5H1VA

Complex structure of trim24 phd-bromodomain and inhibitor 6
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
169
Chain Sequence
b'NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQESMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 50
structure length 169
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1vA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1vA01
4NRBA 2RNXA 2CSZA 1WGMA 4A9EA 4A9NA 1ZS5A 2KIZA 5AD2A 2LDRA 2G45A 3IU6A 4HXOA 5A81A 1WFKA 3C6WA 3JVLA 4QEUA 5HLSA 5G05B 4TKPB 5C4QA 2CSYA 1ZBDB 2N9GA 3EB5A 5D3SA 3LRQA 4UYFB 4UIUA 2L5UA 2QICA 4AUQB 4E96A 5FE3A 2KGIA 3DQVR 2CKLA 1WEWA 4CUUA 2R0SA 2M85A 4YYHA 5TABA 2KREA 4O77A 4HBXA 4NR6A 5DBMA 4QSXA 4UIWA 3LXJA 5I80A 4CFLA 4F52B 4QUTA 5LJ1A 5FE8A 3O7AA 3HMEA 4O71A 5F62A 1X4IA 4YH4A 3FKMX 4IR6A 2IDAA 2LGVA 5EPSA 3AQAA 5KHMA 4HXRA 1RMDA 3M99A 2L5EA 2VJFB 3PHDA 3FL2A 4Q0NA 2WP2A 4A9HA 4FJCA 4O76A 5E7DA 2I7KA 2R0YA 2YQDA 4A9FA 4F3IA 5LJ0A 4X2IA 2VPBA 1V87A 4I7CA 5LKXA 1JSPB 4QSTA 5CUAA 1U6GB 3DAIA 5HEMA 4NR7A 5II1A 5ACYA 5AIUA 2CKLB 3RTRB 2DVVA 4LR6A 4MR3A 5J0DA 4RVRA 3SVGA 4QSUA 4QZSA 5DX4A 4FO9A 3NXBA 3RCWA 4NYVA 5E0RA 4A9KA 5DKHA 2VPGA 4N4IA 2YURA 3HCSA 3N9OA 5EWCA 3ZYUA 4AP4A 4HXSA 2YEKA 4HBWA 2D9EA 3UVXA 5EM3A 4KCXA 5B78A 4XY9A 5CQ6A 4YYMA 5I7YA 5CUBA 5F5ZA 5I88A 4QSQA 4QBMA 3O35A 4O7FA 5CQ7A 5A5SA 4LADB 1JM7A 3SHBA 1WEOA 2Y1MA 2XEUA 4MSXA 5HFQA 4QEWA 5DYUA 4ZC9A 5L96A 4BW4A 3O37A 2RNWA 4NYWA 5A5NA 5AMFA 2MA6A 3N9NA 3PURA 4YYIA 5FDZA 4QSPA 2Y43A 3LQIA 2OXQC 2KWNA 3P1DA 1WEQA 2K17A 3NG2A 3P1FA 5HRWA 3ZYQA 2MNYA 1K2FA 2OSSA 5COIA 2ECIA 1LDJB 4YATA 4WIVA 4QSWA 5L8TA 5FBXA 4UIVA 3MHSA 5FEYA 4TU6A 3SOXA 2NAAA 2MT5A 4N4FA 4CUSA 5CPEA 4PY6A 5FB0A 5I40A 1XWHA 2EA6A 4IC3A 2KU3A 5B77A 5I3LA 2H60A 4O70A 5KTUA 4LZRA 5DW2A 3GG3A 3ONIA 1WEEA 5D7XA 5FFVA 2JMIA 5TDWA 1VFYA 2KGGA 5A5QA 2FSAA 4AYCA 3RPGB 5EGUA 4BHWA 4Z1SA 3IU5A 1JM7B 4WZ2A 5TCMA 4CUPA 2ECWA 5II2A 4YADA 5DLZA 5EYAF 5B8DA 4LKAA 4YC9A 4UYDA 5ENHA 4BW2A 5IGKA 4Z93A 5HCLA 4R2YA 4A4BA 5EV9A 4Q6FA 1X4UA 2ECTA 5IGLA 4UYHA 3UV5A 4QSVA 4UP5A 5L99A 5DKCA 4IC2A 4MR5A 5CTLA 3UV4A 5EA1A 5LUUA 2LQ6A 2ECVA 5D3HA 5CQAA 5G4SA 4BJXA 4S3OB 5BT5A 5FE6A 4UYEA 2KWOA 5I7XA 2HYED 2M1RA 2RI7A 5HQ5A 4HXPA 4ALHA 4NUCA 3SVFA 4Z1QA 2CT2A 4O64A 5BT3A 2LV9A 3KNVA 4QEVA 4DONA 5D26A 5DLXA 3ZVYA 2VJFA 5HELA 1X0JA 1MM3A 2R0VA 2E6RA 1JM4B 2OUOA 5JWMA 4NXJA 5CS8A 4AYCB 1G25A 4XUAA 3MQMA 2L85A 1Z2QA 5C8GA 2VNFA 4QYLA 1WEUA 5EI4A 5FE4A 4IORA 5F2PA 5FG5A 5CUGA 4ZDTA 3UVDA 4IR3A 5DYXA 4CFKA 2G4AA 5ENJA 5G0FA 2E3KA 1FBVA 3Q2FA 2EGPA 4CURA 1E4UA 2F6JA 4CL9A 5E3DA 2RSDA 4QB3A 5EWHA 5ENIA 4A4CA 2BAYA 2KFTA 5D3LA 4CA1A 5C85A 5LVRA 5H85A 1BORA 2LXHC 4WA6A 2I50A 2RS9B 4B7YC 4NRCA 3PUQA 4OGIA 1WESA 2YQMA 1X4JA 5F36A 1DVPA 3JVJA 5CZGA 5FE2A 1WEPA 5FH7A 1WIMA 4TT4A 5L98A 3U5MA 4YYDA 4O78A 4PCIA 2MUMA 2VP7A 3S91A 5EP7A 1VYXA 2VPEA 4O72A 4YABA 3L11A 5CFWA 4A9JA 5CUCA 2KWJA 3UVYA 1WENA 3U5PA 2AN6A 5D1KB 5DFCA 2JRJA 2RFJA 4AKNA 3DWYA 3C5KA 5IG6A 1N87A 4ZQLA 5I89A 3KV6A 4PKLA 4HXMA 4LYSA 4NS5A 5CRMA 5L97A 2LGLA 4GNDA 5DFBA 5E73A 4X3GA 5EWVA 4MEQA 4YYKA 2VPDA 4I7DA 4P5OB 2KR4A 4A0CD 4QC1A 4QUUA 4UIZA 5E3GA 3HTKC 4V3LC 1JOCA 2FUUA 5E9YA 5ENGA 4A9LA 3MULA 1FP0A 3O33A 5LVQA 4TU4A 5FERA 2MD7B 1MM2A 2MA5A 1Z60A 5TBNA 4KV4A 4C67A 4QNSA 5H1TA 5KH7A 4NR5A 3U5LA 5E9MA 5A83A 3KV5A 4TT2A 4R7EA 4NRAA 5C87A 4GNFA 3I2DA 3MHHA 4UYGA 4Q0OA 4J0SA 2PNXA 4LZSA 2DVQA 5DYCA 5B79A 4C9ZA 2G43A 3MB3A 5LKUA 2E7NA 4HXLA 5D24A 4PS5A 5TB6A 4PTBA 5I86A 4QF3A 1WILA 2G6QA 2K4DA 4N4GA 5D1LB 4LYIA 1VD4A 4IR5A 3N9MA 2MNZA 5D1MB 4LZ2A 5E9IA 2LGGA 5F1LA 3SOWA 3ZNIA 5CQ8A 4N4HA 3T7LA 4XI1A 2DKWA 5G4RA 1HYJA 4C66A 3U5NA 4LYWA 5FB1A 2MJVB 2FUIA 3HCTA 1WUGA 4L58A 4GNEA 4CLBA 5KO4A 4CUQA 5B75A 2KWKA 5JI8A 3U5OA 5C13A 2MD8C 5D3NA 5A5OA 5DW1A 4XUBA 4WZ3B 4WHUA 5A82A 5K29A 3ZPVE 5FE1A 2YHOA 5H1VA 4YBMA 3VK6A 4NQMA 2M3HA 5CGPA 5G04B 4PCEA 5F60A 3UVWA 4MEPA 3UV2A 5HRVA 5EWDA 2OO1A 2YW5A 4TZ2A 2K16A 5KTXA 5KU3A 5LKTA 5D3JA 3M62A 2YEMA 5DY7A 2KTBB 5LCWB 5IGMA 3JVMA 5ETDA 3LJWA 5DINA 