  2P57 A;  4AYC A;  2KWN A;  2E61 A;  5FE5 A;  4KCX A;  5DLX A;  5LVQ A;  4QC1 A;  1MBM A;  5D1K B;  4BW4 A;  2ECI A;  2JMD A;  2MD8 C;  1Z6U A;  3Q2E A;  4PKL A;  3UVD A;  2EA6 A;  3ZTG A;  3SHB A;  4ZUX U;  4A9L A;  3MUK A;  5AIU A;  5ETD A;  1MM3 A;  2VJF B;  4YYN A;  5L99 A;  2EGM A;  2DKW A;  2QIZ A;  4N4I A;  4LR6 A;  4HXN A;  2MJV B;  4NUC A;  2FSA A;  4NUE A;  5CQ4 A;  4Z93 A;  5I88 A;  3IHP A;  5C4Q A;  5F60 A;  4L58 A;  4LYS A;  4YAX A;  1IYM A;  2FD4 A;  4QEV A;  4QSU A;  2CRR A;  5AD3 A;  2H0D B;  3UV2 A;  5E0R A;  2VPB A;  2MA5 A;  5CUB A;  4QSV A;  4UIX A;  5CUA A;  5I40 A;  2VJE A;  4GPJ A;  5F1H A;  4YYD A;  5HRX A;  5JI8 A;  5FE7 A;  5TB6 A;  5EWV A;  5IGK A;  3U5J A;  2WP2 A;  4QNS A;  2OWA A;  3LJU X;  3M99 A;  4P5O B;  4LJN A;  3UVW A;  5FFY A;  1WEV A;  2JUN A;  5KTU A;  5CUC A;  5EGU A;  2OSS A;  1X0J A;  3Q2F A;  4HBY A;  4A9I A;  5E9V A;  5LVR A;  5D1L B;  4Z0O A;  2I7K A;  2YYN A;  4AKG A;  2K1J A;  2XB1 A;  4OGJ A;  3M7K A;  2DVR A;  2H60 A;  2CT2 A;  2LRI C;  2M3H A;  4MSX A;  3QZT A;  4QYL A;  3LDY A;  4NR4 A;  4ALG A;  5I86 A;  2YEM A;  4QSQ A;  5C13 A;  4TQN A;  4IR4 A;  4QR5 A;  4XY9 A;  2WP1 A;  5IGN A;  2CRW A;  4QSP A;  2H0D A;  2VJF A;  4MEN A;  2Y1N A;  4ZDT A;  5CGP A;  4XYA A;  5EPR A;  2Y1M A;  5DKD A;  3LVR E;  5G4R A;  4A9J A;  4MEP A;  2YUR A;  2K4D A;  3O7A A;  5D3J A;  5EI4 A;  4CUP A;  2L0B A;  2I50 A;  1WES A;  4XUB A;  3LRQ A;  3H7H A;  5D0C A;  2NXB A;  4AI6 A;  3SUB A;  3S92 A;  5I89 A;  5KHM A;  2LXH C;  2MUM A;  3S91 A;  4LYW A;  5A5O A;  2ECV A;  2YUC A;  3NXB A;  2L7P A;  4O7B A;  3KDE C;  2GRC A;  2YEL A;  5EV9 A;  2CKL A;  1G25 A;  2D82 A;  4O74 A;  3UVY A;  4HBW A;  5IID A;  1LDK C;  3O35 A;  2ECN A;  4V3L C;  2YHN A;  5BT5 A;  4PPE A;  5CUE A;  2EXU A;  2LGK A;  4QQ4 A;  5I80 A;  4AKI A;  5DFC A;  5E7D A;  4ZC9 A;  4HBX A;  2K16 A;  4B86 C;  4A9H A;  5B79 A;  5DY7 A;  5IGM A;  1E6I A;  2ECG A;  4AKH A;  4A9O A;  5G4S A;  3SVG A;  4UIV A;  5HRW A;  5L8T A;  2MNY A;  3DPL R;  4F1P A;  4LDF A;  5BT3 A;  5AMF A;  2R0S A;  5FFV A;  1F62 A;  5HQ5 A;  5E9K A;  4NYW A;  2G43 A;  4MEQ A;  4O7F A;  5A85 A;  1WEP A;  