5H1VA

Complex structure of trim24 phd-bromodomain and inhibitor 6
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
169
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQESMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 50
structure length 169
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1vA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1vA01
3GV4A 2CKLB 3ZPV1 4O75A 1HYIA 3IU6A 4CLBA 2YYRA 5I1QA 2KE1A 3O33A 2L75A 3DPLR 2R0VA 5CFWA 4Y03A 5D3RA 5F62A 3S91A 5DFDA 4O7EA 3P1CA 4TTEA 3C5KA 5KH7A 5F1LA 1MM2A 2LDRA 4QBMA 5L97A 4TU6A 3ZPVE 2KTBB 5CQAA 2DVRA 4NUDA 3U5OA 4MR6A 2K1JA 4ZC9A 4BW1A 5CQ7A 4WZ0A 4YYNA 4GNGA 5ENCA 4WHUA 5CUDA 4YAXA 5COIA 2LGKA 2OUOA 1JM7A 5ACYA 5EICA 4O72A 2H0DA 5I29A 3UVWA 4QSUA 5FE7A 5B76A 5LUUA 3MHHA 2JMIA 4GPJA 4O74A 5ENEA 3ZNIA 5DLXA 4A4CA 3HMEA 3I2DA 2MUMA 5FB0A 3IU5A 5D3JA 4AP4A 5F63A 4YK0A 2L5EA 5FE5A 1X4UA 4QEWA 3FL2A 4TQNA 3HCUA 4C9ZA 4MR4A 4Q0OA 2L85A 5CUGA 2YELA 5I83A 5IGLA 5A7CA 2PNXA 5EWHA 3UV4A 4A9MA 4ALHA 4QSTA 5C87A 5C13A 5EPRA 3DWYA 5FH8A 3TLPA 4ALGA 4QC1A 3U5PA 1DVPA 1Z2QA 5K29A 4QYLA 3UV5A 4ZUXU 5E9YA 3S92A 4XY8A 5EGUA 2OSSA 5ENBA 3P1FA 5H85A 5IGNA 4LKAA 5CQ8A 2ECTA 2KWOA 3RPGB 5II1A 3N9PA 4QSPA 5A85A 3KQIA 4IORA 5J0DA 5E74A 1CHCA 4N4HA 1VYXA 1EQFA 2WP2A 3D7CA 4HXLA 4TYLA 4WZ2A 1WUMA 4NR8A 2ECJA 2ZETC 4HBWA 2M6MA 3RPGC 4A9JA 5D3NA 5KU3A 3MUKA 4YH3A 4A9IA 4WIVA 3N9OA 5HRWA 2PUYA 4LC2A 2L43A 4CUUA 2E6SA 4TT4A 3ZVZB 4NUEA 5LVQA 4WA6A 4UYEA 2YREA 1E4UA 5D24A 5C11A 3N9LA 5CUAA 4I7CA 2IDAA 4S3OB 5HENA 4NR4A 2MNZA 5LKUA 2KGGA 5DY7A 3SOXA 5DX4A 5EV9A 1F62A 4QEUA 5EISA 5IBNA 5J3XA 4QB3A 3G0JA 1VFYA 4AKNA 5B8DA 4UIWA 4FO9A 5HFQA 5BT5A 5AITA 1WEUA 2KWKA 3HCSA 3T7LA 4O76A 4NQMA 5EM3A 4A9HA 5KTXA 5IIDA 4UIUA 4FIPA 3UV2A 3MHSA 5I80A 2UZGA 5FE0A 5CQ5A 2QICA 3ZYQA 4IC2A 3M62A 2K16A 2L0BA 4O7FA 2YHNA 4NRCA 2DATA 4MEPA 2Y43A 4B7YC 2HDPA 4UIXA 4YADA 4LYWA 4KV4A 2QIZA 4NYWA 4XUBA 3KV6A 2I50A 4XYAA 4MEOA 2YEKA 2YW5A 3G0LA 4O71A 5E73A 5FFYA 5IGKA 4YYDA 4HXOA 2KU3A 4QSXA 2OO1A 4PS5A 4Z1SA 3O34A 2OXQC 4IR4A 5C89A 3UW9A 5AIUA 4OGIA 3QZSA 5AD3A 3C6WA 4V3KC 4IR6A 4A9FA 1WEMA 3IHPA 1G25A 1V87A 2VPBA 1JM7B 2E6RA 4O70A 2H0DB 5EP7A 2KYUA 3KV5A 5B77A 5FE4A 2VPGA 2LN0A 4PTBA 2NAAA 4KCXA 5CGPA 5JG6A 2EGPA 5F60A 4QUUA 5H9MA 5HQ7A 1WGMA 4O7AA 2YHOA 2R0YA 3U5NA 4A9LA 4RVRA 2RI7A 2E7NA 2XB1A 1F68A 5H1UA 5HCLA 2DVQA 4YYJA 3P1EA 3N9MA 5F3AA 3O35A 5A83A 3MXFA 3RTRB 4A4BA 4A9NA 5C4QA 5D0CA 1LDJB 4CCGX 5HM0A 4NRBA 4MENA 4GNDA 5C85A 5EI4A 4NXJA 3I3JA 4Z6IA 2MIQA 5DYUA 4NN2A 5CTLA 5CP5A 2G6QA 4UYFA 4XUAA 5E9LA 4LZSA 2FSAA 5CQ6A 3LRQA 2YQMA 1K2FA 4NR6A 5D25A 4YY6A 2I7KA 4J1PA 4QC3A 4NR9A 5ETDA 5FE6A 1U6GB 3LQHA 4NS5A 4LK9A 4QF3A 5D1MB 3JVJA 5E7DA 4TT6A 4E96A 4YH4A 5FBXA 5HFRA 2LXPC 5FFWA 2H60A 1FP0A 3O70A 4R8PK 1VD4A 3MQMA 5TRBA 4NR7A 5E9KA 2G4AA 4QSWA 2Y1NA 5HEMA 3EB6A 2YDWA 3RCWA 2RNXA 5IG6A 5DW2A 4B86C 4MSXA 4CUSA 1WEOA 2MNYA 5HQ5A 5DKHA 5KH3A 4LZRA 4IOQA 1WILA 5HQ6A 2VJEA 4NUCA 3L11A 5EPSA 2AN6A 4ZW1A 3PUQA 5L8TA 5TDRA 5LKXA 5EYAF 2YEMA 5G05B 4AYCB 5LJ1A 5I3LA 5C8GA 5A5QA 2L5UA 3N9NA 2RNYA 4R2YA 4YATA 2KREA 2YUCA 1WEWA 5D3LA 4BBQA 2VPEA 3Q2FA 2VJFB 4UI9B 4HXPA 4UP0A 5A5SA 3EB5A 5CZGA 5CUBA 4HBVA 5LKTA 4AVXA 4GNEA 5FB1A 5EWVA 4LYIA 5E3GA 4MVTA 1HYJA 4XI1A 2K4DA 4J0SA 2DWWA 2L80A 5E9VA 4FLPA 4QSVA 2YW8A 3AADA 2RFJA 3PURA 5FE9A 5I40A 5CU8A 5TCMA 3DQVR 5LVRA 2YURA 2F6NA 5D3HA 1JSPB 5CQTA 4O78A 2YT5A 5H1VA 5BT4A 5FE8A 1X4JA 2F42A 4QUTA 2DVSA 2D82A 3HMFA 2R10A 4YYHA 5D1KB 5AD2A 5FERA 1WENA 4YYIA 5DFBA 5EWDA 2QJ0A 1XWHA 4W4UA 2CSYA 1WFKA 5E3DA 3L1XA 5FDZA 1WIMA 4HXMA 2ECNA 4L7XA 3ZVYA 5D3PA 4QR3A 5F25A 5L99A 5ENGA 3PHDA 1WESA 4CURA 5A5RA 5L98A 4UP5A 4YC9A 5HLSA 4BHWA 4LYSA 1BORA 5HELA 2JMDA 2LGVA 4YYKA 4IR3A 5CUCA 5F1HA 5A5OA 5L8UA 5DINA 3NXBA 1N87A 5D1LB 4ZDTA 3K2JA 4TKPB 2RSDA 3MB4A 5A5NA 4YY4A 5D7XA 3ASLA 5FG4A 4HXNA 2LGLA 3U5KA 1FBVA 3VK6A 5LKZA 2MD7B 5LCWB 4CA1A 4C67A 3AQAA 4HBXA 4MR5A 4F52B 4WZ3B 2M3HA 4UYFB 4N4FA 5B75A 2CT2A 3ZYUA 2FUIA 4Z93A 2VNFA 5DKDA 4P5OB 4UYDA 5DW1A 1X0JA 3UVDA 2I8NA 4HXRA 1RMDA 2K17A 4FJCA 4TS8A 4QSSA 4X3GA 4CUPA 2DVVA 1E6IA 5DBMA 5I7XA 3FKMX 2ECVA 4AUQB 2VPDA 5KTWA 5B79A 4QZSA 4BW2A 3JVKA 4DONA 4WHWA 5CPEA 4GNFA 3GL6A 3JVMA 3N9QA 3UVXA 5KO4A 4Q0NA 5CQ4A 5LJ2A 5L96A 2C2LA 2CSZA 2YSMA 1IYMA 1ZBDB 4YBTA 4A49A 2MT5A 4LJNA 2MD8C 4TZ2A 2GRCA 4R7EA 3ZTGA 2RS9B 2KWNA 2YQDA 4N4GA 4CUQA 5H1TA 5HRVA 2EODA 3M63A 2VJEB 4ZQLA 5KHMA 3LQJA 4CFKA 4GB0A 5FEYA 2LXHC 4CFLA 2YQLA 1WEQA 4LDFA 4OGJA 3QZTA 3SVFA 4QNSA 4LRGA 4YBMA 4QR4A 2M85A 4PPEA 4PCIA 3HCTA 5DYAA 2E3KA 4HBYA 4OUFA 3M99A 3P5OA 2XEUA 5EPBA 4UIYA 2D8SA 2M1RA 4QSRA 5JWMA 5ENFA 1Z60A 2YSJA 2KR4A 1JOCA 5ENHA 4A9OA 5EA1A 4NR5A 5I86A 2E7OA 5DYXA 2CKLA 4BW3A 4YYGA 3LXJA 5CUEA 3QZVA 3LJWA 3GG3A 4UYHA 1Z6UA 2JMJA 5F36A 4O7CA 4PY6A 3KNVA 4Q6FA 3P1DA 5I7YA 2MJVB 5I88A 2C2VS 3JVLA 5DLZA 5FE3A 5EWWA 5F2PA 4CUTA 3V43A 5HJCA 3O7AA 2YYNA 2DKWA 4TU4A 4BW4A 1WEPA 4HXKA 2LGGA 3DAIA 5E0RA 5G0FA 2YU4A 4BJXA 4UITA 3NG2A 4CL9A 1X4IA 2HYED 4IC3A 4Z6HA 5KTUA 4N3WA 2N9GA 5JI8A 5AMFA 5AMEA 3U5MA 5FFVA 5CRMA 2MA6A 1N72A 1T1HA 4YABA 3U5JA 2FUUA 4A0CD 4QEVA 1JM4B 5LJ0A 3SOUA 2EA6A 4NYXA 5FE1A 4Z1QA 2VP7A 5B78A 5CRZA 4N4IA 2WP1A 5A81A 3UVYA 2BAYA 4A9KA 2Y1MA 4LADB 4PKLA 4J3IA 3MULA 5DYCA 2D9EA 5BT3A 1LDKC 5FH7A 5EU1A 3MB3A 4O77A 3Q2EA 1WE9A 4X2IA 4NRAA 4NYVA 5ENIA 4YBSA 5EK9A 4F3IA 2ECWA 3SHBA 5FE2A 2KIZA 5TDWA 5ETBA 5G4SA 2NXBA 5TABA 4O64A 5II2A 4I7BA 4QR5A 4IOOA 3O36A 2LV9A 4AYCA 4HXSA 2JRJA 3U5LA 5D26A 5I89A 5A82A 5FG6A 1WEVA 2KGIA 4LLBA 4S3OC 2LRIC 5E9IA 5TB6A 2L84A 2KWJA 2G43A 4QSQA 5DKAA 5D3TA 5FH6A 5DFCA 1WEEA 2VJFA 5DKCA 2R0SA 2LSPB 5EQ1A 5A5PA 2ECGA 5C7NA 5G4RA 5G04B 4KV1A 5D3SA 4FK5A 3LQIA 4YYMA 4C66A 5CS8A 1MM3A 2KFTA 4I7DA 3T6RA 2G45A 3L1ZB 5E9MA 1WUGA 5EVAA 4UIZA 3SVGA 4TT2A 4L58A 4O7BA 4MR3A 3SVHA 2F6JA 4XY9A 4QY4A 5CY9A 4TZ8A 2MA5A 4IR5A 4V3LC 5TBNA 3ONIA 5KH9A 2DX8A 3O37A 2RNWA 2ECIA 3SOWA 3HTKC 4A9EA 5HRXA 4PCEA 2RO1A 3HMHA 4LR6A 5IGMA 4UYGA 4MEQA 5ENJA 5F61A 5F5ZA 2LQ6A 4NQNA 5EWCA 4QYDA 4J0RA 1ZS5A 4LZ2A 4UIVA 5FG5A 5CQ3A 4QF2A