4IOQA 4NR9A 4Z6HA 4OUFA 2E6SA 5F3AA 3G0JA 5CP5A 3U5KA 4LRGA 5CRZA 5IGNA 4XY8A 5FE0A 4MVTA 5FFWA 2YYRA 5FE7A 4AVXA 3GV4A 2DWWA 4NR4A 3G0LA 4TTEA 4YY6A 5HJCA 4TQNA 5D3PA 2VJEA 4YAXA 5HENA 5DKDA 1E6IA 3P1CA 5EICA 5CY9A 3O36A 4UP0A 4LK9A 4NYXA 3P1EA 2ECJA 2RNYA 2YU4A 3N9LA 2YHNA 5H1UA 4GNGA 5ENBA 5ENEA 1LDKC 1HYIA 5A5PA 2DVSA 2F6NA 2YW8A 4YH3A 5A7CA 3N9PA 4MR6A 4W4UA 5DKAA 2L80A 2E7OA 3UW9A 5IBNA 4NQNA 4QYDA 4N3WA 2L0BA 4R8PK 4O7EA 5C89A 5BT4A 5D3RA 3N9QA 4YYGA 2NXBA 5CQ3A 3O70A 4FK5A 4UIXA 5FE5A 1EQFA 5A5RA 3MXFA 4HBYA 4O7BA 4QSRA 4PPEA 5FE9A 5J3XA 5AMEA 5FH8A 5FG6A 2DX8A 3HMFA 4IOOA 2DVRA 4Y03A 5CQ4A 5I83A 4QR4A 4OGJA 3JVKA 2JMJA 2QIZA 3L1ZB 4GB0A 4NN2A 2YT5A 4UITA 4J3IA 4O75A 2VJEB 2H0DB 4MENA 1CHCA 4HXNA 2I8NA 2L43A 1T1HA 5AD3A 4TT6A 5DFDA 3QZTA 2YYNA 3D7CA 5F25A 3TLPA 4L7XA 5D0CA 3MB4A 4A9MA 5HQ7A 2Y1NA 3L1XA 5DYAA 5KH3A 4O7AA 2L75A 2KYUA 2UZGA 4ZUXU 5HFRA 5CQ5A 5I29A 3ASLA 4HBVA 3ZTGA 5CUEA 4V3KC 4A49A 4TZ8A 5E9VA 4GPJA 4YBTA 5E74A 3HCUA 3ZVZB 3IHPA 2YUCA 1IYMA 4A9OA 1WEMA 2LRIC 2XB1A 4FLPA 4I7BA 4QR5A 4WZ0A 3SOUA 3MUKA 5D25A 3RPGC 5ETBA 5KTWA 3LQHA 5E9KA 5A85A 3LQJA 3S92A 2ECNA 1N72A 3DPLR 4ALGA 5C11A 5EPBA 2JMDA 4Z6IA 2ECGA 4LLBA 4NUEA 5B76A 5AITA 4IR4A 4ZW1A 4YYJA 4NUDA 4BW1A 2LSPB 2YQLA 5HRXA 3ZPV1 5FFYA 5D3TA 4BW3A 4S3OC 2F42A 5HM0A 4LC2A 5F63A 5I1QA 2DATA 4BBQA 3Q2EA 5CU8A 4HXKA 5EQ1A 2LN0A 4CUTA 4MEOA 1WEVA 2R10A 2YDWA 5EU1A 4YYNA 1Z6UA 4XYAA 5TDRA 1WUMA 4QSSA 2YSJA 5FG4A 5EISA 2C2VS 4B86C 3EB6A 2RO1A 2C2LA 5H9MA 5KH9A 5ENFA 2YELA 2WP1A 5JG6A 4O74A 3KQIA 1WE9A 4J1PA 4QY4A 3QZSA 3QZVA 4YBSA 2LXPC 2YREA 5TRBA 5LKZA 4WHWA 2KE1A 2PUYA 3GL6A 3V43A 5ENCA 4QC3A 5CQTA 5FH6A 4LDFA 2L84A 4FIPA 5LJ2A 3AADA 5F61A 2HDPA 2M6MA 4LJNA 4O7CA 2YSMA 2EODA 4TYLA 2K1JA 5EVAA 4QR3A 5EWWA 3T6RA 3U5JA 2ZETC 1F62A 5E9LA 4UYFA 4UI9B 2D8SA 3O34A 4NR8A 2MIQA 4CCGX 2QJ0A 4YK0A 5EPRA 4J0RA 2D82A 3P5OA 5L8UA 3K2JA 4YY4A 3SVHA 3M63A 3HMHA 4UIYA 5CUDA 5HQ6A 2H0DA 4KV1A 4QF2A 5EK9A 2GRCA 5IIDA 1F68A 2LGKA 3I3JA 5F1HA 4A9IA 5C7NA 4TS8A 4MR4A
chains in the Genus database with same CATH superfamily
4NRBA 2RNXA 2CSZA 1WGMA 4A9EA 4A9NA 1ZS5A 2KIZA 5AD2A 2LDRA 2G45A 3IU6A 4HXOA 5A81A 1WFKA 3C6WA 3JVLA 2MKEA 4QEUA 4F1PA 5HLSA 5G05B 4TKPB 5C4QA 2CSYA 1ZBDB 2N9GA 2KKXA 2IQJA 3EB5A 5D3SA 3LRQA 4UYFB 4UIUA 2L5UA 2QICA 4AUQB 4E96A 5FE3A 2KGIA 3DQVR 2CKLA 1WEWA 4CUUA 2R0SA 2M85A 4YYHA 5TABA 2KREA 2CSVA 4O77A 4HBXA 3VKGA 4NR6A 5DBMA 2P57A 4QSXA 4UIWA 3LXJA 5I80A 4CFLA 3E2DA 4F52B 4QUTA 5LJ1A 5FE8A 2YVRA 3O7AA 3HMEA 4O71A 5F62A 1X4IA 2E61A 4YH4A 3FKMX 4IR6A 2IDAA 2LGVA 5EPSA 3AQAA 5KHMA 4HXRA 1RMDA 3M99A 2FD4A 2L5EA 3FANA 2VJFB 3FAOA 3PHDA 3FL2A 4Q0NA 2WP2A 4A9HA 4FJCA 2XOYA 4O76A 5E7DA 2I7KA 2R0YA 2YQDA 4A9FA 4F3IA 5LJ0A 4X2IA 2KKYA 2VPBA 1V87A 4I7CA 5LKXA 1JSPB 4QSTA 5CUAA 1U6GB 3DAIA 5HEMA 4NR7A 5II1A 5ACYA 5AIUA 4O62A 2CKLB 3RTRB 1ZKRA 2DVVA 4LR6A 4MR3A 5J0DA 4RVRA 3SVGA 4QSUA 4QZSA 5DX4A 4FO9A 3NXBA 3RCWA 4NYVA 5E0RA 4A9KA 5DKHA 2VPGA 4N4IA 2YURA 3HCSA 3N9OA 5EWCA 3ZYUA 3PLWA 4AP4A 4HXSA 2YEKA 4HBWA 2D9EA 3UVXA 5EM3A 4KCXA 5B78A 4XY9A 5CQ6A 4YYMA 5I7YA 5CUBA 2CONA 5F5ZA 4QQ4A 5I88A 4QSQA 4QBMA 3O35A 4O7FA 5CQ7A 5A5SA 2M13A 4LADB 3SHBA 1WEOA 2Y1MA 1JM7A 2XEUA 4MSXA 5HFQA 4QEWA 5DYUA 4ZC9A 5L96A 4BW4A 3O37A 2RNWA 4NYWA 5A5NA 5AMFA 2MA6A 3N9NA 3PURA 4YYIA 5FDZA 3DWDA 4QSPA 2Y43A 3LQIA 2OXQC 2KWNA 3P1DA 1WEQA 2K17A 3NG2A 3P1FA 5HRWA 3ZYQA 2MNYA 1K2FA 2OSSA 5COIA 2ECIA 1LDJB 4YATA 4WIVA 4QSWA 3H7HA 5L8TA 5FBXA 4UIVA 3MHSA 5FEYA 4TU6A 3SOXA 2NAAA 2MT5A 4N4FA 4CUSA 5CPEA 4PY6A 5FB0A 5I40A 1XWHA 2EA6A 4IC3A 2KU3A 5B77A 5I3LA 2H60A 4O70A 2XP0A 5KTUA 4LZRA 5DW2A 3GG3A 3ONIA 1WEEA 5D7XA 5FFVA 2JMIA 5TDWA 1VFYA 2KGGA 5A5QA 3JUEA 2FSAA 4AYCA 3RPGB 5EGUA 4BHWA 4Z1SA 3IU5A 1JM7B 4WZ2A 5TCMA 4CUPA 2ECWA 5SVYA 5II2A 4YADA 5DLZA 5EYAF 3KDEC 5B8DA 4LKAA 4YC9A 4UYDA 5ENHA 4BW2A 5IGKA 4Z93A 5HCLA 4R2YA 4A4BA 5EV9A 4Q6FA 1X4UA 2ECTA 5IGLA 2XOCA 4UYHA 3UV5A 4QSVA 4UP5A 5L99A 5DKCA 4IC2A 4MR5A 5CTLA 3UV4A 2DSMA 5EA1A 5LUUA 2LQ6A 2ECVA 5D3HA 5CQAA 5G4SA 4BJXA 4S3OB 5BT5A 5FE6A 