4ALH A;  5B75 A;  5ENI A;  5IG6 A;  4OUF A;  2KRE A;  4R7E A;  5CQT A;  4LC2 A;  4TYL A;  5FE2 A;  3M62 A;  4IR5 A;  4CUQ A;  5JWM A;  1FP0 A;  4NR8 A;  4LZ2 A;  1WEU A;  4BW1 A;  3MQM A;  5FG5 A;  2C2V S;  5E3G A;  2MA6 A;  4UI9 B;  4QY4 A;  2YU4 A;  3O33 A;  5CQ5 A;  2KWK A;  3ZVY A;  4A49 A;  5D3R A;  5A5R A;  5H1V A;  3SVH A;  3P1D A;  5A7C A;  4WHU A;  3D1B A;  4TU6 A;  2XEU A;  5ETB A;  5J0D A;  4E96 A;  2EJN A;  3N9P A;  5I29 A;  5K3Q A;  5F62 A;  2KFT A;  3KNV A;  5CZG A;  3V43 A;  4CL9 A;  4S3O C;  3U5K A;  3VKG A;  2L75 A;  3Q1D A;  4NRB A;  4UYE A;  2YT5 A;  4YY4 A;  2RNW A;  5CPE A;  3L1Z B;  3SOW A;  3LQJ A;  1EQF A;  4UYF A;  4ZQL A;  5HQ6 A;  1HYJ A;  4YYH A;  3RPG C;  3I2D A;  3HME A;  1K2F A;  2L5E A;  3N9O A;  5LJ0 A;  1X4I A;  4N3W A;  4MR5 A;  3MDB C;  5SVY A;  4QB3 A;  3G0J A;  3GV4 A;  3ZYU A;  2KTB B;  1WUM A;  1U6G B;  5DYU A;  4WIV A;  2JMJ A;  3HCS A;  4O72 A;  1WE9 A;  2EGP A;  2E7O A;  2OUO A;  1WGM A;  4YK0 A;  2B0O E;  2ZET C;  4TU4 A;  4Z0R A;  5AME A;  3FJU B;  4FLP A;  5F25 A;  4FJC A;  4MR4 A;  4PTB A;  2L5U A;  5ENH A;  1ZBD B;  3PUR A;  2PNX A;  5FBX A;  5E9L A;  5FG6 A;  5DX4 A;  5I7Y A;  2YSM A;  4XUA A;  4LK9 A;  2LSP B;  2I8N A;  1FBV A;  4IC2 A;  3SOX A;  5HFQ A;  4N4G A;  3T9K A;  3ZYQ A;  2F42 A;  3MUL A;  4OGC A;  1ZS5 A;  4NRA A;  4MEO A;  5DIN A;  4CUT A;  4YYI A;  4Q6F A;  5LKT A;  5EIC A;  3LQI A;  4NS5 A;  2YQD A;  1JOC A;  5FG4 A;  2KU3 A;  5LCW B;  4QSX A;  3P5O A;  5D3L A;  4LYI A;  2CON A;  2G6Q A;  2KGG A;  5G05 B;  1T1H A;  4KV4 A;  4O71 A;  4Z6I A;  1WIM A;  3LVQ E;  4O75 A;  4UP5 A;  5ACY A;  5CFW A;  3LJW A;  5CY9 A;  4B7Y C;  5D3H A;  3KV5 A;  3JVJ A;  3I3J A;  1WEW A;  4YC9 A;  5KH3 A;  3HMH A;  4C9Z A;  5CQ8 A;  4NN2 A;  5C85 A;  4O78 A;  3L1X A;  2R0Y A;  4A9E A;  4TKP B;  4AYC B;  4XY8 A;  4UIU A;  3PHD A;  2D9E A;  4OGI A;  2YSJ A;  5JG6 A;  4PCE A;  3JUE A;  4HXR A;  5EWH A;  5LJ2 A;  5G0F A;  3HMF A;  4NR9 A;  4F52 B;  4GNE A;  5EYA F;  4O76 A;  2MKE A;  4HXL A;  5D3T A;  4Z6H A;  2C2L A;  2YW5 A;  5EWW A;  2CSV A;  4QEU A;  5KU3 A;  2YVR A;  3DDT A;  4CLB A;  4YAT A;  4I7C A;  5EP7 A;  2E6R A;  4TT2 A;  4O7A A;  4YBM A;  5HCL A;  1PUO A;  2N9G A;  4QSS A;  5HLS A;  3O36 A;  3UVX A;  4A4B A;  5AIT A;  2MIQ A;  1F68 A;  3QZV A; 