chains in the Genus database with same CATH superfamily
3GV4A 2CKLB 3ZPV1 4O75A 1HYIA 3IU6A 4CLBA 2YYRA 5I1QA 2KE1A 3O33A 3LDYA 2L75A 3DPLR 2R0VA 5CFWA 4Y03A 5D3RA 5F62A 3S91A 5DFDA 4O7EA 3P1CA 4TTEA 3C5KA 3D1DA 5KH7A 5F1LA 1MM2A 2LDRA 4QBMA 5L97A 4TU6A 3ZPVE 2KTBB 5CQAA 2DVRA 4NUDA 3U5OA 5SVXA 4MR6A 2K1JA 4ZC9A 4BW1A 5CQ7A 4WZ0A 4YYNA 4GNGA 5ENCA 4WHUA 5CUDA 4YAXA 5COIA 2LGKA 2OUOA 2OWAA 1JM7A 5ACYA 5EICA 4O72A 2H0DA 5I29A 3UVWA 4QSUA 5FE7A 5B76A 5LUUA 3MHHA 2JMIA 4GPJA 4O74A 5ENEA 3ZNIA 5DLXA 2D8UA 4A4CA 3HMEA 3I2DA 2MUMA 5FB0A 3IU5A 5D3JA 4AP4A 5F63A 4YK0A 2L5EA 3PLWA 5FE5A 1X4UA 4QEWA 3FL2A 4TQNA 3HCUA 4C9ZA 4MR4A 4Q0OA 5SVIA 2L85A 5CUGA 2CONA 2YELA 3D1BA 5I83A 5A7CA 5IGLA 5EWHA 3UV4A 2PNXA 4A9MA 4ALHA 4QSTA 5C87A 5C13A 5EPRA 3DWYA 5FH8A 3TLPA 4ALGA 4QC1A 3U5PA 1DVPA 1Z2QA 5K29A 4QYLA 3UV5A 4ZUXU 5E9YA 3S92A 4XY8A 5EGUA 2CSVA 2OSSA 5ENBA 3P1FA 5H85A 5IGNA 4LKAA 4F1PA 5CQ8A 2ECTA 2KWOA 3RPGB 5II1A 3N9PA 3SUBA 3FJUB 4QSPA 5A85A 3KQIA 4IORA 5J0DA 5E74A 1CHCA 4N4HA 1VYXA 1EQFA 2WP2A 3D7CA 4HXLA 4TYLA 4WZ2A 1WUMA 4NR8A 2ECJA 2ZETC 4HBWA 2M6MA 3RPGC 3LVRE 4A9JA 5D3NA 5KU3A 3MUKA 4YH3A 4A9IA 4WIVA 3N9OA 5HRWA 2PUYA 4LC2A 2L43A 4CUUA 2E6SA 4TT4A 2XOZA 3ZVZB 4AKHA 4NUEA 5LVQA 4WA6A 4UYEA 2YREA 1E4UA 5D24A 5C11A 2XOCA 3N9LA 5CUAA 4I7CA 2IDAA 4S3OB 5HENA 4NR4A 2MNZA 5LKUA 2KGGA 5DY7A 3SOXA 5DX4A 5EV9A 1F62A 4QEUA 5EISA 5IBNA 5J3XA 4QB3A 3G0JA 1VFYA 4Z0RA 4AKNA 5B8DA 4UIWA 4FO9A 5HFQA 3FAOA 5BT5A 5AITA 1WEUA 2KWKA 3HCSA 3T7LA 4O76A 4NQMA 5EM3A 4A9HA 5KTXA 5IIDA 4UIUA 4FIPA 3UV2A 3MHSA 5I80A 2UZGA 5FE0A 5CQ5A 2QICA 3ZYQA 4IC2A 3M62A 3E2DA 2K16A 2L0BA 4O7FA 2YHNA 4NRCA 2DATA 4MEPA 2Y43A 4B7YC 2HDPA 4UIXA 4QQ4A 4YADA 4LYWA 3JUEA 4KV4A 2QIZA 4NYWA 2IQJA 4XUBA 3KV6A 3LJUX 2I50A 4XYAA 4MEOA 2YEKA 2YW5A 3G0LA 4O71A 5E73A 5FFYA 5IGKA 4YYDA 2CRRA 2XP0A 4HXOA 2KU3A 4QSXA 2OO1A 4PS5A 4Z1SA 3O34A 2OXQC 4IR4A 3ERRA 5C89A 3UW9A 5AIUA 4OGIA 3QZSA 5AD3A 3C6WA 4V3KC 4IR6A 4A9FA 1WEMA 3IHPA 1G25A 1V87A 2VPBA 1JM7B 2E6RA 1DCQA 4O70A 2H0DB 5EP7A 2KYUA 3KV5A 5B77A 5FE4A 2RR4A 2EGMA 2VPGA 2LN0A 4PTBA 2NAAA 4KCXA 5CGPA 5JG6A 2EGPA 5F60A 4QUUA 5H9MA 5HQ7A 1WGMA 4O7AA 2YHOA 2R0YA 3U5NA 4A9LA 4RVRA 2DSMA 2RI7A 2E7NA 2XB1A 1F68A 5H1UA 5HCLA 2DVQA 4YYJA 3P1EA 3DWDA 3N9MA 5F3AA 3O35A 5A83A 3MXFA 3RTRB 4A4BA 4A9NA 5C4QA 5D0CA 1LDJB 2P57A 4CCGX 5HM0A 4NRBA 4MENA 4GNDA 5C85A 5EI4A 4NXJA 3I3JA 4Z6IA 2MIQA 5DYUA 2CRWA 3T9KA 4NN2A 5CTLA 3FANA 5CP5A 2G6QA 4UYFA 4XUAA 5E9LA 4LZSA 2FSAA 5CQ6A 3LRQA 2YQMA 1K2FA 4NR6A 3DDTA 5D25A 4YY6A 2I7KA 4J1PA 4QC3A 4NR9A 4OGCA 5ETDA 5FE6A 1U6GB 3LQHA 4NS5A 4LK9A 4QF3A 5D1MB 3JVJA 5E7DA 2DJAA 4TT6A 4E96A 4YH4A 5FBXA 5HFRA 2LXPC 5FFWA 2H60A 1FP0A 3O70A 4H9DA 4R8PK 3M7KA 1VD4A 3MQMA 5TRBA 4NR7A 5E9KA 2G4AA 4QSWA 2Y1NA 5HEMA 3EB6A 2YDWA 3RCWA 2RNXA 5IG6A 5DW2A 1MBMA 4B86C 4MSXA 4CUSA 1WEOA 2MNYA 5HQ5A 5DKHA 5KH3A 4LZRA 4IOQA 1WILA 2YVRA 5HQ6A 2VJEA 4NUCA 3L11A 5EPSA 2AN6A 4ZW1A 3PUQA 5L8TA 4AKGA 5TDRA 5LKXA 5EYAF 2YEMA 5G05B 4AYCB 5LJ1A 3VKHA 5I3LA 5C8GA 5A5QA 2L5UA 3N9NA 3O47A 2RNYA 4R2YA 4YATA 2KREA 2XOYA 2YUCA 1WEWA 5D3LA 4BBQA 2VPEA 3Q2FA 2VJFB 4UI9B 4HXPA 4UP0A 5A5SA 3EB5A 5CZGA 5CUBA 4Z0OA 4HBVA 5LKTA 4AVXA 4GNEA 5FB1A 5EWVA 4LYIA 5E3GA 4MVTA 1HYJA 4XI1A 2K4DA 4J0SA 2DWWA 3FEHA 2L80A 5E9VA 4FLPA 4QSVA 2YW8A 3AADA 2RFJA 3PURA 5FE9A 2L7PA 5I40A 5CU8A 5TCMA 3DQVR 5LVRA 2YURA 2F6NA 5D3HA 1JSPB 5CQTA 4O78A 2YT5A 5H1VA 5BT4A 5FE8A 1X4JA 2F42A 4QUTA 2DVSA 2D82A 3HMFA 2R10A 4YYHA 5D1KB 5AD2A 5SVYA 5FERA 1WENA 4YYIA 5DFBA 5EWDA 2QJ0A 1XWHA 4O62A 4W4UA 2CSYA 1WFKA 5E3DA 3L1XA 5FDZA 1WIMA 4HXMA 2ECNA 4L7XA 3ZVYA 5D3PA 4QR3A 5F25A 5L99A 5ENGA 3PHDA 1WESA 4CURA 5A5RA 5L98A 4UP5A 4YC9A 5HLSA 4BHWA 4LYSA 1BORA 5HELA 2JMDA 2LGVA 4YYKA 4IR3A 5CUCA 5F1HA 5A5OA 5L8UA 5DINA 3NXBA 1N87A 5D1LB 4ZDTA 3K2JA 4TKPB 2RSDA 3MB4A 5A5NA 4YY4A 5D7XA 3ASLA 5FG4A 4HXNA 2LGLA 3U5KA 1FBVA 2KKYA 3VK6A 5LKZA 2MD7B 5LCWB 4CA1A 4C67A 3AQAA 5K3QA 4HBXA 4MR5A 4F52B 4WZ3B 2M3HA 4UYFB 4N4FA 4AI6A 2FFWA 5B75A 2CT2A 3ZYUA 2FUIA 4Z93A 2VNFA 5DKDA 4P5OB 4UYDA 5DW1A 1X0JA 3UVDA 3LVQE 2I8NA 4HXRA 1RMDA 2K17A 4FJCA 4TS8A 4QSSA 4X3GA 4CUPA 2DVVA 1E6IA 5DBMA 5I7XA 3FKMX 2ECVA 4AUQB 2VPDA 5KTWA 5B79A 4QZSA 4BW2A 3Q1DA 5SVIB 3JVKA 4DONA 4WHWA 2LAUA 5CPEA 4GNFA 3GL6A 3JVMA 3N9QA 3UVXA 5KO4A 4Q0NA 5CQ4A 5LJ2A 5L96A 2C2LA 2CSZA 2YSMA 1IYMA 2MKEA 1ZBDB 4YBTA 4A49A 2MT5A 4LJNA 2MD8C 4TZ2A 2GRCA 4R7EA 3ZTGA 2RS9B 2KWNA 2YQDA 4N4GA 4CUQA 5H1TA 5HRVA 2EODA 3M63A 2VJEB 4ZQLA 5KHMA 3LQJA 4CFKA 4GB0A 5FEYA 2LXHC 4CFLA 2YQLA 1WEQA 4LDFA 4OGJA 3QZTA 3SVFA 4QNSA 4LRGA 4YBMA 4QR4A 2M85A 4PPEA 4PCIA 3HCTA 5DYAA 2E3KA 4HBYA 4OUFA 3M99A 3P5OA 2XEUA 5EPBA 4UIYA 2D8SA 2M1RA 4QSRA 5JWMA 5ENFA 1Z60A 2YSJA 2KR4A 1JOCA 5ENHA 4A9OA 5EA1A 4NR5A 5I86A 2E7OA 5DYXA 2CKLA 4BW3A 4YYGA 1ZKRA 3LXJA 5CUEA 3QZVA 3LJWA 3GG3A 4UYHA 1Z6UA 2JMJA 5F36A 4O7CA 4PY6A 3KNVA 4Q6FA 3P1DA 5I7YA 3FM8C 2MJVB 5I88A 2C2VS 3JVLA 5DLZA 5FE3A 5EWWA 5F2PA 4CUTA 3V43A 5HJCA 3VKGA 3O7AA 2YYNA 3H7HA 2DKWA 2EJNA 4TU4A 4BW4A 1WEPA 4HXKA 2LGGA 3DAIA 5E0RA 5G0FA 2YU4A 4BJXA 4UITA 3NG2A 