4UYEA 2KWOA 5I7XA 2HYED 2M1RA 2RI7A 5HQ5A 4HXPA 4ALHA 4NUCA 3SVFA 4Z1QA 2CT2A 3DDTA 4O64A 5BT3A 2LV9A 3KNVA 4QEVA 4DONA 5D26A 5DLXA 3ZVYA 2VJFA 5HELA 1X0JA 1MM3A 2EJNA 2R0VA 2E6RA 1JM4B 2OUOA 5JWMA 4NXJA 5CS8A 4AYCB 1G25A 4XUAA 3MQMA 2L85A 1Z2QA 5C8GA 2B0OE 2VNFA 4QYLA 1WEUA 5EI4A 5FE4A 4IORA 5F2PA 5FG5A 5K3QA 5CUGA 4ZDTA 3UVDA 4IR3A 5DYXA 4CFKA 2G4AA 5ENJA 5G0FA 2E3KA 1FBVA 3Q2FA 2EGPA 4CURA 4Z0OA 1E4UA 2F6JA 4CL9A 5E3DA 2RSDA 4QB3A 5EWHA 5ENIA 4A4CA 2BAYA 2KFTA 5D3LA 4CA1A 5C85A 5LVRA 2DJAA 5H85A 1BORA 2LXHC 4WA6A 2I50A 2RS9B 4B7YC 4NRCA 3PUQA 4OGIA 1WESA 2YQMA 1X4JA 5F36A 1DVPA 3JVJA 5CZGA 5FE2A 1WEPA 5FH7A 1WIMA 4TT4A 5L98A 3U5MA 4YYDA 2EGMA 4O78A 4PCIA 2MUMA 2VP7A 3S91A 5EP7A 1VYXA 2VPEA 4O72A 4YABA 3L11A 5CFWA 4A9JA 5CUCA 4AKGA 3UVYA 2KWJA 1WENA 3U5PA 2AN6A 4AKIA 2L7PA 5D1KB 5SVXA 5DFCA 2JRJA 2RFJA 4AKNA 3DWYA 3C5KA 5IG6A 1N87A 4ZQLA 5I89A 2EXUA 3KV6A 3D1BA 4PKLA 5CRMA 4HXMA 4LYSA 4NS5A 5L97A 2LGLA 4GNDA 5DFBA 2CRRA 2XOZA 5E73A 4X3GA 5EWVA 4MEQA 4YYKA 2VPDA 4I7DA 4P5OB 2KR4A 4A0CD 4QC1A 4QUUA 4UIZA 5E3GA 3HTKC 4V3LC 1JOCA 2FUUA 5E9YA 5ENGA 4A9LA 3MULA 1FP0A 3M7KA 3O33A 5LVQA 4TU4A 1MBMA 5FERA 2MD7B 1MM2A 3FM8C 2MA5A 1Z60A 5TBNA 4KV4A 4C67A 4QNSA 5H1TA 5KH7A 4NR5A 3U5LA 2OWAA 5E9MA 5A83A 3KV5A 4TT2A 4R7EA 4NRAA 5C87A 4GNFA 3I2DA 3MHHA 4UYGA 4Q0OA 4J0SA 2PNXA 4LZSA 2DVQA 5DYCA 1PUOA 4C9ZA 2G43A 5B79A 3MB3A 5LKUA 2E7NA 4HXLA 5D24A 4PS5A 5TB6A 4PTBA 5I86A 4QF3A 1WILA 2G6QA 2K4DA 4N4GA 5D1LB 4LYIA 1VD4A 3T9KA 4IR5A 3N9MA 2MNZA 5D1MB 4LZ2A 5E9IA 2LGGA 5F1LA 3SOWA 3ZNIA 5CQ8A 4N4HA 3T7LA 4XI1A 2DKWA 5G4RA 1HYJA 4C66A 3U5NA 4LYWA 5FB1A 2MJVB 2FUIA 3HCTA 5SVIA 1WUGA 4L58A 4GNEA 2JM3A 4CLBA 5KO4A 4CUQA 5B75A 2KWKA 5JI8A 3U5OA 5C13A 2MD8C 5D3NA 5A5OA 5DW1A 4XUBA 4WZ3B 4WHUA 5A82A 5K29A 3ZPVE 5FE1A 2YHOA 5H1VA 4YBMA 3MDBC 3VK6A 4NQMA 2M3HA 5CGPA 5G04B 4PCEA 5F60A 3UVWA 4MEPA 3UV2A 5HRVA 5EWDA 2OO1A 2YW5A 4TZ2A 2K16A 5KTXA 5KU3A 5LKTA 5D3JA 3M62A 2YEMA 5DY7A 2KTBB 5LCWB 5IGMA 3JVMA 5ETDA 3LJWA 5DINA 4IOQA 4NR9A 4Z6HA 4OUFA 2E6SA 5F3AA 3G0JA 5SVIB 5CP5A 3U5KA 4LRGA 5CRZA 5IGNA 4XY8A 4Z0RA 5FE0A 4MVTA 5FFWA 2YYRA 5FE7A 4AVXA 3GV4A 2DWWA 4NR4A 3G0LA 4TTEA 4YY6A 5HJCA 2JUNA 4TQNA 5D3PA 2VJEA 4YAXA 5HENA 5DKDA 2CRWA 4OGEA 1E6IA 3P1CA 5EICA 5CY9A 3O36A 3FEHA 4UP0A 4LK9A 4NYXA 2RR4A 3P1EA 2ECJA 2RNYA 2YU4A 3N9LA 3LVRE 2YHNA 5H1UA 4GNGA 5ENBA 5ENEA 1LDKC 1HYIA 5A5PA 2DVSA 2F6NA 2YW8A 4YH3A 5A7CA 3N9PA 4MR6A 4W4UA 5DKAA 2L80A 2E7OA 3UW9A 5IBNA 4NQNA 4QYDA 4N3WA 2L0BA 4R8PK 4O7EA 5C89A 5BT4A 5D3RA 3N9QA 4YYGA 2NXBA 5CQ3A 4AKHA 3O70A 4FK5A 4UIXA 5FE5A 1EQFA 5A5RA 3MXFA 4HBYA 4O7BA 4QSRA 4PPEA 5FE9A 5J3XA 5AMEA 5FH8A 5FG6A 2DX8A 3HMFA 4IOOA 2DVRA 4Y03A 5CQ4A 5I83A 4QR4A 4OGJA 3JVKA 2JMJA 2QIZA 3L1ZB 4GB0A 4NN2A 2YT5A 4UITA 4J3IA 4O75A 2VJEB 4AI6A 2H0DB 4MENA 1CHCA 4HXNA 2I8NA 2L43A 1T1HA 5AD3A 4TT6A 5DFDA 3QZTA 2YYNA 3D7CA 5F25A 3TLPA 4L7XA 5D0CA 3MB4A 4A9MA 5HQ7A 2Y1NA 3L1XA 5DYAA 5KH3A 4O7AA 2L75A 2KYUA 2UZGA 4ZUXU 5HFRA 3O47A 5CQ5A 5I29A 3FJUB 3ASLA 4HBVA 3ZTGA 5CUEA 4V3KC 4A49A 3LDYA 4TZ8A 5E9VA 4GPJA 4YBTA 5E74A 2LAUA 3HCUA 3ZVZB 3IHPA 2YUCA 1IYMA 4A9OA 1WEMA 2LRIC 2XB1A 4FLPA 4I7BA 4QR5A 4WZ0A 3SOUA 3MUKA 2D8UA 5D25A 3RPGC 5ETBA 5KTWA 3LQHA 5E9KA 5A85A 3SUBA 3LVQE 3LQJA 3S92A 2ECNA 1N72A 3DPLR 4ALGA 5C11A 5EPBA 4OGCA 2JMDA 4Z6IA 2ECGA 4LLBA 4NUEA 5B76A 5AITA 4IR4A 4ZW1A 4YYJA 4NUDA 4BW1A 2LSPB 2YQLA 5HRXA 3ZPV1 5FFYA 5D3TA 4BW3A 4S3OC 2F42A 5HM0A 4LC2A 5F63A 5I1QA 2DATA 4BBQA 3Q2EA 5CU8A 4HXKA 2FFWA 5EQ1A 2LN0A 4CUTA 4MEOA 1WEVA 2R10A 3VKHA 3Q1DA 2YDWA 5EU1A 4YYNA 1Z6UA 4XYAA 5TDRA 1WUMA 4QSSA 2YSJA 5FG4A 5EISA 2C2VS 4B86C 3EB6A 2RO1A 1DCQA 2C2LA 5H9MA 5KH9A 5ENFA 2YELA 2WP1A 5JG6A 4O74A 3KQIA 1WE9A 4J1PA 4QY4A 3QZSA 3QZVA 4YBSA 2LXPC 2YREA 5TRBA 5LKZA 4WHWA 2KE1A 2PUYA 3GL6A 3V43A 5ENCA 4QC3A 5CQTA 5FH6A 4LDFA 2L84A 4FIPA 5LJ2A 3AADA 5F61A 2HDPA 2M6MA 4LJNA 4O7CA 2YSMA 2EODA 4TYLA 2K1JA 5EVAA 4QR3A 5EWWA 3T6RA 3U5JA 2ZETC 1F62A 5E9LA 4UYFA 4UI9B 2D8SA 3O34A 4NR8A 2MIQA 3D1DA 4CCGX 2QJ0A 4YK0A 5EPRA 4J0RA 2D82A 3P5OA 5L8UA 3K2JA 4YY4A 3SVHA 3LJUX 3M63A 3HMHA 4H9DA 4UIYA 5CUDA 5HQ6A 2H0DA 3ERRA 4KV1A 4QF2A 5EK9A 2GRCA 5IIDA 1F68A 2LGKA 3I3JA 5F1HA 4A9IA 5C7NA 4TS8A 4MR4A