#chains in the Genus database with same CATH homology
 5COI A;  2JMI A;  5D3N A;  5EVA A;  2KE1 A;  3HCU A;  5D7X A;  3ASL A;  3DWY A;  5H1T A;  5D3P A;  4A9K A;  5DYA A;  4TZ8 A;  5EIS A;  1X4J A;  5B76 A;  2L85 A;  2HYE D;  1Z2Q A;  5EU1 A;  4CUU A;  4AUQ B;  1E4U A;  4X3G A;  4BHW A;  3P1E A;  4NQN A;  4QR4 A;  5HEN A;  5CRM A;  4A9N A;  1X4U A;  2VPG A;  5IGL A;  4XI1 A;  5D1M B;  3VK6 A;  5F61 A;  4F3I A;  4Y03 A;  4J0R A;  5DW2 A;  3U5O A;  5K29 A;  5EPS A;  3P1F A;  2VPD A;  4FIP A;  1WEE A;  2LQ6 A;  4LKA A;  3RPG B;  2F6J A;  2RSD A;  2E6S A;  2YDW A;  2RS9 B;  4HXP A;  4A0C D;  1HYI A;  5I83 A;  5FE0 A;  2L43 A;  3N9M A;  5HFR A;  2LV9 A;  1WUG A;  4YH4 A;  3U5P A;  4TS8 A;  5HQ7 A;  1WEN A;  3DQV R;  4S3O B;  4KV1 A;  4NR5 A;  3O70 A;  5E9I A;  5TDR A;  5E9Y A;  4A4C A;  5CUG A;  3MB4 A;  1WEO A;  5H9M A;  3UV4 A;  4UYF B;  5CTL A;  2E7N A;  4J1P A;  4QC3 A;  4DON A;  4PCI A;  2Y43 A;  2KYU A;  4WA6 A;  5L96 A;  1N72 A;  4NYX A;  5DFD A;  2VJE B;  4UIW A;  5G04 B;  3TLP A;  4I7B A;  5CS8 A;  4NR7 A;  2OXQ C;  1VYX A;  4O64 A;  5DFB A;  1WFK A;  2YW8 A;  2G45 A;  4HXO A;  4AKN A;  2DX8 A;  5F63 A;  3G0L A;  5HEM A;  4Q0N A;  4LZS A;  2CKL B;  5FEY A;  5F5Z A;  5A5S A;  3GL6 A;  5CQ7 A;  2LDR A;  4YYM A;  5C87 A;  1RMD A;  4TTE A;  5A82 A;  4O7C A;  5D3S A;  4O70 A;  4YBS A;  4YYG A;  2EOD A;  2HDP A;  3HCT A;  4L7X A;  2JRJ A;  4CCG X;  5HJC A;  4LLB A;  5I3L A;  5FH6 A;  3HTK C;  4CA1 A;  4R2Y A;  2YHO A;  2AN6 A;  4IR3 A;  3FKM X;  5J3X A;  5FH8 A;  2LGV A;  2RI7 A;  3JVM A;  5H1U A;  2PUY A;  1JM4 B;  3AQA A;  3KV6 A;  3M63 A;  3ZVZ B;  2YRE A;  3SOU A;  1BOR A;  4YAB A;  3SVF A;  3O37 A;  2UZG A;  4UYD A;  5C11 A;  5E9M A;  2R0V A;  2QJ0 A;  5FDZ A;  2OO1 A;  3IU5 A;  2YQL A;  3EB5 A;  5B77 A;  2VP7 A;  4O7E A;  4I7D A;  4HXM A;  1WIL A;  2YYR A;  5B8D A;  5FE4 A;  2M1R A;  3UW9 A;  3L11 A;  5E3D A;  2ECJ A;  4TT4 A;  4UP0 A;  5DYC A;  3JVL A;  1LDJ B;  1JM7 B;  4IOO A;  5KTW A;  4YY6 A;  2IDA A;  2K17 A;  2DVV A;  2YQM