4CL9A 1X4IA 2HYED 4IC3A 4Z6HA 5KTUA 4N3WA 2N9GA 5JI8A 5AMFA 5AMEA 3U5MA 5FFVA 5CRMA 2MA6A 1N72A 1T1HA 4YABA 3U5JA 2FUUA 4A0CD 4QEVA 1JM4B 5LJ0A 3SOUA 2EA6A 4NYXA 5FE1A 4Z1QA 2VP7A 5B78A 2KKXA 5CRZA 4N4IA 2WP1A 5A81A 3UVYA 2BAYA 4A9KA 2Y1MA 4LADB 4PKLA 4J3IA 3MULA 5DYCA 2D9EA 5BT3A 1LDKC 5FH7A 5EU1A 3MB3A 4O77A 3Q2EA 1WE9A 4X2IA 2B0OE 4NRAA 4NYVA 5ENIA 4YBSA 5EK9A 4F3IA 2ECWA 3SHBA 5FE2A 2KIZA 5TDWA 5ETBA 5G4SA 2NXBA 5TABA 4O64A 5II2A 4I7BA 4QR5A 4IOOA 3O36A 2LV9A 4AYCA 4HXSA 2JRJA 3U5LA 5D26A 5I89A 5A82A 5FG6A 1WEVA 2EXUA 4AKIA 2KGIA 4LLBA 4S3OC 2M13A 2LRIC 5E9IA 5TB6A 2L84A 2KWJA 2G43A 4QSQA 5DKAA 5D3TA 5FH6A 5DFCA 1WEEA 2VJFA 5DKCA 2R0SA 2LSPB 5EQ1A 5A5PA 2ECGA 5C7NA 5G4RA 5G04B 4OGEA 4KV1A 5D3SA 2E61A 2FD4A 4FK5A 3LQIA 4YYMA 4C66A 5CS8A 1MM3A 2KFTA 4I7DA 3T6RA 2G45A 1PUOA 3L1ZB 5E9MA 1WUGA 5EVAA 4UIZA 3SVGA 4TT2A 4L58A 4O7BA 4MR3A 3SVHA 2F6JA 4XY9A 3KDEC 4QY4A 5CY9A 4TZ8A 2MA5A 4IR5A 4V3LC 5TBNA 3ONIA 5KH9A 2DX8A 3O37A 2RNWA 2ECIA 3SOWA 3HTKC 4A9EA 5HRXA 4PCEA 2RO1A 3HMHA 4LR6A 5IGMA 4UYGA 2JM3A 4MEQA 5ENJA 5F61A 3MDBC 5F5ZA 2LQ6A 4NQNA 5EWCA 4QYDA 4J0RA 1ZS5A 4LZ2A 4UIVA 5FG5A 5CQ3A 4QF2A 2JUNA
chains in the Genus database with same CATH topology
3GV4A 2CKLB 3ZPV1 4O75A 1HYIA 3IU6A 4CLBA 2YYRA 5I1QA 2KE1A 3O33A 2L75A 3DPLR 2R0VA 5CFWA 4Y03A 5D3RA 5F62A 3S91A 5DFDA 4O7EA 3P1CA 4TTEA 3C5KA 5KH7A 5F1LA 1MM2A 2LDRA 4QBMA 5L97A 4TU6A 3ZPVE 2KTBB 5CQAA 2DVRA 4NUDA 3U5OA 4MR6A 2K1JA 4ZC9A 4BW1A 5CQ7A 4WZ0A 4YYNA 4GNGA 5ENCA 4WHUA 5CUDA 4YAXA 5COIA 2LGKA 2OUOA 1JM7A 5ACYA 5EICA 4O72A 2H0DA 5I29A 3UVWA 4QSUA 5FE7A 5B76A 5LUUA 3MHHA 2JMIA 4GPJA 4O74A 5ENEA 3ZNIA 5DLXA 4A4CA 3HMEA 3I2DA 2MUMA 5FB0A 3IU5A 5D3JA 4AP4A 5F63A 4YK0A 2L5EA 5FE5A 1X4UA 4QEWA 3FL2A 4TQNA 3HCUA 4C9ZA 4MR4A 4Q0OA 2L85A 5CUGA 2YELA 5I83A 5IGLA 5A7CA 2PNXA 5EWHA 3UV4A 4A9MA 4ALHA 4QSTA 5C87A 5C13A 5EPRA 3DWYA 5FH8A 3TLPA 4ALGA 4QC1A 3U5PA 1DVPA 1Z2QA 5K29A 4QYLA 3UV5A 4ZUXU 5E9YA 3S92A 4XY8A 5EGUA 2OSSA 5ENBA 3P1FA 5H85A 5IGNA 4LKAA 5CQ8A 2ECTA 2KWOA 3RPGB 5II1A 3N9PA 4QSPA 5A85A 3KQIA 4IORA 5J0DA 5E74A 1CHCA 4N4HA 1VYXA 1EQFA 2WP2A 3D7CA 4HXLA 4TYLA 4WZ2A 1WUMA 4NR8A 2ECJA 2ZETC 4HBWA 2M6MA 3RPGC 4A9JA 5D3NA 5KU3A 3MUKA 4YH3A 4A9IA 4WIVA 3N9OA 5HRWA 2PUYA 4LC2A 2L43A 4CUUA 2E6SA 4TT4A 3ZVZB 4NUEA 5LVQA 4WA6A 4UYEA 2YREA 1E4UA 5D24A 5C11A 3N9LA 5CUAA 4I7CA 2IDAA 4S3OB 5HENA 4NR4A 2MNZA 5LKUA 2KGGA 5DY7A 3SOXA 5DX4A 5EV9A 1F62A 4QEUA 5EISA 5IBNA 5J3XA 4QB3A 3G0JA 1VFYA 4AKNA 5B8DA 4UIWA 4FO9A 5HFQA 5BT5A 5AITA 1WEUA 2KWKA 3HCSA 3T7LA 4O76A 4NQMA 5EM3A 4A9HA 5KTXA 5IIDA 4UIUA 4FIPA 3UV2A 3MHSA 5I80A 2UZGA 5FE0A 5CQ5A 2QICA 3ZYQA 4IC2A 3M62A 2K16A 2L0BA 4O7FA 2YHNA 4NRCA 2DATA 4MEPA 2Y43A 4B7YC 2HDPA 4UIXA 4YADA 4LYWA 4KV4A 2QIZA 4NYWA 4XUBA 3KV6A 2I50A 4XYAA 4MEOA 2YEKA 2YW5A 3G0LA 4O71A 5E73A 5FFYA 5IGKA 4YYDA 4HXOA 2KU3A 4QSXA 2OO1A 4PS5A 4Z1SA 3O34A 2OXQC 4IR4A 5C89A 3UW9A 5AIUA 4OGIA 3QZSA 5AD3A 3C6WA 4V3KC 4IR6A 4A9FA 1WEMA 3IHPA 1G25A 1V87A 2VPBA 1JM7B 2E6RA 4O70A 2H0DB 5EP7A 2KYUA 3KV5A 5B77A 5FE4A 2VPGA 2LN0A 4PTBA 2NAAA 4KCXA 5CGPA 5JG6A 2EGPA 5F60A 4QUUA 5H9MA 5HQ7A 1WGMA 4O7AA 2YHOA 2R0YA 3U5NA 4A9LA 4RVRA 2RI7A 2E7NA 2XB1A 1F68A 5H1UA 5HCLA 2DVQA 4YYJA 3P1EA 3N9MA 5F3AA 3O35A 5A83A 3MXFA 3RTRB 4A4BA 4A9NA 5C4QA 5D0CA 1LDJB 4CCGX 5HM0A 4NRBA 4MENA 4GNDA 5C85A 5EI4A 4NXJA 3I3JA 4Z6IA 2MIQA 5DYUA 4NN2A 5CTLA 5CP5A 2G6QA 4UYFA 4XUAA 5E9LA 4LZSA 2FSAA 5CQ6A 3LRQA 2YQMA 1K2FA 4NR6A 5D25A 4YY6A 2I7KA 4J1PA 4QC3A 4NR9A 5ETDA 5FE6A 1U6GB 3LQHA 4NS5A 4LK9A 4QF3A 5D1MB 3JVJA 5E7DA 4TT6A 4E96A 4YH4A 5FBXA 5HFRA 2LXPC 5FFWA 2H60A 1FP0A 3O70A 4R8PK 1VD4A 3MQMA 5TRBA 4NR7A 5E9KA 2G4AA 4QSWA 2Y1NA 5HEMA 3EB6A 2YDWA 3RCWA 2RNXA 5IG6A 5DW2A 4B86C 4MSXA 4CUSA 1WEOA 2MNYA 5HQ5A 5DKHA 5KH3A 4LZRA 4IOQA 1WILA 5HQ6A 2VJEA 4NUCA 3L11A 5EPSA 2AN6A 4ZW1A 3PUQA 5L8TA 5TDRA 5LKXA 5EYAF 2YEMA 5G05B 4AYCB 5LJ1A 5I3LA 5C8GA 5A5QA 2L5UA 3N9NA 2RNYA 4R2YA 4YATA 2KREA 2YUCA 1WEWA 5D3LA 4BBQA 2VPEA 3Q2FA 2VJFB 4UI9B 4HXPA 4UP0A 5A5SA 3EB5A 5CZGA 5CUBA 4HBVA 5LKTA 4AVXA 4GNEA 5FB1A 5EWVA 4LYIA 5E3GA 4MVTA 1HYJA 4XI1A 2K4DA 4J0SA 2DWWA 2L80A 5E9VA 4FLPA 4QSVA 2YW8A 3AADA 2RFJA 3PURA 5FE9A 5I40A 5CU8A 5TCMA 3DQVR 5LVRA 2YURA 2F6NA 5D3HA 1JSPB 5CQTA 4O78A 2YT5A 5H1VA 5BT4A 5FE8A 1X4JA 2F42A 4QUTA 2DVSA 2D82A 3HMFA 2R10A 4YYHA 5D1KB 5AD2A 5FERA 1WENA 4YYIA 5DFBA 5EWDA 2QJ0A 1XWHA 4W4UA 2CSYA 1WFKA 5E3DA 3L1XA 5FDZA 1WIMA 4HXMA 2ECNA 4L7XA 3ZVYA 5D3PA 4QR3A 5F25A 5L99A 5ENGA 3PHDA 1WESA 4CURA 5A5RA 5L98A 4UP5A 4YC9A 5HLSA 4BHWA 4LYSA 1BORA 5HELA 2JMDA 2LGVA 4YYKA 4IR3A 5CUCA 5F1HA 5A5OA 5L8UA 5DINA 3NXBA 1N87A 5D1LB 4ZDTA 3K2JA 4TKPB 2RSDA 3MB4A 5A5NA 4YY4A 5D7XA 3ASLA 5FG4A 4HXNA 2LGLA 3U5KA 1FBVA 3VK6A 5LKZA 2MD7B 5LCWB 4CA1A 4C67A 3AQAA 4HBXA 4MR5A 4F52B 4WZ3B 2M3HA 4UYFB 4N4FA 5B75A 2CT2A 3ZYUA 2FUIA 4Z93A 2VNFA 5DKDA 4P5OB 4UYDA 5DW1A 1X0JA 3UVDA 2I8NA 4HXRA 1RMDA 2K17A 4FJCA 4TS8A 4QSSA 4X3GA 4CUPA 2DVVA 1E6IA 5DBMA 5I7XA 3FKMX 2ECVA 4AUQB 2VPDA 5KTWA 5B79A 4QZSA 4BW2A 3JVKA 4DONA 4WHWA 5CPEA 4GNFA 3GL6A 3JVMA 3N9QA 3UVXA 5KO4A 4Q0NA 5CQ4A 5LJ2A 5L96A 2C2LA 2CSZA 2YSMA 1IYMA 1ZBDB 4YBTA 4A49A 2MT5A 4LJNA 2MD8C 4TZ2A 2GRCA 4R7EA 3ZTGA 2RS9B 2KWNA 2YQDA 4N4GA 4CUQA 5H1TA 5HRVA 2EODA 3M63A 2VJEB 4ZQLA 5KHMA 3LQJA 4CFKA 4GB0A 5FEYA 2LXHC 4CFLA 2YQLA 1WEQA 4LDFA 4OGJA 3QZTA 3SVFA 4QNSA 4LRGA 4YBMA 4QR4A 2M85A 4PPEA 4PCIA 3HCTA 5DYAA 2E3KA 4HBYA 4OUFA 3M99A 3P5OA 2XEUA 5EPBA 4UIYA 2D8SA 2M1RA 4QSRA 5JWMA 5ENFA 1Z60A 2YSJA 2KR4A 1JOCA 5ENHA 4A9OA 5EA1A 4NR5A 5I86A 2E7OA 5DYXA 2CKLA 4BW3A 4YYGA 3LXJA 5CUEA 