chains in the Genus database with same CATH topology
4NRBA 2RNXA 2CSZA 1WGMA 4A9EA 4A9NA 1ZS5A 2KIZA 5AD2A 2LDRA 2G45A 3IU6A 4HXOA 5A81A 1WFKA 3C6WA 3JVLA 4QEUA 5HLSA 5G05B 4TKPB 5C4QA 2CSYA 1ZBDB 2N9GA 3EB5A 5D3SA 3LRQA 4UYFB 4UIUA 2L5UA 2QICA 4AUQB 4E96A 5FE3A 2KGIA 3DQVR 2CKLA 1WEWA 4CUUA 2R0SA 2M85A 4YYHA 5TABA 2KREA 4O77A 4HBXA 4NR6A 5DBMA 4QSXA 4UIWA 3LXJA 5I80A 4CFLA 4F52B 4QUTA 5LJ1A 5FE8A 3O7AA 3HMEA 4O71A 5F62A 1X4IA 4YH4A 3FKMX 4IR6A 2IDAA 2LGVA 5EPSA 3AQAA 5KHMA 4HXRA 1RMDA 3M99A 2L5EA 2VJFB 3PHDA 3FL2A 4Q0NA 2WP2A 4A9HA 4FJCA 4O76A 5E7DA 2I7KA 2R0YA 2YQDA 4A9FA 4F3IA 5LJ0A 4X2IA 2VPBA 1V87A 4I7CA 5LKXA 1JSPB 4QSTA 5CUAA 1U6GB 3DAIA 5HEMA 4NR7A 5II1A 5ACYA 5AIUA 2CKLB 3RTRB 2DVVA 4LR6A 4MR3A 5J0DA 4RVRA 3SVGA 4QSUA 4QZSA 5DX4A 4FO9A 3NXBA 3RCWA 4NYVA 5E0RA 4A9KA 5DKHA 2VPGA 4N4IA 2YURA 3HCSA 3N9OA 5EWCA 3ZYUA 4AP4A 4HXSA 2YEKA 4HBWA 2D9EA 3UVXA 5EM3A 4KCXA 5B78A 4XY9A 5CQ6A 4YYMA 5I7YA 5CUBA 5F5ZA 5I88A 4QSQA 4QBMA 3O35A 4O7FA 5CQ7A 5A5SA 4LADB 1JM7A 3SHBA 1WEOA 2Y1MA 2XEUA 4MSXA 5HFQA 4QEWA 5DYUA 4ZC9A 5L96A 4BW4A 3O37A 2RNWA 4NYWA 5A5NA 5AMFA 2MA6A 3N9NA 3PURA 4YYIA 5FDZA 4QSPA 2Y43A 3LQIA 2OXQC 2KWNA 3P1DA 1WEQA 2K17A 3NG2A 3P1FA 5HRWA 3ZYQA 2MNYA 1K2FA 2OSSA 5COIA 2ECIA 1LDJB 4YATA 4WIVA 4QSWA 5L8TA 5FBXA 4UIVA 3MHSA 5FEYA 4TU6A 3SOXA 2NAAA 2MT5A 4N4FA 4CUSA 5CPEA 4PY6A 5FB0A 5I40A 1XWHA 2EA6A 4IC3A 2KU3A 5B77A 5I3LA 2H60A 4O70A 5KTUA 4LZRA 5DW2A 3GG3A 3ONIA 1WEEA 5D7XA 5FFVA 2JMIA 5TDWA 1VFYA 2KGGA 5A5QA 2FSAA 4AYCA 3RPGB 5EGUA 4BHWA 4Z1SA 3IU5A 1JM7B 4WZ2A 5TCMA 4CUPA 2ECWA 5II2A 4YADA 5DLZA 5EYAF 5B8DA 4LKAA 4YC9A 4UYDA 5ENHA 4BW2A 5IGKA 4Z93A 5HCLA 4R2YA 4A4BA 5EV9A 4Q6FA 1X4UA 2ECTA 5IGLA 4UYHA 3UV5A 4QSVA 4UP5A 5L99A 5DKCA 4IC2A 4MR5A 5CTLA 3UV4A 5EA1A 5LUUA 2LQ6A 2ECVA 5D3HA 5CQAA 5G4SA 4BJXA 4S3OB 5BT5A 5FE6A 4UYEA 2KWOA 5I7XA 2HYED 2M1RA 2RI7A 5HQ5A 4HXPA 4ALHA 4NUCA 3SVFA 4Z1QA 2CT2A 4O64A 5BT3A 2LV9A 3KNVA 4QEVA 4DONA 5D26A 5DLXA 3ZVYA 2VJFA 5HELA 1X0JA 1MM3A 2R0VA 2E6RA 1JM4B 2OUOA 5JWMA 4NXJA 5CS8A 4AYCB 1G25A 4XUAA 3MQMA 2L85A 1Z2QA 5C8GA 2VNFA 4QYLA 1WEUA 5EI4A 5FE4A 4IORA 5F2PA 5FG5A 5CUGA 4ZDTA 3UVDA 4IR3A 5DYXA 4CFKA 2G4AA 5ENJA 5G0FA 2E3KA 1FBVA 3Q2FA 2EGPA 4CURA 1E4UA 2F6JA 4CL9A 5E3DA 2RSDA 4QB3A 5EWHA 5ENIA 4A4CA 2BAYA 2KFTA 5D3LA 4CA1A 5C85A 5LVRA 5H85A 1BORA 2LXHC 4WA6A 2I50A 2RS9B 4B7YC 4NRCA 3PUQA 4OGIA 1WESA 2YQMA 1X4JA 5F36A 1DVPA 3JVJA 5CZGA 5FE2A 1WEPA 5FH7A 1WIMA 4TT4A 5L98A 3U5MA 4YYDA 4O78A 4PCIA 2MUMA 2VP7A 3S91A 5EP7A 1VYXA 2VPEA 4O72A 4YABA 3L11A 5CFWA 4A9JA 5CUCA 2KWJA 3UVYA 1WENA 3U5PA 2AN6A 5D1KB 5DFCA 2JRJA 2RFJA 4AKNA 3DWYA 3C5KA 5IG6A 1N87A 4ZQLA 5I89A 3KV6A 4PKLA 4HXMA 4LYSA 4NS5A 5CRMA 5L97A 2LGLA 4GNDA 5DFBA 5E73A 4X3GA 5EWVA 4MEQA 4YYKA 2VPDA 4I7DA 4P5OB 2KR4A 4A0CD 4QC1A 4QUUA 4UIZA 5E3GA 3HTKC 4V3LC 1JOCA 2FUUA 5E9YA 5ENGA 4A9LA 3MULA 1FP0A 3O33A 5LVQA 4TU4A 5FERA 2MD7B 1MM2A 2MA5A 1Z60A 5TBNA 4KV4A 4C67A 4QNSA 5H1TA 5KH7A 4NR5A 3U5LA 5E9MA 5A83A 3KV5A 4TT2A 4R7EA 4NRAA 5C87A 4GNFA 3I2DA 3MHHA 4UYGA 4Q0OA 4J0SA 2PNXA 4LZSA 2DVQA 5DYCA 5B79A 4C9ZA 2G43A 3MB3A 5LKUA 2E7NA 4HXLA 5D24A 4PS5A 5TB6A 4PTBA 5I86A 4QF3A 1WILA 2G6QA 2K4DA 4N4GA 5D1LB 4LYIA 1VD4A 4IR5A 3N9MA 2MNZA 5D1MB 4LZ2A 5E9IA 2LGGA 5F1LA 3SOWA 3ZNIA 5CQ8A 4N4HA 3T7LA 4XI1A 2DKWA 5G4RA 1HYJA 4C66A 3U5NA 4LYWA 5FB1A 2MJVB 2FUIA 3HCTA 1WUGA 4L58A 4GNEA 4CLBA 5KO4A 4CUQA 5B75A 2KWKA 5JI8A 3U5OA 5C13A 2MD8C 5D3NA 5A5OA 5DW1A 4XUBA 4WZ3B 4WHUA 5A82A 5K29A 3ZPVE 5FE1A 2YHOA 5H1VA 4YBMA 3VK6A 4NQMA 2M3HA 5CGPA 5G04B 4PCEA 5F60A 3UVWA 4MEPA 3UV2A 5HRVA 5EWDA 2OO1A 2YW5A 4TZ2A 2K16A 5KTXA 5KU3A 5LKTA 5D3JA 3M62A 2YEMA 5DY7A 2KTBB 5LCWB 5IGMA 3JVMA 5ETDA 3LJWA 5DINA 4IOQA 4NR9A 4Z6HA 4OUFA 2E6SA 5F3AA 3G0JA 5CP5A 3U5KA 4LRGA 5CRZA 5IGNA 4XY8A 5FE0A 4MVTA 5FFWA 2YYRA 5FE7A 4AVXA 3GV4A 2DWWA 4NR4A 3G0LA 4TTEA 4YY6A 5HJCA 4TQNA 5D3PA 2VJEA 4YAXA 5HENA 5DKDA 1E6IA 