A;  3D7C A;  4GB0 A;  4QUT A;  5ENB A;  4HBV A;  4QF2 A;  1MM2 A;  5IBN A;  5EM3 A;  4QUU A;  4GNG A;  3AAD A;  4BW2 A;  4PS5 A;  3U5L A;  4AP4 A;  2R10 A;  5A5N A;  2KWO A;  4UYG A;  5C89 A;  5D25 A;  4QYD A;  3O34 A;  5E73 A;  5D24 A;  4YBT A;  5I7X A;  4QSW A;  1CHC A;  2CSZ A;  4WZ0 A;  3DAI A;  3QZS A;  5FE3 A;  2DWW A;  2DAT A;  2LN0 A;  4MVT A;  2LXP C;  5E74 A;  1JM7 A;  2FUI A;  3MHS A;  5FE8 A;  2L80 A;  4X2I A;  4C67 A;  4W4U A;  4AVX A;  4FO9 A;  2F6N A;  4LRG A;  4CUR A;  5EPB A;  3EB6 A;  5DKH A;  3K2J A;  2QIC A;  5DKA A;  3U5N A;  5KO4 A;  5A83 A;  3NG2 A;  5KH9 A;  2RO1 A;  5LKZ A;  2KGI A;  4PY6 A;  5DLZ A;  4Z1S A;  4GND A;  1VD4 A;  5CP5 A;  4QST A;  1XWH A;  5LUU A;  4CFL A;  2MNZ A;  2M6M A;  5LJ1 A;  2KWJ A;  3U5M A;  4LZR A;  5CUD A;  4NR6 A;  2LGG A;  3FL2 A;  4C66 A;  4FK5 A;  5CQ3 A;  5DW1 A;  5FH7 A;  2BAY A;  5DBM A;  4YH3 A;  5EWC A;  5EQ1 A;  4YAD A;  5L97 A;  3UV5 A;  2CSY A;  5TBN A;  2VNF A;  4MR6 A;  3MHH A;  3ZPV E;  4ZW1 A;  3LQH A;  4NUD A;  5EA1 A;  5LKX A;  4A9F A;  5I1Q A;  5ENG A;  3N9N A;  2D8S A;  3ZNI A;  4UYH A;  1WEQ A;  2MD7 B;  4Z1Q A;  2YEK A;  3KQI A;  5EWD A;  5FER A;  4QF3 A;  3T6R A;  5CQ6 A;  5HEL A;  2FUU A;  1DVP A;  2DVS A;  3MB3 A;  5L98 A;  2DVQ A;  3C6W A;  4Q0O A;  5F36 A;  5ENJ A;  3LXJ A;  5D26 A;  5CQA A;  3IU6 A;  4WZ2 A;  5FE6 A;  4YYK A;  4NYV A;  2E3K A;  4QBM A;  4NXJ A;  5HRV A;  1VFY A;  5F1L A;  5A5P A;  5F2P A;  4WZ3 B;  4O77 A;  4GNF A;  4IC3 A;  2RNY A;  4IOR A;  4NQM A;  4UIY A;  5TCM A;  1JSP B;  5BT4 A;  2L84 A;  5AD2 A;  1N87 A;  2LGL A;  4BBQ A;  5FFW A;  2M85 A;  3N9Q A;  3RCW A;  4IR6 A;  5EK9 A;  4TT6 A;  1WEM A;  5TDW A;  4QEW A;  3ZPV 1;  4HXS A;  5DYX A;  3P1C A;  4N4H A;  4HXK A;  4RVR A;  5A5Q A;  4CFK A;  5H85 A;  5ENE A;  2ECW A;  3N9L A;  2G4A A;  5II1 A;  5DKC A;  5ENF A;  1V87 A;  3JVK A;  4QR3 A;  4BJX A;  1Z60 A;  4BW3 A;  2KR4 A;  5LKU A;  4J0S A;  4N4F A;  4UIT A;  2NAA A;  5CRZ A;  4LAD B;  5KTX A;  5CU8 A;  3PUQ A;  3MXF A;  4UIZ A;  3T7L A;  4NRC A;  4TZ2 A;  4A9M A;  4WHW A;  5FE1 A;  5L8U A;  3ONI A;  3C5K A;  5TRB A;  2RFJ A;  5FB1 A;  4IOQ A;  2ECT A;  2KIZ A;  