3QZVA 3LJWA 3GG3A 4UYHA 1Z6UA 2JMJA 5F36A 4O7CA 4PY6A 3KNVA 4Q6FA 3P1DA 5I7YA 2MJVB 5I88A 2C2VS 3JVLA 5DLZA 5FE3A 5EWWA 5F2PA 4CUTA 3V43A 5HJCA 3O7AA 2YYNA 2DKWA 4TU4A 4BW4A 1WEPA 4HXKA 2LGGA 3DAIA 5E0RA 5G0FA 2YU4A 4BJXA 4UITA 3NG2A 4CL9A 1X4IA 2HYED 4IC3A 4Z6HA 5KTUA 4N3WA 2N9GA 5JI8A 5AMFA 5AMEA 3U5MA 5FFVA 5CRMA 2MA6A 1N72A 1T1HA 4YABA 3U5JA 2FUUA 4A0CD 4QEVA 1JM4B 5LJ0A 3SOUA 2EA6A 4NYXA 5FE1A 4Z1QA 2VP7A 5B78A 5CRZA 4N4IA 2WP1A 5A81A 3UVYA 2BAYA 4A9KA 2Y1MA 4LADB 4PKLA 4J3IA 3MULA 5DYCA 2D9EA 5BT3A 1LDKC 5FH7A 5EU1A 3MB3A 4O77A 3Q2EA 1WE9A 4X2IA 4NRAA 4NYVA 5ENIA 4YBSA 5EK9A 4F3IA 2ECWA 3SHBA 5FE2A 2KIZA 5TDWA 5ETBA 5G4SA 2NXBA 5TABA 4O64A 5II2A 4I7BA 4QR5A 4IOOA 3O36A 2LV9A 4AYCA 4HXSA 2JRJA 3U5LA 5D26A 5I89A 5A82A 5FG6A 1WEVA 2KGIA 4LLBA 4S3OC 2LRIC 5E9IA 5TB6A 2L84A 2KWJA 2G43A 4QSQA 5DKAA 5D3TA 5FH6A 5DFCA 1WEEA 2VJFA 5DKCA 2R0SA 2LSPB 5EQ1A 5A5PA 2ECGA 5C7NA 5G4RA 5G04B 4KV1A 5D3SA 4FK5A 3LQIA 4YYMA 4C66A 5CS8A 1MM3A 2KFTA 4I7DA 3T6RA 2G45A 3L1ZB 5E9MA 1WUGA 5EVAA 4UIZA 3SVGA 4TT2A 4L58A 4O7BA 4MR3A 3SVHA 2F6JA 4XY9A 4QY4A 5CY9A 4TZ8A 2MA5A 4IR5A 4V3LC 5TBNA 3ONIA 5KH9A 2DX8A 3O37A 2RNWA 2ECIA 3SOWA 3HTKC 4A9EA 5HRXA 4PCEA 2RO1A 3HMHA 4LR6A 5IGMA 4UYGA 4MEQA 5ENJA 5F61A 5F5ZA 2LQ6A 4NQNA 5EWCA 4QYDA 4J0RA 1ZS5A 4LZ2A 4UIVA 5FG5A 5CQ3A 4QF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV4 A;  2CKL B;  3ZPV 1;  4O75 A;  1HYI A;  3IU6 A;  4CLB A;  2YYR A;  5I1Q A;  2KE1 A;  3O33 A;  2L75 A;  3DPL R;  2R0V A;  5CFW A;  4Y03 A;  5D3R A;  5F62 A;  3S91 A;  5DFD A;  4O7E A;  3P1C A;  4TTE A;  3C5K A;  5KH7 A;  5F1L A;  1MM2 A;  2LDR A;  4QBM A;  5L97 A;  4TU6 A;  3ZPV E;  2KTB B;  5CQA A;  2DVR A;  4NUD A;  3U5O A;  4MR6 A;  2K1J A;  4ZC9 A;  4BW1 A;  5CQ7 A;  4WZ0 A;  4YYN A;  4GNG A;  5ENC A;  4WHU A;  5CUD A;  4YAX A;  5COI A;  2LGK A;  2OUO A;  1JM7 A;  5ACY A;  5EIC A;  4O72 A;  2H0D A;  5I29 A;  3UVW A;  4QSU A;  5FE7 A;  5B76 A;  5LUU A;  3MHH A;  2JMI A;  4GPJ A;  4O74 A;  5ENE A;  3ZNI A;  5DLX A;  4A4C A;  3HME A;  3I2D A;  2MUM A;  5FB0 A;  3IU5 A;  5D3J A;  4AP4 A;  5F63 A;  4YK0 A;  2L5E A;  5FE5 A;  1X4U A;  4QEW A;  3FL2 A;  4TQN A;  3HCU A;  4C9Z A;  4MR4 A;  4Q0O A;  2L85 A;  5CUG A;  2YEL A;  5I83 A;  5IGL A;  5A7C A;  2PNX A;  5EWH A;  3UV4 A;  4A9M A;  4ALH A;  4QST A;  5C87 A;  5C13 A;  5EPR A;  3DWY A;  5FH8 A;  3TLP A;  4ALG A;  4QC1 A;  3U5P A;  1DVP A;  1Z2Q A;  5K29 A;  4QYL A;  3UV5 A;  4ZUX U;  5E9Y A;  3S92 A;  4XY8 A;  5EGU A;  2OSS A;  5ENB A;  3P1F A;  5H85 A;  5IGN A;  4LKA A;  5CQ8 A;  2ECT A;  2KWO A;  3RPG B;  5II1 A;  3N9P A;  4QSP A;  5A85 A;  3KQI A;  4IOR A;  5J0D A;  5E74 A;  1CHC A;  4N4H A;  1VYX A;  1EQF A;  2WP2 A;  3D7C A;  4HXL A;  4TYL A;  4WZ2 A;  1WUM A;  4NR8 A;  2ECJ A;  2ZET C;  4HBW A;  2M6M A;  3RPG C;  4A9J A;  5D3N A;  5KU3 A;  3MUK A;  4YH3 A;  4A9I A;  4WIV A;  3N9O A;  5HRW A;  2PUY A;  4LC2 A;  2L43 A;  4CUU A;  2E6S A;  4TT4 A;  3ZVZ B;  4NUE A;  5LVQ A;  4WA6 A;  4UYE A;  2YRE A;  1E4U A;  5D24 A;  5C11 A;  3N9L A;  5CUA A;  4I7C A;  2IDA A;  4S3O B;  5HEN A;  4NR4 A;  2MNZ A;  5LKU A;  2KGG A;  5DY7 A;  3SOX A;  5DX4 A;  5EV9 A;  1F62 A;  4QEU A;  5EIS A;  5IBN A;  5J3X A;  4QB3 A;  3G0J A;  1VFY A;  4AKN A;  5B8D A;  4UIW A;  4FO9 A;  5HFQ A;  5BT5 A;  5AIT A;  1WEU A;  2KWK A;  3HCS A;  3T7L A;  4O76 A;  4NQM A;  5EM3 A;  4A9H A;  5KTX A;  5IID A;  4UIU A;  4FIP A;  3UV2 A;  3MHS A;  5I80 A;  2UZG A;  5FE0 A;  5CQ5 A;  2QIC A;  3ZYQ A;  4IC2 A;  3M62 A;  2K16 A;  2L0B A;  4O7F A;  2YHN A;  4NRC A;  2DAT A;  4MEP A;  2Y43 A;  4B7Y C;  2HDP A;  4UIX A;  4YAD A;  4LYW A;  4KV4 A;  2QIZ A;  4NYW A;  4XUB A;  3KV6 A;  2I50 A;  4XYA A;  4MEO A;  2YEK A;  2YW5 A;  3G0L A;  4O71 A;  5E73 A;  5FFY A;  5IGK A;  4YYD A;  4HXO A;  2KU3 A;  4QSX A;  2OO1 A;  4PS5 A;  4Z1S A;  3O34 A;  2OXQ C;  4IR4 A;  5C89 A;  3UW9 A;  5AIU A;  4OGI A;  3QZS A;  5AD3 A;  3C6W A;  4V3K C;  4IR6 A;  4A9F A;  1WEM A;  3IHP A;  1G25 A;  1V87 A;  2VPB A;  1JM7 B;  2E6R A;  4O70 A;  2H0D B;  5EP7 A;  2KYU A;  3KV5 A;  5B77 A;  5FE4 A;  2VPG A;  2LN0 A;  4PTB A;  2NAA A;  4KCX A;  5CGP A;  5JG6 A;  2EGP A;  5F60 A;  4QUU A;  5H9M A;  5HQ7 A;  1WGM A;  4O7A A;  2YHO A;  2R0Y A;  3U5N A;  4A9L A;  4RVR A;  2RI7 A;  2E7N A;  2XB1 A;  1F68 A;  5H1U A;  5HCL A;  2DVQ A;  4YYJ A;  3P1E A;  3N9M A;  5F3A A;  3O35 A;  5A83 A;  3MXF A;  3RTR B;  4A4B A;  4A9N A;  5C4Q A;  5D0C A;  1LDJ B;  4CCG X;  5HM0 A;  4NRB A;  4MEN A;  4GND A;  5C85 A;  5EI4 A;  4NXJ A;  3I3J A;  4Z6I A;  2MIQ A;  5DYU A;  4NN2 A;  5CTL A;  5CP5 A;  2G6Q A;  4UYF A;  4XUA A;  5E9L A;  4LZS A;  2FSA A;  5CQ6 A;  3LRQ A;  2YQM A;  1K2F A;  4NR6 A;  5D25 A;  4YY6 A;  2I7K A;  4J1P A;  4QC3 A;  4NR9 A;  5ETD A;  5FE6 A;  1U6G B;  3LQH A;  4NS5 A;  4LK9 A;  4QF3 A;  5D1M B;  3JVJ A;  5E7D A;  4TT6 A;  4E96 A;  4YH4 A;  5FBX A;  5HFR A;  2LXP C;  5FFW A;  2H60 A;  1FP0 A;  3O70 A;  4R8P K;  1VD4 A;  3MQM A;  5TRB A;  4NR7 A;  5E9K A;  2G4A A;  4QSW A;  2Y1N A;  5HEM A;  3EB6 A;  2YDW A;  3RCW A;  2RNX A;  5IG6 A;  5DW2 A;  4B86 C;  4MSX A;  4CUS A;  1WEO A;  2MNY A;  5HQ5 A;  5DKH A;  5KH3 A;  4LZR A;  4IOQ A;  1WIL A;  5HQ6 A;  2VJE A;  4NUC A;  3L11 A;  5EPS A;  2AN6 A;  4ZW1 A;  3PUQ A;  5L8T A;  5TDR A;  5LKX A;  5EYA F;  2YEM A;  5G05 B;  4AYC B;  5LJ1 A;  5I3L A;  5C8G A;  5A5Q A;  2L5U A;  3N9N A;  2RNY A;  4R2Y A;  4YAT A;  2KRE A;  2YUC A;  1WEW A;  5D3L A;  4BBQ A;  2VPE A;  3Q2F A;  2VJF B;  4UI9 B;  4HXP A;  4UP0 A;  5A5S A;  