3P1CA 5EICA 5CY9A 3O36A 4UP0A 4LK9A 4NYXA 3P1EA 2ECJA 2RNYA 2YU4A 3N9LA 2YHNA 5H1UA 4GNGA 5ENBA 5ENEA 1LDKC 1HYIA 5A5PA 2DVSA 2F6NA 2YW8A 4YH3A 5A7CA 3N9PA 4MR6A 4W4UA 5DKAA 2L80A 2E7OA 3UW9A 5IBNA 4NQNA 4QYDA 4N3WA 2L0BA 4R8PK 4O7EA 5C89A 5BT4A 5D3RA 3N9QA 4YYGA 2NXBA 5CQ3A 3O70A 4FK5A 4UIXA 5FE5A 1EQFA 5A5RA 3MXFA 4HBYA 4O7BA 4QSRA 4PPEA 5FE9A 5J3XA 5AMEA 5FH8A 5FG6A 2DX8A 3HMFA 4IOOA 2DVRA 4Y03A 5CQ4A 5I83A 4QR4A 4OGJA 3JVKA 2JMJA 2QIZA 3L1ZB 4GB0A 4NN2A 2YT5A 4UITA 4J3IA 4O75A 2VJEB 2H0DB 4MENA 1CHCA 4HXNA 2I8NA 2L43A 1T1HA 5AD3A 4TT6A 5DFDA 3QZTA 2YYNA 3D7CA 5F25A 3TLPA 4L7XA 5D0CA 3MB4A 4A9MA 5HQ7A 2Y1NA 3L1XA 5DYAA 5KH3A 4O7AA 2L75A 2KYUA 2UZGA 4ZUXU 5HFRA 5CQ5A 5I29A 3ASLA 4HBVA 3ZTGA 5CUEA 4V3KC 4A49A 4TZ8A 5E9VA 4GPJA 4YBTA 5E74A 3HCUA 3ZVZB 3IHPA 2YUCA 1IYMA 4A9OA 1WEMA 2LRIC 2XB1A 4FLPA 4I7BA 4QR5A 4WZ0A 3SOUA 3MUKA 5D25A 3RPGC 5ETBA 5KTWA 3LQHA 5E9KA 5A85A 3LQJA 3S92A 2ECNA 1N72A 3DPLR 4ALGA 5C11A 5EPBA 2JMDA 4Z6IA 2ECGA 4LLBA 4NUEA 5B76A 5AITA 4IR4A 4ZW1A 4YYJA 4NUDA 4BW1A 2LSPB 2YQLA 5HRXA 3ZPV1 5FFYA 5D3TA 4BW3A 4S3OC 2F42A 5HM0A 4LC2A 5F63A 5I1QA 2DATA 4BBQA 3Q2EA 5CU8A 4HXKA 5EQ1A 2LN0A 4CUTA 4MEOA 1WEVA 2R10A 2YDWA 5EU1A 4YYNA 1Z6UA 4XYAA 5TDRA 1WUMA 4QSSA 2YSJA 5FG4A 5EISA 2C2VS 4B86C 3EB6A 2RO1A 2C2LA 5H9MA 5KH9A 5ENFA 2YELA 2WP1A 5JG6A 4O74A 3KQIA 1WE9A 4J1PA 4QY4A 3QZSA 3QZVA 4YBSA 2LXPC 2YREA 5TRBA 5LKZA 4WHWA 2KE1A 2PUYA 3GL6A 3V43A 5ENCA 4QC3A 5CQTA 5FH6A 4LDFA 2L84A 4FIPA 5LJ2A 3AADA 5F61A 2HDPA 2M6MA 4LJNA 4O7CA 2YSMA 2EODA 4TYLA 2K1JA 5EVAA 4QR3A 5EWWA 3T6RA 3U5JA 2ZETC 1F62A 5E9LA 4UYFA 4UI9B 2D8SA 3O34A 4NR8A 2MIQA 4CCGX 2QJ0A 4YK0A 5EPRA 4J0RA 2D82A 3P5OA 5L8UA 3K2JA 4YY4A 3SVHA 3M63A 3HMHA 4UIYA 5CUDA 5HQ6A 2H0DA 4KV1A 4QF2A 5EK9A 2GRCA 5IIDA 1F68A 2LGKA 3I3JA 5F1HA 4A9IA 5C7NA 4TS8A 4MR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRB A;  2RNX A;  2CSZ A;  1WGM A;  4A9E A;  4A9N A;  1ZS5 A;  2KIZ A;  5AD2 A;  2LDR A;  2G45 A;  3IU6 A;  4HXO A;  5A81 A;  1WFK A;  3C6W A;  3JVL A;  4QEU A;  5HLS A;  5G05 B;  4TKP B;  5C4Q A;  2CSY A;  1ZBD B;  2N9G A;  3EB5 A;  5D3S A;  3LRQ A;  4UYF B;  4UIU A;  2L5U A;  2QIC A;  4AUQ B;  4E96 A;  5FE3 A;  2KGI A;  3DQV R;  2CKL A;  1WEW A;  4CUU A;  2R0S A;  2M85 A;  4YYH A;  5TAB A;  2KRE A;  4O77 A;  4HBX A;  4NR6 A;  5DBM A;  4QSX A;  4UIW A;  3LXJ A;  5I80 A;  4CFL A;  4F52 B;  4QUT A;  5LJ1 A;  5FE8 A;  3O7A A;  3HME A;  4O71 A;  5F62 A;  1X4I A;  4YH4 A;  3FKM X;  4IR6 A;  2IDA A;  2LGV A;  5EPS A;  3AQA A;  5KHM A;  4HXR A;  1RMD A;  3M99 A;  2L5E A;  2VJF B;  3PHD A;  3FL2 A;  4Q0N A;  2WP2 A;  4A9H A;  4FJC A;  4O76 A;  5E7D A;  2I7K A;  2R0Y A;  2YQD A;  4A9F A;  4F3I A;  5LJ0 A;  4X2I A;  2VPB A;  1V87 A;  4I7C A;  5LKX A;  1JSP B;  4QST A;  5CUA A;  1U6G B;  3DAI A;  5HEM A;  4NR7 A;  5II1 A;  5ACY A;  5AIU A;  2CKL B;  3RTR B;  2DVV A;  4LR6 A;  4MR3 A;  5J0D A;  4RVR A;  3SVG A;  4QSU A;  4QZS A;  5DX4 A;  4FO9 A;  3NXB A;  3RCW A;  4NYV A;  5E0R A;  4A9K A;  5DKH A;  2VPG A;  4N4I A;  2YUR A;  3HCS A;  3N9O A;  5EWC A;  3ZYU A;  4AP4 A;  4HXS A;  2YEK A;  4HBW A;  2D9E A;  3UVX A;  5EM3 A;  4KCX A;  5B78 A;  4XY9 A;  5CQ6 A;  4YYM A;  5I7Y A;  5CUB A;  5F5Z A;  5I88 A;  4QSQ A;  4QBM A;  3O35 A;  4O7F A;  5CQ7 A;  5A5S A;  4LAD B;  1JM7 A;  3SHB A;  1WEO A;  2Y1M A;  2XEU A;  4MSX A;  5HFQ A;  4QEW A;  5DYU A;  4ZC9 A;  5L96 A;  4BW4 A;  3O37 A;  2RNW A;  4NYW A;  5A5N A;  5AMF A;  2MA6 A;  3N9N A;  3PUR A;  4YYI A;  5FDZ A;  4QSP A;  2Y43 A;  3LQI A;  2OXQ C;  2KWN A;  3P1D A;  1WEQ A;  2K17 A;  3NG2 A;  3P1F A;  5HRW A;  3ZYQ A;  2MNY A;  1K2F A;  2OSS A;  5COI A;  2ECI A;  1LDJ B;  4YAT A;  4WIV A;  4QSW A;  5L8T A;  5FBX A;  4UIV A;  3MHS A;  5FEY A;  4TU6 A;  3SOX A;  2NAA A;  2MT5 A;  4N4F A;  4CUS A;  5CPE A;  4PY6 A;  5FB0 A;  5I40 A;  1XWH A;  2EA6 A;  4IC3 A;  2KU3 A;  5B77 A;  5I3L A;  2H60 A;  4O70 A;  5KTU A;  4LZR A;  5DW2 A;  3GG3 A;  3ONI A;  1WEE A;  5D7X A;  5FFV A;  2JMI A;  5TDW A;  1VFY A;  2KGG A;  5A5Q A;  