4J3I A;  2MT5 A;  4CUS A;  4QZS A;  2RNX A;  5C8G A;  4V3K C;  3GG3 A;  4YYJ A;  4MR3 A;  5ENC A;  5C7N A;  2VPE A;  5FB0 A;  5TAB A;  5A81 A;  5B78 A;  5II2 A;  3RTR B;  4QSR A;  5F3A A;  5FE9 A;  5KH7 A;  5HM0 A;  4AYC A;  2KWN A;  5FE5 A;  4KCX A;  5DLX A;  5LVQ A;  4QC1 A;  5D1K B;  4BW4 A;  2ECI A;  2JMD A;  2MD8 C;  1Z6U A;  3Q2E A;  4PKL A;  3UVD A;  2EA6 A;  3ZTG A;  3SHB A;  4ZUX U;  4A9L A;  3MUK A;  5AIU A;  5ETD A;  1MM3 A;  2VJF B;  4YYN A;  5L99 A;  2DKW A;  2QIZ A;  4N4I A;  4LR6 A;  4HXN A;  2MJV B;  4NUC A;  2FSA A;  4NUE A;  5CQ4 A;  4Z93 A;  5I88 A;  3IHP A;  5C4Q A;  5F60 A;  4L58 A;  4LYS A;  4YAX A;  1IYM A;  4QEV A;  4QSU A;  2H0D B;  5AD3 A;  3UV2 A;  5E0R A;  2VPB A;  2MA5 A;  5CUB A;  4QSV A;  4UIX A;  5CUA A;  5I40 A;  2VJE A;  4GPJ A;  5F1H A;  4YYD A;  5HRX A;  5JI8 A;  5FE7 A;  5TB6 A;  5EWV A;  5IGK A;  3U5J A;  2WP2 A;  4QNS A;  3M99 A;  4P5O B;  4LJN A;  3UVW A;  5FFY A;  1WEV A;  5KTU A;  5CUC A;  5EGU A;  2OSS A;  1X0J A;  3Q2F A;  4HBY A;  4A9I A;  5E9V A;  5LVR A;  5D1L B;  2I7K A;  2YYN A;  2XB1 A;  2K1J A;  4OGJ A;  2DVR A;  2H60 A;  2CT2 A;  2LRI C;  2M3H A;  4MSX A;  3QZT A;  4QYL A;  4NR4 A;  4ALG A;  5I86 A;  2YEM A;  4QSQ A;  5C13 A;  4TQN A;  4IR4 A;  4QR5 A;  4XY9 A;  2WP1 A;  5IGN A;  2H0D A;  4QSP A;  2VJF A;  2Y1N A;  4MEN A;  4ZDT A;  4R8P K;  5CGP A;  4XYA A;  5EPR A;  2Y1M A;  5DKD A;  5G4R A;  4A9J A;  4MEP A;  2YUR A;  2K4D A;  3O7A A;  5D3J A;  5EI4 A;  4CUP A;  2L0B A;  2I50 A;  1WES A;  4XUB A;  3LRQ A;  5D0C A;  2NXB A;  3S92 A;  5I89 A;  5KHM A;  2LXH C;  2MUM A;  3S91 A;  4LYW A;  5A5O A;  2ECV A;  2YUC A;  3NXB A;  4O7B A;  2GRC A;  2YEL A;  5EV9 A;  2CKL A;  1G25 A;  2D82 A;  4O74 A;  3UVY A;  4HBW A;  5IID A;  1LDK C;  3O35 A;  2ECN A;  4V3L C;  2YHN A;  5BT5 A;  4PPE A;  5CUE A;  2LGK A;  5I80 A;  5DFC A;  5E7D A;  4ZC9 A;  4HBX A;  2K16 A;  4B86 C;  4A9H A;  5B79 A;  5DY7 A;  5IGM A;  1E6I A;  2ECG A;  4A9O A;  5G4S A;  3SVG A;  4UIV A;  5HRW A;  5L8T A;  2MNY A;  3DPL R;  4LDF A;  5BT3 A;  5AMF A;  2R0S A;  5FFV A;  1F62 A;  5HQ5 A;  5E9K A;  4NYW A;  2G43 A;  4MEQ A;  4O7F A;  5A85 A;  1WEP A;  