3EB5 A;  5CZG A;  5CUB A;  4HBV A;  5LKT A;  4AVX A;  4GNE A;  5FB1 A;  5EWV A;  4LYI A;  5E3G A;  4MVT A;  1HYJ A;  4XI1 A;  2K4D A;  4J0S A;  2DWW A;  2L80 A;  5E9V A;  4FLP A;  4QSV A;  2YW8 A;  3AAD A;  2RFJ A;  3PUR A;  5FE9 A;  5I40 A;  5CU8 A;  5TCM A;  3DQV R;  5LVR A;  2YUR A;  2F6N A;  5D3H A;  1JSP B;  5CQT A;  4O78 A;  2YT5 A;  5H1V A;  5BT4 A;  5FE8 A;  1X4J A;  2F42 A;  4QUT A;  2DVS A;  2D82 A;  3HMF A;  2R10 A;  4YYH A;  5D1K B;  5AD2 A;  5FER A;  1WEN A;  4YYI A;  5DFB A;  5EWD A;  2QJ0 A;  1XWH A;  4W4U A;  2CSY A;  1WFK A;  5E3D A;  3L1X A;  5FDZ A;  1WIM A;  4HXM A;  2ECN A;  4L7X A;  3ZVY A;  5D3P A;  4QR3 A;  5F25 A;  5L99 A;  5ENG A;  3PHD A;  1WES A;  4CUR A;  5A5R A;  5L98 A;  4UP5 A;  4YC9 A;  5HLS A;  4BHW A;  4LYS A;  1BOR A;  5HEL A;  2JMD A;  2LGV A;  4YYK A;  4IR3 A;  5CUC A;  5F1H A;  5A5O A;  5L8U A;  5DIN A;  3NXB A;  1N87 A;  5D1L B;  4ZDT A;  3K2J A;  4TKP B;  2RSD A;  3MB4 A;  5A5N A;  4YY4 A;  5D7X A;  3ASL A;  5FG4 A;  4HXN A;  2LGL A;  3U5K A;  1FBV A;  3VK6 A;  5LKZ A;  2MD7 B;  5LCW B;  4CA1 A;  4C67 A;  3AQA A;  4HBX A;  4MR5 A;  4F52 B;  4WZ3 B;  2M3H A;  4UYF B;  4N4F A;  5B75 A;  2CT2 A;  3ZYU A;  2FUI A;  4Z93 A;  2VNF A;  5DKD A;  4P5O B;  4UYD A;  5DW1 A;  1X0J A;  3UVD A;  2I8N A;  4HXR A;  1RMD A;  2K17 A;  4FJC A;  4TS8 A;  4QSS A;  4X3G A;  4CUP A;  2DVV A;  1E6I A;  5DBM A;  5I7X A;  3FKM X;  2ECV A;  4AUQ B;  2VPD A;  5KTW A;  5B79 A;  4QZS A;  4BW2 A;  3JVK A;  4DON A;  4WHW A;  5CPE A;  4GNF A;  3GL6 A;  3JVM A;  3N9Q A;  3UVX A;  5KO4 A;  4Q0N A;  5CQ4 A;  5LJ2 A;  5L96 A;  2C2L A;  2CSZ A;  2YSM A;  1IYM A;  1ZBD B;  4YBT A;  4A49 A;  2MT5 A;  4LJN A;  2MD8 C;  4TZ2 A;  2GRC A;  4R7E A;  3ZTG A;  2RS9 B;  2KWN A;  2YQD A;  4N4G A;  4CUQ A;  5H1T A;  5HRV A;  2EOD A;  3M63 A;  2VJE B;  4ZQL A;  5KHM A;  3LQJ A;  4CFK A;  4GB0 A;  5FEY A;  2LXH C;  4CFL A;  2YQL A;  1WEQ A;  4LDF A;  4OGJ A;  3QZT A;  3SVF A;  4QNS A;  4LRG A;  4YBM A;  4QR4 A;  2M85 A;  4PPE A;  4PCI A;  3HCT A;  5DYA A;  2E3K A;  4HBY A;  4OUF A;  3M99 A;  3P5O A;  2XEU A;  5EPB A;  4UIY A;  2D8S A;  2M1R A;  4QSR A;  5JWM A;  5ENF A;  1Z60 A;  2YSJ A;  2KR4 A;  1JOC A;  5ENH A;  4A9O A;  5EA1 A;  4NR5 A;  5I86 A;  2E7O A;  5DYX A;  2CKL A;  4BW3 A;  4YYG A;  3LXJ A;  5CUE A;  3QZV A;  3LJW A;  3GG3 A;  4UYH A;  1Z6U A;  2JMJ A;  5F36 A;  4O7C A;  4PY6 A;  3KNV A;  4Q6F A;  3P1D A;  5I7Y A;  2MJV B;  5I88 A;  2C2V S;  3JVL A;  5DLZ A;  5FE3 A;  5EWW A;  5F2P A;  4CUT A;  3V43 A;  5HJC A;  3O7A A;  2YYN A;  2DKW A;  4TU4 A;  4BW4 A;  1WEP A;  4HXK A;  2LGG A;  3DAI A;  5E0R A;  5G0F A;  2YU4 A;  4BJX A;  4UIT A;  3NG2 A;  4CL9 A;  1X4I A;  2HYE D;  4IC3 A;  4Z6H A;  5KTU A;  4N3W A;  2N9G A;  5JI8 A;  5AMF A;  5AME A;  3U5M A;  5FFV A;  5CRM A;  2MA6 A;  1N72 A;  1T1H A;  4YAB A;  3U5J A;  2FUU A;  4A0C D;  4QEV A;  1JM4 B;  5LJ0 A;  3SOU A;  2EA6 A;  4NYX A;  5FE1 A;  4Z1Q A;  2VP7 A;  5B78 A;  5CRZ A;  4N4I A;  2WP1 A;  5A81 A;  3UVY A;  2BAY A;  4A9K A;  2Y1M A;  4LAD B;  4PKL A;  4J3I A;  3MUL A;  5DYC A;  2D9E A;  5BT3 A;  1LDK C;  5FH7 A;  5EU1 A;  3MB3 A;  4O77 A;  3Q2E A;  1WE9 A;  4X2I A;  4NRA A;  4NYV A;  5ENI A;  4YBS A;  5EK9 A;  4F3I A;  2ECW A;  3SHB A;  5FE2 A;  2KIZ A;  5TDW A;  5ETB A;  5G4S A;  2NXB A;  5TAB A;  4O64 A;  5II2 A;  4I7B A;  4QR5 A;  4IOO A;  3O36 A;  2LV9 A;  4AYC A;  4HXS A;  2JRJ A;  3U5L A;  5D26 A;  5I89 A;  5A82 A;  5FG6 A;  1WEV A;  2KGI A;  4LLB A;  4S3O C;  2LRI C;  5E9I A;  5TB6 A;  2L84 A;  2KWJ A;  2G43 A;  4QSQ A;  5DKA A;  5D3T A;  5FH6 A;  5DFC A;  1WEE A;  2VJF A;  5DKC A;  2R0S A;  2LSP B;  5EQ1 A;  5A5P A;  2ECG A;  5C7N A;  5G4R A;  5G04 B;  4KV1 A;  5D3S A;  4FK5 A;  3LQI A;  4YYM A;  4C66 A;  5CS8 A;  1MM3 A;  2KFT A;  4I7D A;  3T6R A;  2G45 A;  3L1Z B;  5E9M A;  1WUG A;  5EVA A;  4UIZ A;  3SVG A;  4TT2 A;  4L58 A;  4O7B A;  4MR3 A;  3SVH A;  2F6J A;  4XY9 A;  4QY4 A;  5CY9 A;  4TZ8 A;  2MA5 A;  4IR5 A;  4V3L C;  5TBN A;  3ONI A;  5KH9 A;  2DX8 A;  3O37 A;  2RNW A;  2ECI A;  3SOW A;  3HTK C;  4A9E A;  5HRX A;  4PCE A;  2RO1 A;  3HMH A;  4LR6 A;  5IGM A;  4UYG A;  4MEQ A;  5ENJ A;  5F61 A;  5F5Z A;  2LQ6 A;  4NQN A;  5EWC A;  4QYD A;  4J0R A;  1ZS5 A;  4LZ2 A;  4UIV A;  5FG5 A;  5CQ3 A;  4QF2 A; 
#chains in the Genus database with same CATH topology
 3GV4 A;  2CKL B;  3ZPV 1;  4O75 A;  1HYI A;  3IU6 A;  4CLB A;  2YYR A;  5I1Q A;  2KE1 A;  3O33 A;  3LDY A;  2L75 A;  3DPL R;  2R0V A;  5CFW A;  4Y03 A;  5D3R A;  5F62 A;  3S91 A;  5DFD A;  4O7E A;  3P1C A;  4TTE A;  3C5K A;  3D1D A;  5KH7 A;  5F1L A;  1MM2 A;  2LDR A;  4QBM A;  5L97 A;  4TU6 A;  3ZPV E;  2KTB B;  5CQA A;  2DVR A;  4NUD A;  3U5O A;  5SVX A;  4MR6 A;  2K1J A;  4ZC9 A;  4BW1 A;  5CQ7 A;  4WZ0 A;  4YYN A;  4GNG A;  5ENC A;  4WHU A;  5CUD A;  4YAX A;  5COI A;  2LGK A;  2OUO A;  2OWA A;  1JM7 A;  5ACY A;  5EIC A;  4O72 A;  2H0D A;  5I29 A;  3UVW A;  4QSU A;  5FE7 A;  5B76 A;  5LUU A;  3MHH A;  2JMI A;  4GPJ A;  4O74 A;  5ENE A;  3ZNI A;  5DLX A;  2D8U A;  4A4C A;  3HME A;  3I2D A;  2MUM A;  5FB0 A;  3IU5 A;  5D3J A;  4AP4 A;  5F63 A;  4YK0 A;  2L5E A;  3PLW A;  5FE5 A;  1X4U A;  4QEW A;  3FL2 A;  4TQN A;  3HCU A;  4C9Z A;  4MR4 A;  4Q0O A;  5SVI A;  2L85 A;  5CUG A;  2CON A;  2YEL A;  3D1B A;  5I83 A;  5A7C A;  5IGL A;  5EWH A;  3UV4 A;  2PNX A;  4A9M A;  4ALH A;  4QST A;  5C87 A;  5C13 A;  5EPR A;  3DWY A;  5FH8 A;  3TLP A;  4ALG A;  4QC1 A;  3U5P A;  1DVP A;  1Z2Q A;  5K29 A;  4QYL A;  3UV5 A;  4ZUX U;  