2FSA A;  4AYC A;  3RPG B;  5EGU A;  4BHW A;  4Z1S A;  3IU5 A;  1JM7 B;  4WZ2 A;  5TCM A;  4CUP A;  2ECW A;  5II2 A;  4YAD A;  5DLZ A;  5EYA F;  5B8D A;  4LKA A;  4YC9 A;  4UYD A;  5ENH A;  4BW2 A;  5IGK A;  4Z93 A;  5HCL A;  4R2Y A;  4A4B A;  5EV9 A;  4Q6F A;  1X4U A;  2ECT A;  5IGL A;  4UYH A;  3UV5 A;  4QSV A;  4UP5 A;  5L99 A;  5DKC A;  4IC2 A;  4MR5 A;  5CTL A;  3UV4 A;  5EA1 A;  5LUU A;  2LQ6 A;  2ECV A;  5D3H A;  5CQA A;  5G4S A;  4BJX A;  4S3O B;  5BT5 A;  5FE6 A;  4UYE A;  2KWO A;  5I7X A;  2HYE D;  2M1R A;  2RI7 A;  5HQ5 A;  4HXP A;  4ALH A;  4NUC A;  3SVF A;  4Z1Q A;  2CT2 A;  4O64 A;  5BT3 A;  2LV9 A;  3KNV A;  4QEV A;  4DON A;  5D26 A;  5DLX A;  3ZVY A;  2VJF A;  5HEL A;  1X0J A;  1MM3 A;  2R0V A;  2E6R A;  1JM4 B;  2OUO A;  5JWM A;  4NXJ A;  5CS8 A;  4AYC B;  1G25 A;  4XUA A;  3MQM A;  2L85 A;  1Z2Q A;  5C8G A;  2VNF A;  4QYL A;  1WEU A;  5EI4 A;  5FE4 A;  4IOR A;  5F2P A;  5FG5 A;  5CUG A;  4ZDT A;  3UVD A;  4IR3 A;  5DYX A;  4CFK A;  2G4A A;  5ENJ A;  5G0F A;  2E3K A;  1FBV A;  3Q2F A;  2EGP A;  4CUR A;  1E4U A;  2F6J A;  4CL9 A;  5E3D A;  2RSD A;  4QB3 A;  5EWH A;  5ENI A;  4A4C A;  2BAY A;  2KFT A;  5D3L A;  4CA1 A;  5C85 A;  5LVR A;  5H85 A;  1BOR A;  2LXH C;  4WA6 A;  2I50 A;  2RS9 B;  4B7Y C;  4NRC A;  3PUQ A;  4OGI A;  1WES A;  2YQM A;  1X4J A;  5F36 A;  1DVP A;  3JVJ A;  5CZG A;  5FE2 A;  1WEP A;  5FH7 A;  1WIM A;  4TT4 A;  5L98 A;  3U5M A;  4YYD A;  4O78 A;  4PCI A;  2MUM A;  2VP7 A;  3S91 A;  5EP7 A;  1VYX A;  2VPE A;  4O72 A;  4YAB A;  3L11 A;  5CFW A;  4A9J A;  5CUC A;  2KWJ A;  3UVY A;  1WEN A;  3U5P A;  2AN6 A;  5D1K B;  5DFC A;  2JRJ A;  2RFJ A;  4AKN A;  3DWY A;  3C5K A;  5IG6 A;  1N87 A;  4ZQL A;  5I89 A;  3KV6 A;  4PKL A;  4HXM A;  4LYS A;  4NS5 A;  5CRM A;  5L97 A;  2LGL A;  4GND A;  5DFB A;  5E73 A;  4X3G A;  5EWV A;  4MEQ A;  4YYK A;  2VPD A;  4I7D A;  4P5O B;  2KR4 A;  4A0C D;  4QC1 A;  4QUU A;  4UIZ A;  5E3G A;  3HTK C;  4V3L C;  1JOC A;  2FUU A;  5E9Y A;  5ENG A;  4A9L A;  3MUL A;  1FP0 A;  3O33 A;  5LVQ A;  4TU4 A;  5FER A;  2MD7 B;  1MM2 A;  2MA5 A;  1Z60 A;  5TBN A;  4KV4 A;  4C67 A;  4QNS A;  5H1T A;  5KH7 A;  4NR5 A;  3U5L A;  5E9M A;  5A83 A;  3KV5 A;  4TT2 A;  4R7E A;  4NRA A;  5C87 A;  4GNF A;  3I2D A;  3MHH A;  4UYG A;  4Q0O A;  4J0S A;  2PNX A;  4LZS A;  2DVQ A;  5DYC A;  5B79 A;  4C9Z A;  2G43 A;  3MB3 A;  5LKU A;  2E7N A;  4HXL A;  5D24 A;  4PS5 A;  5TB6 A;  4PTB A;  5I86 A;  4QF3 A;  1WIL A;  2G6Q A;  2K4D A;  4N4G A;  5D1L B;  4LYI A;  1VD4 A;  4IR5 A;  3N9M A;  2MNZ A;  5D1M B;  4LZ2 A;  5E9I A;  2LGG A;  5F1L A;  3SOW A;  3ZNI A;  5CQ8 A;  4N4H A;  3T7L A;  4XI1 A;  2DKW A;  5G4R A;  1HYJ A;  4C66 A;  3U5N A;  4LYW A;  5FB1 A;  2MJV B;  2FUI A;  3HCT A;  1WUG A;  4L58 A;  4GNE A;  4CLB A;  5KO4 A;  4CUQ A;  5B75 A;  2KWK A;  5JI8 A;  3U5O A;  5C13 A;  2MD8 C;  5D3N A;  5A5O A;  5DW1 A;  4XUB A;  4WZ3 B;  4WHU A;  5A82 A;  5K29 A;  3ZPV E;  5FE1 A;  2YHO A;  5H1V A;  4YBM A;  3VK6 A;  4NQM A;  2M3H A;  5CGP A;  5G04 B;  4PCE A;  5F60 A;  3UVW A;  4MEP A;  3UV2 A;  5HRV A;  5EWD A;  2OO1 A;  2YW5 A;  4TZ2 A;  2K16 A;  5KTX A;  5KU3 A;  5LKT A;  5D3J A;  3M62 A;  2YEM A;  5DY7 A;  2KTB B;  5LCW B;  5IGM A;  3JVM A;  5ETD A;  3LJW A;  5DIN A;  4IOQ A;  4NR9 A;  4Z6H A;  4OUF A;  2E6S A;  5F3A A;  3G0J A;  5CP5 A;  3U5K A;  4LRG A;  5CRZ A;  5IGN A;  4XY8 A;  5FE0 A;  4MVT A;  5FFW A;  2YYR A;  5FE7 A;  4AVX A;  3GV4 A;  2DWW A;  4NR4 A;  3G0L A;  4TTE A;  4YY6 A;  5HJC A;  4TQN A;  5D3P A;  2VJE A;  4YAX A;  5HEN A;  5DKD A;  1E6I A;  3P1C A;  5EIC A;  5CY9 A;  3O36 A;  4UP0 A;  4LK9 A;  4NYX A;  3P1E A;  2ECJ A;  2RNY A;  2YU4 A;  3N9L A;  2YHN A;  5H1U A;  4GNG A;  5ENB A;  5ENE A;  1LDK C;  1HYI A;  5A5P A;  2DVS A;  2F6N A;  2YW8 A;  4YH3 A;  5A7C A;  3N9P A;  4MR6 A;  4W4U A;  5DKA A;  2L80 A;  2E7O A;  3UW9 A;  5IBN A;  4NQN A;  4QYD A;  4N3W A;  2L0B A;  4R8P K;  4O7E A;  5C89 A;  5BT4 A;  5D3R A;  3N9Q A;  4YYG A;  2NXB A;  5CQ3 A;  3O70 A;  4FK5 A;  4UIX A;  