4ALH A;  5B75 A;  5ENI A;  5IG6 A;  4OUF A;  2KRE A;  4R7E A;  5CQT A;  4LC2 A;  4TYL A;  5FE2 A;  3M62 A;  4IR5 A;  4CUQ A;  5JWM A;  1FP0 A;  4NR8 A;  4LZ2 A;  1WEU A;  4BW1 A;  3MQM A;  5FG5 A;  2C2V S;  5E3G A;  2MA6 A;  4UI9 B;  4QY4 A;  2YU4 A;  3O33 A;  5CQ5 A;  2KWK A;  3ZVY A;  4A49 A;  5D3R A;  5A5R A;  5H1V A;  3SVH A;  3P1D A;  5A7C A;  4WHU A;  4TU6 A;  2XEU A;  5ETB A;  5J0D A;  4E96 A;  3N9P A;  5I29 A;  5F62 A;  2KFT A;  3KNV A;  5CZG A;  3V43 A;  4CL9 A;  4S3O C;  3U5K A;  2L75 A;  4NRB A;  4UYE A;  2YT5 A;  4YY4 A;  2RNW A;  5CPE A;  3L1Z B;  3SOW A;  3LQJ A;  1EQF A;  4UYF A;  4ZQL A;  5HQ6 A;  1HYJ A;  4YYH A;  3RPG C;  3I2D A;  3HME A;  1K2F A;  2L5E A;  3N9O A;  5LJ0 A;  1X4I A;  4N3W A;  4MR5 A;  4QB3 A;  3G0J A;  3GV4 A;  3ZYU A;  2KTB B;  1WUM A;  1U6G B;  5DYU A;  4WIV A;  2JMJ A;  3HCS A;  4O72 A;  1WE9 A;  2EGP A;  2E7O A;  2OUO A;  1WGM A;  4YK0 A;  2ZET C;  4TU4 A;  5AME A;  4FLP A;  5F25 A;  4FJC A;  4MR4 A;  4PTB A;  2L5U A;  5ENH A;  1ZBD B;  3PUR A;  2PNX A;  5FBX A;  5E9L A;  5FG6 A;  5DX4 A;  5I7Y A;  2YSM A;  4XUA A;  4LK9 A;  2LSP B;  2I8N A;  1FBV A;  4IC2 A;  3SOX A;  5HFQ A;  4N4G A;  3ZYQ A;  2F42 A;  3MUL A;  1ZS5 A;  4NRA A;  4MEO A;  5DIN A;  4CUT A;  4YYI A;  4Q6F A;  5LKT A;  5EIC A;  3LQI A;  4NS5 A;  2YQD A;  1JOC A;  5FG4 A;  2KU3 A;  5LCW B;  4QSX A;  3P5O A;  5D3L A;  4LYI A;  2G6Q A;  2KGG A;  5G05 B;  1T1H A;  4KV4 A;  4O71 A;  4Z6I A;  1WIM A;  4O75 A;  4UP5 A;  5ACY A;  5CFW A;  3LJW A;  5CY9 A;  4B7Y C;  5D3H A;  3KV5 A;  3JVJ A;  3I3J A;  1WEW A;  4YC9 A;  5KH3 A;  3HMH A;  4C9Z A;  5CQ8 A;  4NN2 A;  5C85 A;  4O78 A;  3L1X A;  2R0Y A;  4A9E A;  4TKP B;  4AYC B;  4XY8 A;  4UIU A;  3PHD A;  2D9E A;  4OGI A;  2YSJ A;  5JG6 A;  4PCE A;  4HXR A;  5EWH A;  5LJ2 A;  5G0F A;  3HMF A;  4NR9 A;  4F52 B;  4GNE A;  5EYA F;  4O76 A;  4HXL A;  5D3T A;  4Z6H A;  2C2L A;  2YW5 A;  5EWW A;  4QEU A;  5KU3 A;  4CLB A;  4YAT A;  4I7C A;  5EP7 A;  2E6R A;  4TT2 A;  4O7A A;  4YBM A;  5HCL A;  5HLS A;  2N9G A;  4QSS A;  3O36 A;  3UVX A;  4A4B A;  5AIT A;  2MIQ A;  1F68 A;  3QZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...