5E9Y A;  3S92 A;  4XY8 A;  5EGU A;  2CSV A;  2OSS A;  5ENB A;  3P1F A;  5H85 A;  5IGN A;  4LKA A;  4F1P A;  5CQ8 A;  2ECT A;  2KWO A;  3RPG B;  5II1 A;  3N9P A;  3SUB A;  3FJU B;  4QSP A;  5A85 A;  3KQI A;  4IOR A;  5J0D A;  5E74 A;  1CHC A;  4N4H A;  1VYX A;  1EQF A;  2WP2 A;  3D7C A;  4HXL A;  4TYL A;  4WZ2 A;  1WUM A;  4NR8 A;  2ECJ A;  2ZET C;  4HBW A;  2M6M A;  3RPG C;  3LVR E;  4A9J A;  5D3N A;  5KU3 A;  3MUK A;  4YH3 A;  4A9I A;  4WIV A;  3N9O A;  5HRW A;  2PUY A;  4LC2 A;  2L43 A;  4CUU A;  2E6S A;  4TT4 A;  2XOZ A;  3ZVZ B;  4AKH A;  4NUE A;  5LVQ A;  4WA6 A;  4UYE A;  2YRE A;  1E4U A;  5D24 A;  5C11 A;  2XOC A;  3N9L A;  5CUA A;  4I7C A;  2IDA A;  4S3O B;  5HEN A;  4NR4 A;  2MNZ A;  5LKU A;  2KGG A;  5DY7 A;  3SOX A;  5DX4 A;  5EV9 A;  1F62 A;  4QEU A;  5EIS A;  5IBN A;  5J3X A;  4QB3 A;  3G0J A;  1VFY A;  4Z0R A;  4AKN A;  5B8D A;  4UIW A;  4FO9 A;  5HFQ A;  3FAO A;  5BT5 A;  5AIT A;  1WEU A;  2KWK A;  3HCS A;  3T7L A;  4O76 A;  4NQM A;  5EM3 A;  4A9H A;  5KTX A;  5IID A;  4UIU A;  4FIP A;  3UV2 A;  3MHS A;  5I80 A;  2UZG A;  5FE0 A;  5CQ5 A;  2QIC A;  3ZYQ A;  4IC2 A;  3M62 A;  3E2D A;  2K16 A;  2L0B A;  4O7F A;  2YHN A;  4NRC A;  2DAT A;  4MEP A;  2Y43 A;  4B7Y C;  2HDP A;  4UIX A;  4QQ4 A;  4YAD A;  4LYW A;  3JUE A;  4KV4 A;  2QIZ A;  4NYW A;  2IQJ A;  4XUB A;  3KV6 A;  3LJU X;  2I50 A;  4XYA A;  4MEO A;  2YEK A;  2YW5 A;  3G0L A;  4O71 A;  5E73 A;  5FFY A;  5IGK A;  4YYD A;  2CRR A;  2XP0 A;  4HXO A;  2KU3 A;  4QSX A;  2OO1 A;  4PS5 A;  4Z1S A;  3O34 A;  2OXQ C;  4IR4 A;  3ERR A;  5C89 A;  3UW9 A;  5AIU A;  4OGI A;  3QZS A;  5AD3 A;  3C6W A;  4V3K C;  4IR6 A;  4A9F A;  1WEM A;  3IHP A;  1G25 A;  1V87 A;  2VPB A;  1JM7 B;  2E6R A;  1DCQ A;  4O70 A;  2H0D B;  5EP7 A;  2KYU A;  3KV5 A;  5B77 A;  5FE4 A;  2RR4 A;  2EGM A;  2VPG A;  2LN0 A;  4PTB A;  2NAA A;  4KCX A;  5CGP A;  5JG6 A;  2EGP A;  5F60 A;  4QUU A;  5H9M A;  5HQ7 A;  1WGM A;  4O7A A;  2YHO A;  2R0Y A;  3U5N A;  4A9L A;  4RVR A;  2DSM A;  2RI7 A;  2E7N A;  2XB1 A;  1F68 A;  5H1U A;  5HCL A;  2DVQ A;  4YYJ A;  3P1E A;  3DWD A;  3N9M A;  5F3A A;  3O35 A;  5A83 A;  3MXF A;  3RTR B;  4A4B A;  4A9N A;  5C4Q A;  5D0C A;  1LDJ B;  2P57 A;  4CCG X;  5HM0 A;  4NRB A;  4MEN A;  4GND A;  5C85 A;  5EI4 A;  4NXJ A;  3I3J A;  4Z6I A;  2MIQ A;  5DYU A;  2CRW A;  3T9K A;  4NN2 A;  5CTL A;  3FAN A;  5CP5 A;  2G6Q A;  4UYF A;  4XUA A;  5E9L A;  4LZS A;  2FSA A;  5CQ6 A;  3LRQ A;  2YQM A;  1K2F A;  4NR6 A;  3DDT A;  5D25 A;  4YY6 A;  2I7K A;  4J1P A;  4QC3 A;  4NR9 A;  4OGC A;  5ETD A;  5FE6 A;  1U6G B;  3LQH A;  4NS5 A;  4LK9 A;  4QF3 A;  5D1M B;  3JVJ A;  5E7D A;  2DJA A;  4TT6 A;  4E96 A;  4YH4 A;  5FBX A;  5HFR A;  2LXP C;  5FFW A;  2H60 A;  1FP0 A;  3O70 A;  4H9D A;  4R8P K;  3M7K A;  1VD4 A;  3MQM A;  5TRB A;  4NR7 A;  5E9K A;  2G4A A;  4QSW A;  2Y1N A;  5HEM A;  3EB6 A;  2YDW A;  3RCW A;  2RNX A;  5IG6 A;  5DW2 A;  1MBM A;  4B86 C;  4MSX A;  4CUS A;  1WEO A;  2MNY A;  5HQ5 A;  5DKH A;  5KH3 A;  4LZR A;  4IOQ A;  1WIL A;  2YVR A;  5HQ6 A;  2VJE A;  4NUC A;  3L11 A;  5EPS A;  2AN6 A;  4ZW1 A;  3PUQ A;  5L8T A;  4AKG A;  5TDR A;  5LKX A;  5EYA F;  2YEM A;  5G05 B;  4AYC B;  5LJ1 A;  3VKH A;  5I3L A;  5C8G A;  5A5Q A;  2L5U A;  3N9N A;  3O47 A;  2RNY A;  4R2Y A;  4YAT A;  2KRE A;  2XOY A;  2YUC A;  1WEW A;  5D3L A;  4BBQ A;  2VPE A;  3Q2F A;  2VJF B;  4UI9 B;  4HXP A;  4UP0 A;  5A5S A;  3EB5 A;  5CZG A;  5CUB A;  4Z0O A;  4HBV A;  5LKT A;  4AVX A;  4GNE A;  5FB1 A;  5EWV A;  4LYI A;  5E3G A;  4MVT A;  1HYJ A;  4XI1 A;  2K4D A;  4J0S A;  2DWW A;  3FEH A;  2L80 A;  5E9V A;  4FLP A;  4QSV A;  2YW8 A;  3AAD A;  2RFJ A;  3PUR A;  5FE9 A;  2L7P A;  5I40 A;  5CU8 A;  5TCM A;  3DQV R;  5LVR A;  2YUR A;  2F6N A;  5D3H A;  1JSP B;  5CQT A;  4O78 A;  2YT5 A;  5H1V A;  5BT4 A;  5FE8 A;  1X4J A;  2F42 A;  4QUT A;  2DVS A;  2D82 A;  3HMF A;  2R10 A;  4YYH A;  5D1K B;  5AD2 A;  5SVY A;  5FER A;  1WEN A;  4YYI A;  5DFB A;  5EWD A;  2QJ0 A;  1XWH A;  4O62 A;  4W4U A;  2CSY A;  1WFK A;  5E3D A;  3L1X A;  5FDZ A;  1WIM A;  4HXM A;  2ECN A;  4L7X A;  3ZVY A;  5D3P A;  4QR3 A;  5F25 A;  5L99 A;  5ENG A;  3PHD A;  1WES A;  4CUR A;  5A5R A;  5L98 A;  4UP5 A;  4YC9 A;  5HLS A;  4BHW A;  4LYS A;  1BOR A;  5HEL A;  2JMD A;  2LGV A;  4YYK A;  4IR3 A;  5CUC A;  5F1H A;  5A5O A;  5L8U A;  5DIN A;  3NXB A;  1N87 A;  5D1L B;  4ZDT A;  3K2J A;  4TKP B;  2RSD A;  3MB4 A;  5A5N A;  4YY4 A;  5D7X A;  3ASL A;  5FG4 A;  4HXN A;  2LGL A;  3U5K A;  1FBV A;  2KKY A;  3VK6 A;  5LKZ A;  2MD7 B;  5LCW B;  4CA1 A;  4C67 A;  3AQA A;  5K3Q A;  4HBX A;  4MR5 A;  4F52 B;  4WZ3 B;  2M3H A;  4UYF B;  4N4F A;  4AI6 A;  2FFW A;  5B75 A;  2CT2 A;  3ZYU A;  2FUI A;  4Z93 A;  2VNF A;  5DKD A;  4P5O B;  4UYD A;  5DW1 A;  1X0J A;  3UVD A;  3LVQ E;  2I8N A;  4HXR A;  1RMD A;  2K17 A;  4FJC A;  4TS8 A;  4QSS A;  4X3G A;  4CUP A;  2DVV A;  1E6I A;  5DBM A;  5I7X A;  3FKM X;  2ECV A;  4AUQ B;  2VPD A;  5KTW A;  5B79 A;  4QZS A;  4BW2 A;  3Q1D A;  5SVI B;  3JVK A;  4DON A;  4WHW A;  2LAU A;  5CPE A;  4GNF A;  3GL6 A;  3JVM A;  3N9Q A;  3UVX A;  5KO4 A;  4Q0N A;  5CQ4 A;  5LJ2 A;  5L96 A;  2C2L A;  2CSZ A;  2YSM A;  1IYM A;  2MKE A;  1ZBD B;  4YBT A;  4A49 A;  2MT5 A;  4LJN A;  2MD8 C;  4TZ2 A;  2GRC A;  4R7E A;  3ZTG A;  2RS9 B;  2KWN A;  2YQD A;  4N4G A;  4CUQ A;  5H1T A;  5HRV A;  2EOD A;  3M63 A;  2VJE B;  4ZQL A;  5KHM A;  3LQJ A;  4CFK A;  4GB0 A;  5FEY A;  2LXH C;  4CFL A;  2YQL A;  1WEQ A;  4LDF A;  4OGJ A;  3QZT A;  3SVF A;  4QNS