5FE5 A;  1EQF A;  5A5R A;  3MXF A;  4HBY A;  4O7B A;  4QSR A;  4PPE A;  5FE9 A;  5J3X A;  5AME A;  5FH8 A;  5FG6 A;  2DX8 A;  3HMF A;  4IOO A;  2DVR A;  4Y03 A;  5CQ4 A;  5I83 A;  4QR4 A;  4OGJ A;  3JVK A;  2JMJ A;  2QIZ A;  3L1Z B;  4GB0 A;  4NN2 A;  2YT5 A;  4UIT A;  4J3I A;  4O75 A;  2VJE B;  2H0D B;  4MEN A;  1CHC A;  4HXN A;  2I8N A;  2L43 A;  1T1H A;  5AD3 A;  4TT6 A;  5DFD A;  3QZT A;  2YYN A;  3D7C A;  5F25 A;  3TLP A;  4L7X A;  5D0C A;  3MB4 A;  4A9M A;  5HQ7 A;  2Y1N A;  3L1X A;  5DYA A;  5KH3 A;  4O7A A;  2L75 A;  2KYU A;  2UZG A;  4ZUX U;  5HFR A;  5CQ5 A;  5I29 A;  3ASL A;  4HBV A;  3ZTG A;  5CUE A;  4V3K C;  4A49 A;  4TZ8 A;  5E9V A;  4GPJ A;  4YBT A;  5E74 A;  3HCU A;  3ZVZ B;  3IHP A;  2YUC A;  1IYM A;  4A9O A;  1WEM A;  2LRI C;  2XB1 A;  4FLP A;  4I7B A;  4QR5 A;  4WZ0 A;  3SOU A;  3MUK A;  5D25 A;  3RPG C;  5ETB A;  5KTW A;  3LQH A;  5E9K A;  5A85 A;  3LQJ A;  3S92 A;  2ECN A;  1N72 A;  3DPL R;  4ALG A;  5C11 A;  5EPB A;  2JMD A;  4Z6I A;  2ECG A;  4LLB A;  4NUE A;  5B76 A;  5AIT A;  4IR4 A;  4ZW1 A;  4YYJ A;  4NUD A;  4BW1 A;  2LSP B;  2YQL A;  5HRX A;  3ZPV 1;  5FFY A;  5D3T A;  4BW3 A;  4S3O C;  2F42 A;  5HM0 A;  4LC2 A;  5F63 A;  5I1Q A;  2DAT A;  4BBQ A;  3Q2E A;  5CU8 A;  4HXK A;  5EQ1 A;  2LN0 A;  4CUT A;  4MEO A;  1WEV A;  2R10 A;  2YDW A;  5EU1 A;  4YYN A;  1Z6U A;  4XYA A;  5TDR A;  1WUM A;  4QSS A;  2YSJ A;  5FG4 A;  5EIS A;  2C2V S;  4B86 C;  3EB6 A;  2RO1 A;  2C2L A;  5H9M A;  5KH9 A;  5ENF A;  2YEL A;  2WP1 A;  5JG6 A;  4O74 A;  3KQI A;  1WE9 A;  4J1P A;  4QY4 A;  3QZS A;  3QZV A;  4YBS A;  2LXP C;  2YRE A;  5TRB A;  5LKZ A;  4WHW A;  2KE1 A;  2PUY A;  3GL6 A;  3V43 A;  5ENC A;  4QC3 A;  5CQT A;  5FH6 A;  4LDF A;  2L84 A;  4FIP A;  5LJ2 A;  3AAD A;  5F61 A;  2HDP A;  2M6M A;  4LJN A;  4O7C A;  2YSM A;  2EOD A;  4TYL A;  2K1J A;  5EVA A;  4QR3 A;  5EWW A;  3T6R A;  3U5J A;  2ZET C;  1F62 A;  5E9L A;  4UYF A;  4UI9 B;  2D8S A;  3O34 A;  4NR8 A;  2MIQ A;  4CCG X;  2QJ0 A;  4YK0 A;  5EPR A;  4J0R A;  2D82 A;  3P5O A;  5L8U A;  3K2J A;  4YY4 A;  3SVH A;  3M63 A;  3HMH A;  4UIY A;  5CUD A;  5HQ6 A;  2H0D A;  4KV1 A;  4QF2 A;  5EK9 A;  2GRC A;  5IID A;  1F68 A;  2LGK A;  3I3J A;  5F1H A;  4A9I A;  5C7N A;  4TS8 A;  4MR4 A; 
#chains in the Genus database with same CATH topology
 4NRB A;  2RNX A;  2CSZ A;  1WGM A;  4A9E A;  4A9N A;  1ZS5 A;  2KIZ A;  5AD2 A;  2LDR A;  2G45 A;  3IU6 A;  4HXO A;  5A81 A;  1WFK A;  3C6W A;  3JVL A;  2MKE A;  4QEU A;  4F1P A;  5HLS A;  5G05 B;  4TKP B;  5C4Q A;  2CSY A;  1ZBD B;  2N9G A;  2KKX A;  2IQJ A;  3EB5 A;  5D3S A;  3LRQ A;  4UYF B;  4UIU A;  2L5U A;  2QIC A;  4AUQ B;  4E96 A;  5FE3 A;  2KGI A;  3DQV R;  2CKL A;  1WEW A;  4CUU A;  2R0S A;  2M85 A;  4YYH A;  5TAB A;  2KRE A;  2CSV A;  4O77 A;  4HBX A;  3VKG A;  4NR6 A;  5DBM A;  2P57 A;  4QSX A;  4UIW A;  3LXJ A;  5I80 A;  4CFL A;  3E2D A;  4F52 B;  4QUT A;  5LJ1 A;  5FE8 A;  2YVR A;  3O7A A;  3HME A;  4O71 A;  5F62 A;  1X4I A;  2E61 A;  4YH4 A;  3FKM X;  4IR6 A;  2IDA A;  2LGV A;  5EPS A;  3AQA A;  5KHM A;  4HXR A;  1RMD A;  3M99 A;  2FD4 A;  2L5E A;  3FAN A;  2VJF B;  3FAO A;  3PHD A;  3FL2 A;  4Q0N A;  2WP2 A;  4A9H A;  4FJC A;  2XOY A;  4O76 A;  5E7D A;  2I7K A;  2R0Y A;  2YQD A;  4A9F A;  4F3I A;  5LJ0 A;  4X2I A;  2KKY A;  2VPB A;  1V87 A;  4I7C A;  5LKX A;  1JSP B;  4QST A;  5CUA A;  1U6G B;  3DAI A;  5HEM A;  4NR7 A;  5II1 A;  5ACY A;  5AIU A;  4O62 A;  2CKL B;  3RTR B;  1ZKR A;  2DVV A;  4LR6 A;  4MR3 A;  5J0D A;  4RVR A;  3SVG A;  4QSU A;  4QZS A;  5DX4 A;  4FO9 A;  3NXB A;  3RCW A;  4NYV A;  5E0R A;  4A9K A;  5DKH A;  2VPG A;  4N4I A;  2YUR A;  3HCS A;  3N9O A;  5EWC A;  3ZYU A;  3PLW A;  4AP4 A;  4HXS A;  2YEK A;  4HBW A;  2D9E A;  3UVX A;  5EM3 A;  4KCX A;  5B78 A;  4XY9 A;  5CQ6 A;  4YYM A;  5I7Y A;  5CUB A;  2CON A;  5F5Z A;  4QQ4 A;  5I88 A;  4QSQ A;  4QBM A;  3O35 A;  4O7F A;  5CQ7 A;  5A5S A;  2M13 A;  4LAD B;  3SHB A;  1WEO A;  2Y1M A;  1JM7 A;  2XEU A;  4MSX A;  5HFQ A;  4QEW A;  5DYU A;  