A;  4LRG A;  4YBM A;  4QR4 A;  2M85 A;  4PPE A;  4PCI A;  3HCT A;  5DYA A;  2E3K A;  4HBY A;  4OUF A;  3M99 A;  3P5O A;  2XEU A;  5EPB A;  4UIY A;  2D8S A;  2M1R A;  4QSR A;  5JWM A;  5ENF A;  1Z60 A;  2YSJ A;  2KR4 A;  1JOC A;  5ENH A;  4A9O A;  5EA1 A;  4NR5 A;  5I86 A;  2E7O A;  5DYX A;  2CKL A;  4BW3 A;  4YYG A;  1ZKR A;  3LXJ A;  5CUE A;  3QZV A;  3LJW A;  3GG3 A;  4UYH A;  1Z6U A;  2JMJ A;  5F36 A;  4O7C A;  4PY6 A;  3KNV A;  4Q6F A;  3P1D A;  5I7Y A;  3FM8 C;  2MJV B;  5I88 A;  2C2V S;  3JVL A;  5DLZ A;  5FE3 A;  5EWW A;  5F2P A;  4CUT A;  3V43 A;  5HJC A;  3VKG A;  3O7A A;  2YYN A;  3H7H A;  2DKW A;  2EJN A;  4TU4 A;  4BW4 A;  1WEP A;  4HXK A;  2LGG A;  3DAI A;  5E0R A;  5G0F A;  2YU4 A;  4BJX A;  4UIT A;  3NG2 A;  4CL9 A;  1X4I A;  2HYE D;  4IC3 A;  4Z6H A;  5KTU A;  4N3W A;  2N9G A;  5JI8 A;  5AMF A;  5AME A;  3U5M A;  5FFV A;  5CRM A;  2MA6 A;  1N72 A;  1T1H A;  4YAB A;  3U5J A;  2FUU A;  4A0C D;  4QEV A;  1JM4 B;  5LJ0 A;  3SOU A;  2EA6 A;  4NYX A;  5FE1 A;  4Z1Q A;  2VP7 A;  5B78 A;  2KKX A;  5CRZ A;  4N4I A;  2WP1 A;  5A81 A;  3UVY A;  2BAY A;  4A9K A;  2Y1M A;  4LAD B;  4PKL A;  4J3I A;  3MUL A;  5DYC A;  2D9E A;  5BT3 A;  1LDK C;  5FH7 A;  5EU1 A;  3MB3 A;  4O77 A;  3Q2E A;  1WE9 A;  4X2I A;  2B0O E;  4NRA A;  4NYV A;  5ENI A;  4YBS A;  5EK9 A;  4F3I A;  2ECW A;  3SHB A;  5FE2 A;  2KIZ A;  5TDW A;  5ETB A;  5G4S A;  2NXB A;  5TAB A;  4O64 A;  5II2 A;  4I7B A;  4QR5 A;  4IOO A;  3O36 A;  2LV9 A;  4AYC A;  4HXS A;  2JRJ A;  3U5L A;  5D26 A;  5I89 A;  5A82 A;  5FG6 A;  1WEV A;  2EXU A;  4AKI A;  2KGI A;  4LLB A;  4S3O C;  2M13 A;  2LRI C;  5E9I A;  5TB6 A;  2L84 A;  2KWJ A;  2G43 A;  4QSQ A;  5DKA A;  5D3T A;  5FH6 A;  5DFC A;  1WEE A;  2VJF A;  5DKC A;  2R0S A;  2LSP B;  5EQ1 A;  5A5P A;  2ECG A;  5C7N A;  5G4R A;  5G04 B;  4OGE A;  4KV1 A;  5D3S A;  2E61 A;  2FD4 A;  4FK5 A;  3LQI A;  4YYM A;  4C66 A;  5CS8 A;  1MM3 A;  2KFT A;  4I7D A;  3T6R A;  2G45 A;  1PUO A;  3L1Z B;  5E9M A;  1WUG A;  5EVA A;  4UIZ A;  3SVG A;  4TT2 A;  4L58 A;  4O7B A;  4MR3 A;  3SVH A;  2F6J A;  4XY9 A;  3KDE C;  4QY4 A;  5CY9 A;  4TZ8 A;  2MA5 A;  4IR5 A;  4V3L C;  5TBN A;  3ONI A;  5KH9 A;  2DX8 A;  3O37 A;  2RNW A;  2ECI A;  3SOW A;  3HTK C;  4A9E A;  5HRX A;  4PCE A;  2RO1 A;  3HMH A;  4LR6 A;  5IGM A;  4UYG A;  2JM3 A;  4MEQ A;  5ENJ A;  5F61 A;  3MDB C;  5F5Z A;  2LQ6 A;  4NQN A;  5EWC A;  4QYD A;  4J0R A;  1ZS5 A;  4LZ2 A;  4UIV A;  5FG5 A;  5CQ3 A;  4QF2 A;  2JUN A; 
#chains in the Genus database with same CATH homology
 3GV4 A;  2CKL B;  3ZPV 1;  4O75 A;  1HYI A;  3IU6 A;  4CLB A;  2YYR A;  5I1Q A;  2KE1 A;  3O33 A;  2L75 A;  3DPL R;  2R0V A;  5CFW A;  4Y03 A;  5D3R A;  5F62 A;  3S91 A;  5DFD A;  4O7E A;  3P1C A;  4TTE A;  3C5K A;  5KH7 A;  5F1L A;  1MM2 A;  2LDR A;  4QBM A;  5L97 A;  4TU6 A;  3ZPV E;  2KTB B;  5CQA A;  2DVR A;  4NUD A;  3U5O A;  4MR6 A;  2K1J A;  4ZC9 A;  4BW1 A;  5CQ7 A;  4WZ0 A;  4YYN A;  4GNG A;  5ENC A;  4WHU A;  5CUD A;  4YAX A;  5COI A;  2LGK A;  2OUO A;  1JM7 A;  5ACY A;  5EIC A;  4O72 A;  2H0D A;  5I29 A;  3UVW A;  4QSU A;  5FE7 A;  5B76 A;  5LUU A;  3MHH A;  2JMI A;  4GPJ A;  4O74 A;  5ENE A;  3ZNI A;  5DLX A;  4A4C A;  3HME A;  3I2D A;  2MUM A;  5FB0 A;  3IU5 A;  5D3J A;  4AP4 A;  5F63 A;  4YK0 A;  2L5E A;  5FE5 A;  1X4U A;  4QEW A;  3FL2 A;  4TQN A;  3HCU A;  4C9Z A;  4MR4 A;  4Q0O A;  2L85 A;  5CUG A;  2YEL A;  5I83 A;  5IGL A;  5A7C A;  2PNX A;  5EWH A;  3UV4 A;  4A9M A;  4ALH A;  4QST A;  5C87 A;  5C13 A;  5EPR A;  3DWY A;  5FH8 A;  3TLP A;  4ALG A;  4QC1 A;  3U5P A;  1DVP A;  1Z2Q A;  5K29 A;  4QYL A;  3UV5 A;  4ZUX U;  5E9Y A;  3S92 A;  4XY8 A;  5EGU A;  2OSS A;  5ENB A;  3P1F A;  5H85 A;  5IGN A;  4LKA A;  5CQ8 A;  2ECT A;  2KWO A;  3RPG B;  5II1 A;  3N9P A;  4QSP A;  5A85 A;  3KQI A;  4IOR A;  5J0D A;  5E74 A;  1CHC A;  4N4H A;  1VYX A;  1EQF A;  2WP2 A;  3D7C A;  4HXL A;  4TYL A;  4WZ2 A;  1WUM A;  4NR8 A;  2ECJ A;  2ZET C;  4HBW A;  2M6M A;  3RPG C;  4A9J A;  5D3N A;  5KU3 A;  3MUK A;  4YH3 A;  4A9I A;  4WIV A;  3N9O A;  5HRW A;  2PUY A;  4LC2 A;  2L43 A;  4CUU A;  2E6S A;  4TT4 A;  3ZVZ B;  4NUE A;  5LVQ A;  4WA6 A;  4UYE A;  2YRE A;  1E4U A;  5D24 A;  5C11 A;  3N9L A;  5CUA A;  4I7C A;  2IDA A;  4S3O B;  5HEN A;  4NR4 A;  2MNZ A;  5LKU A;  2KGG A;  5DY7 A;  3SOX A;  5DX4 A;  5EV9 A;  1F62 A;  4QEU A;  5EIS A;  5IBN A;  5J3X A;  4QB3 A;  3G0J A;  1VFY A;  4AKN A;  5B8D A;  4UIW A;  4FO9 A;  5HFQ A;  5BT5 A;  5AIT A;  1WEU A;  2KWK A;  3HCS A;  3T7L A;  4O76 A;  4NQM A;  5EM3 A;  4A9H A;  5KTX A;  5IID A;  4UIU A;  4FIP A;  3UV2 A;  3MHS A;  5I80 A;  2UZG A;  5FE0 A;  5CQ5 A;  2QIC A;  3ZYQ A;  4IC2 A;  3M62 A;  2K16 A;  2L0B A;  4O7F A;  2YHN A;  4NRC A;  2DAT A;  4MEP A;  2Y43 A;  4B7Y C;  2HDP A;  4UIX A;  4YAD A;  4LYW A;  4KV4 A;  2QIZ A;  4NYW A;  4XUB A;  3KV6 A;  2I50 A;  4XYA A;  4MEO A;  2YEK A;  2YW5 A;  3G0L A;  4O71 A;  5E73 A;  5FFY A;  5IGK A;  4YYD A;  4HXO A;  2KU3 A;  4QSX A;  2OO1 A;  4PS5 A;  4Z1S A;  3O34 A;  2OXQ C;  4IR4 A;  5C89 A;  3UW9 A;  5AIU A;  4OGI A;  3QZS A;  5AD3 A;  3C6W A;  4V3K C;  4IR6 A;  4A9F A;  1WEM A;  3IHP A;  1G25 A;  1V87 A;  2VPB A;  1JM7 B;  2E6R A;  4O70 A;  2H0D B;  5EP7 A;  2KYU A;  3KV5 A;  5B77 A;  5FE4 A;  2VPG A;  2LN0 A;  4PTB A;  2NAA A;  4KCX A;  5CGP A;  5JG6 A;  2EGP A;  5F60 A;  4QUU A;  5H9M A;  5HQ7 A;  1WGM A;  4O7A A;  2YHO A;  2R0Y A;  3U5N A;  4A9L A;  4RVR A;  2RI7 A;  2E7N A;  2XB1 A;  1F68 A;  5H1U A;  5HCL A;  2DVQ A;  4YYJ A;  3P1E A;  3N9M A;  5F3A A;  3O35 A;  5A83 A;  3MXF A;  3RTR B;  4A4B A;  4A9N A;  5C4Q A;  5D0C A;  1LDJ B;  4CCG X;  5HM0 A;  4NRB A;  4MEN A;  4GND A;  5C85 A;  5EI4 A;  4NXJ A;  3I3J A;  4Z6I A;  2MIQ A;  5DYU A;  4NN2 A;  5CTL A;  5CP5 A;  2G6Q A;  4UYF A;  4XUA A;  5E9L A;  4LZS A;  2FSA A;  5CQ6 A;  3LRQ A;  2YQM A;  1K2F A;  4NR6 A;  5D25 A;  4YY6 A;  2I7K A;  4J1P A;  4QC3 A;  4NR9 A;  5ETD A;  5FE6 A;  1U6G B;  3LQH A;  4NS5 A;  4LK9 A;  4QF3 A;  5D1M B;  3JVJ A;  5E7D A;  4TT6 A;  4E96 A;  4YH4 A;  5FBX A;  5HFR A;  2LXP C;  5FFW A;  2H60 A;  1FP0 A;  3O70 A;  4R8P K;  1VD4 A;  3MQM A;  5TRB A;  4NR7 A;  5E9K A;  2G4A A;  4QSW A;  2Y1N A;  5HEM A;  3EB6 A;  2YDW A;  3RCW A;  2RNX A;  5IG6 A;  5DW2 A;  4B86 C;  4MSX A;  4CUS A;  1WEO A;  2MNY A;  5HQ5 A;  5DKH A;  5KH3 A;  4LZR A;  4IOQ A;  1WIL A;  5HQ6 A;  2VJE A;  4NUC A;  3L11 A;  5EPS A;  2AN6 A;  4ZW1 A;  3PUQ A;  5L8T A;  5TDR A;  5LKX A;  5EYA F;  2YEM A;  5G05 B;  4AYC B;  5LJ1 A;  5I3L A;  5C8G A;  5A5Q A;  2L5U A;  3N9N A;  2RNY A;  4R2Y A;  4YAT A;  2KRE A;  2YUC A;  1WEW A;  5D3L A;  4BBQ A;  2VPE A;  3Q2F A;  2VJF B;  4UI9 B;  4HXP A;  4UP0 A;  5A5S A;  3EB5 A;  5CZG A;  5CUB A;  4HBV A;  5LKT A;  4AVX A;  4GNE A;  5FB1 A;  5EWV A;  4LYI A;  5E3G A;  4MVT A;  1HYJ A;  4XI1 A;  2K4D A;  4J0S A;  2DWW A;  2L80 A;  5E9V A;  4FLP A;  4QSV A;  2YW8 A;  3AAD A;  2RFJ A;  3PUR A;  5FE9 A;  5I40 A;  5CU8 A;  5TCM A;  3DQV R;  5LVR A;  2YUR A;  2F6N A;  5D3H A;  1JSP B;  5CQT A;  4O78 A;  2YT5 A;  5H1V A;  5BT4 A;  5FE8 A;  1X4J A;  2F42 A;  4QUT A;  2DVS A;  2D82 A;  3HMF A;  2R10 A;  4YYH A;  5D1K B;  5AD2 A;  5FER A;  1WEN A;  4YYI A;  5DFB A;  5EWD A;  2QJ0 A;  1XWH A;  4W4U A;  2CSY A;  1WFK A;  5E3D A;  3L1X A;  5FDZ A;  1WIM A;  4HXM A;  2ECN A;  4L7X A;  3ZVY A;  5D3P A;  4QR3 A;  5F25 A;  5L99 A;  5ENG A;  3PHD A;  1WES A;  4CUR A;  5A5R A;  5L98 A;  4UP5 A;  4YC9 A;  5HLS A;  4BHW A;  4LYS A;  1BOR A;  5HEL A;  2JMD A;  2LGV A;  4YYK A;  4IR3 A;  5CUC A;  5F1H A;  5A5O A;  5L8U A;  5DIN A;  3NXB A;  1N87 A;  5D1L B;  4ZDT A;  3K2J A;  4TKP B;  2RSD A;  3MB4 A;  5A5N A;  4YY4 A;  5D7X A;  3ASL A;  5FG4 A;  4HXN A;  2LGL A;  3U5K A;  1FBV A;  3VK6 A;  5LKZ A;  2MD7 B;  5LCW B;  4CA1 A;  4C67 A;  3AQA A;  4HBX A;  4MR5 A;  4F52 B;  4WZ3 B;  2M3H A;  4UYF B;  4N4F A;  5B75 A;  2CT2 A;  3ZYU A;  2FUI A;  4Z93 A;  2VNF A;  5DKD A;  4P5O B;  4UYD A;  5DW1 A;  1X0J A;  3UVD A;  2I8N A;  4HXR A;  1RMD A;  2K17 A;  4FJC A;  4TS8 A;  4QSS A;  4X3G A;  4CUP A;  2DVV A;  1E6I A;  5DBM A;  5I7X A;  3FKM X;  2ECV A;  4AUQ B;  2VPD A;  5KTW A;  5B79 A;  4QZS A;  4BW2 A;  3JVK A;  4DON A;  4WHW A;  5CPE A;  4GNF A;  3GL6 A;  3JVM A;  3N9Q A;  3UVX A;  5KO4 A;  4Q0N A;  5CQ4 A;  5LJ2 A;  5L96 A;  2C2L A;  2CSZ A;  2YSM A;  1IYM A;  1ZBD B;  4YBT A;  4A49 A;  2MT5 A;  4LJN A;  2MD8 C;  4TZ2 A;  2GRC A;  4R7E A;  3ZTG A;  2RS9 B;  2KWN A;  2YQD A;  4N4G A;  4CUQ A;  5H1T A;  5HRV A;  2EOD A;  3M63 A;  2VJE B;  4ZQL A;  5KHM A;  3LQJ A;  4CFK A;  4GB0 A;  5FEY A;  2LXH C;  4CFL A;  2YQL A;  1WEQ A;  4LDF A;  4OGJ A;  3QZT A;  3SVF A;  4QNS A;  4LRG A;  4YBM A;  4QR4 A;  2M85 A;  4PPE A;  4PCI A;  3HCT A;  5DYA A;  2E3K A;  4HBY A;  4OUF A;  3M99 A;  3P5O A;  2XEU A;  5EPB A;  4UIY A;  2D8S A;  2M1R A;  4QSR A;  5JWM A;  5ENF A;  1Z60 A;  2YSJ A;  2KR4 A;  1JOC A;  5ENH A;  4A9O A;  5EA1 A;  4NR5 A;  5I86 A;  2E7O A;  5DYX A;  2CKL A;  4BW3 A;  4YYG A;  3LXJ A;  5CUE A;  3QZV A;  3LJW A;  3GG3 A;  4UYH A;  1Z6U A;  2JMJ A;  5F36 A;  4O7C A;  4PY6 A;  3KNV A;  4Q6F A;  3P1D A;  5I7Y A;  2MJV B;  5I88 A;  2C2V S;  3JVL A;  5DLZ A;  5FE3 A;  5EWW A;  5F2P A;  4CUT A;  3V43 A;  5HJC A;  3O7A A;  2YYN A;  2DKW A;  4TU4 A;  4BW4 A;  1WEP A;  4HXK A;  2LGG A;  3DAI A;  5E0R A;  5G0F A;  2YU4 A;  4BJX A;  4UIT A;  3NG2 A;  4CL9 A;  1X4I A;  2HYE D;  4IC3 A;  4Z6H A;  5KTU A;  4N3W A;  2N9G A;  5JI8 A;  5AMF A;  5AME A;  3U5M A;  5FFV A;  5CRM A;  2MA6 A;  1N72 A;  1T1H A;  4YAB A;  3U5J A;  2FUU A;  4A0C D;  4QEV A;  1JM4 B;  5LJ0 A;  3SOU A;  2EA6 A;  4NYX A;  5FE1 A;  4Z1Q A;  2VP7 A;  5B78 A;  5CRZ A;  4N4I A;  2WP1 A;  5A81 A;  3UVY A;  2BAY A;  4A9K A;  2Y1M A;  4LAD B;  4PKL A;  4J3I A;  3MUL A;  5DYC A;  2D9E A;  5BT3 A;  1LDK C;  5FH7 A;  5EU1 A;  3MB3 A;  4O77 A;  3Q2E A;  1WE9 A;  4X2I A;  4NRA A;  4NYV A;  5ENI A;  4YBS A;  5EK9 A;  4F3I A;  2ECW A;  3SHB A;  5FE2 A;  2KIZ A;  5TDW A;  5ETB A;  5G4S A;  2NXB A;  5TAB A;  4O64 A;  5II2 A;  4I7B A;  4QR5 A;  4IOO A;  3O36 A;  2LV9 A;  4AYC A;  4HXS A;  2JRJ A;  3U5L A;  5D26 A;  5I89 A;  5A82 A;  5FG6 A;  1WEV A;  2KGI A;  4LLB A;  4S3O C;  2LRI C;  5E9I A;  5TB6 A;  2L84 A;  2KWJ A;  2G43 A;  4QSQ A;  5DKA A;  5D3T A;  5FH6 A;  5DFC A;  1WEE A;  2VJF A;  5DKC A;  2R0S A;  2LSP B;  5EQ1 A;  5A5P A;  2ECG A;  5C7N A;  5G4R A;  5G04 B;  4KV1 A;  5D3S A;  4FK5 A;  3LQI A;  4YYM A;  4C66 A;  5CS8 A;  1MM3 A;  2KFT A;  4I7D A;  3T6R A;  2G45 A;  3L1Z B;  5E9M A;  1WUG A;  5EVA A;  4UIZ A;  3SVG A;  4TT2 A;  4L58 A;  4O7B A;  4MR3 A;  3SVH A;  2F6J A;  4XY9 A;  4QY4 A;  5CY9 A;  4TZ8 A;  2MA5 A;  4IR5 A;  4V3L C;  5TBN A;  3ONI A;  5KH9 A;  2DX8 A;  3O37 A;  2RNW A;  2ECI A;  3SOW A;  3HTK C;  4A9E A;  5HRX A;  4PCE A;  2RO1 A;  3HMH A;  4LR6 A;  5IGM A;  4UYG A;  4MEQ A;  5ENJ A;  5F61 A;  5F5Z A;  2LQ6 A;  4NQN A;  5EWC A;  4QYD A;  4J0R A;  1ZS5 A;  4LZ2 A;  4UIV A;  5FG5 A;  5CQ3 A;  4QF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...