4ZC9 A;  5L96 A;  4BW4 A;  3O37 A;  2RNW A;  4NYW A;  5A5N A;  5AMF A;  2MA6 A;  3N9N A;  3PUR A;  4YYI A;  5FDZ A;  3DWD A;  4QSP A;  2Y43 A;  3LQI A;  2OXQ C;  2KWN A;  3P1D A;  1WEQ A;  2K17 A;  3NG2 A;  3P1F A;  5HRW A;  3ZYQ A;  2MNY A;  1K2F A;  2OSS A;  5COI A;  2ECI A;  1LDJ B;  4YAT A;  4WIV A;  4QSW A;  3H7H A;  5L8T A;  5FBX A;  4UIV A;  3MHS A;  5FEY A;  4TU6 A;  3SOX A;  2NAA A;  2MT5 A;  4N4F A;  4CUS A;  5CPE A;  4PY6 A;  5FB0 A;  5I40 A;  1XWH A;  2EA6 A;  4IC3 A;  2KU3 A;  5B77 A;  5I3L A;  2H60 A;  4O70 A;  2XP0 A;  5KTU A;  4LZR A;  5DW2 A;  3GG3 A;  3ONI A;  1WEE A;  5D7X A;  5FFV A;  2JMI A;  5TDW A;  1VFY A;  2KGG A;  5A5Q A;  3JUE A;  2FSA A;  4AYC A;  3RPG B;  5EGU A;  4BHW A;  4Z1S A;  3IU5 A;  1JM7 B;  4WZ2 A;  5TCM A;  4CUP A;  2ECW A;  5SVY A;  5II2 A;  4YAD A;  5DLZ A;  5EYA F;  3KDE C;  5B8D A;  4LKA A;  4YC9 A;  4UYD A;  5ENH A;  4BW2 A;  5IGK A;  4Z93 A;  5HCL A;  4R2Y A;  4A4B A;  5EV9 A;  4Q6F A;  1X4U A;  2ECT A;  5IGL A;  2XOC A;  4UYH A;  3UV5 A;  4QSV A;  4UP5 A;  5L99 A;  5DKC A;  4IC2 A;  4MR5 A;  5CTL A;  3UV4 A;  2DSM A;  5EA1 A;  5LUU A;  2LQ6 A;  2ECV A;  5D3H A;  5CQA A;  5G4S A;  4BJX A;  4S3O B;  5BT5 A;  5FE6 A;  4UYE A;  2KWO A;  5I7X A;  2HYE D;  2M1R A;  2RI7 A;  5HQ5 A;  4HXP A;  4ALH A;  4NUC A;  3SVF A;  4Z1Q A;  2CT2 A;  3DDT A;  4O64 A;  5BT3 A;  2LV9 A;  3KNV A;  4QEV A;  4DON A;  5D26 A;  5DLX A;  3ZVY A;  2VJF A;  5HEL A;  1X0J A;  1MM3 A;  2EJN A;  2R0V A;  2E6R A;  1JM4 B;  2OUO A;  5JWM A;  4NXJ A;  5CS8 A;  4AYC B;  1G25 A;  4XUA A;  3MQM A;  2L85 A;  1Z2Q A;  5C8G A;  2B0O E;  2VNF A;  4QYL A;  1WEU A;  5EI4 A;  5FE4 A;  4IOR A;  5F2P A;  5FG5 A;  5K3Q A;  5CUG A;  4ZDT A;  3UVD A;  4IR3 A;  5DYX A;  4CFK A;  2G4A A;  5ENJ A;  5G0F A;  2E3K A;  1FBV A;  3Q2F A;  2EGP A;  4CUR A;  4Z0O A;  1E4U A;  2F6J A;  4CL9 A;  5E3D A;  2RSD A;  4QB3 A;  5EWH A;  5ENI A;  4A4C A;  2BAY A;  2KFT A;  5D3L A;  4CA1 A;  5C85 A;  5LVR A;  2DJA A;  5H85 A;  1BOR A;  2LXH C;  4WA6 A;  2I50 A;  2RS9 B;  4B7Y C;  4NRC A;  3PUQ A;  4OGI A;  1WES A;  2YQM A;  1X4J A;  5F36 A;  1DVP A;  3JVJ A;  5CZG A;  5FE2 A;  1WEP A;  5FH7 A;  1WIM A;  4TT4 A;  5L98 A;  3U5M A;  4YYD A;  2EGM A;  4O78 A;  4PCI A;  2MUM A;  2VP7 A;  3S91 A;  5EP7 A;  1VYX A;  2VPE A;  4O72 A;  4YAB A;  3L11 A;  5CFW A;  4A9J A;  5CUC A;  4AKG A;  3UVY A;  2KWJ A;  1WEN A;  3U5P A;  2AN6 A;  4AKI A;  2L7P A;  5D1K B;  5SVX A;  5DFC A;  2JRJ A;  2RFJ A;  4AKN A;  3DWY A;  3C5K A;  5IG6 A;  1N87 A;  4ZQL A;  5I89 A;  2EXU A;  3KV6 A;  3D1B A;  4PKL A;  5CRM A;  4HXM A;  4LYS A;  4NS5 A;  5L97 A;  2LGL A;  4GND A;  5DFB A;  2CRR A;  2XOZ A;  5E73 A;  4X3G A;  5EWV A;  4MEQ A;  4YYK A;  2VPD A;  4I7D A;  4P5O B;  2KR4 A;  4A0C D;  4QC1 A;  4QUU A;  4UIZ A;  5E3G A;  3HTK C;  4V3L C;  1JOC A;  2FUU A;  5E9Y A;  5ENG A;  4A9L A;  3MUL A;  1FP0 A;  3M7K A;  3O33 A;  5LVQ A;  4TU4 A;  1MBM A;  5FER A;  2MD7 B;  1MM2 A;  3FM8 C;  2MA5 A;  1Z60 A;  5TBN A;  4KV4 A;  4C67 A;  4QNS A;  5H1T A;  5KH7 A;  4NR5 A;  3U5L A;  2OWA A;  5E9M A;  5A83 A;  3KV5 A;  4TT2 A;  4R7E A;  4NRA A;  5C87 A;  4GNF A;  3I2D A;  3MHH A;  4UYG A;  4Q0O A;  4J0S A;  2PNX A;  4LZS A;  2DVQ A;  5DYC A;  1PUO A;  4C9Z A;  2G43 A;  5B79 A;  3MB3 A;  5LKU A;  2E7N A;  4HXL A;  5D24 A;  4PS5 A;  5TB6 A;  4PTB A;  5I86 A;  4QF3 A;  1WIL A;  2G6Q A;  2K4D A;  4N4G A;  5D1L B;  4LYI A;  1VD4 A;  3T9K A;  4IR5 A;  3N9M A;  2MNZ A;  5D1M B;  4LZ2 A;  5E9I A;  2LGG A;  5F1L A;  3SOW A;  3ZNI A;  5CQ8 A;  4N4H A;  3T7L A;  4XI1 A;  2DKW A;  5G4R A;  1HYJ A;  4C66 A;  3U5N A;  4LYW A;  5FB1 A;  2MJV B;  2FUI A;  3HCT A;  5SVI A;  1WUG A;  4L58 A;  4GNE A;  2JM3 A;  4CLB A;  5KO4 A;  4CUQ A;  5B75 A;  2KWK A;  5JI8 A;  3U5O A;  5C13 A;  2MD8 C;  5D3N A;  5A5O A;  5DW1 A;  4XUB A;  4WZ3 B;  4WHU A;  5A82 A;  5K29 A;  3ZPV E;  5FE1 A;  2YHO A;  5H1V A;  4YBM A;  3MDB C;  3VK6 A;  4NQM A;  2M3H A;  5CGP A;  5G04 B;  4PCE A;  5F60 A;  3UVW A;  4MEP A;  3UV2 A;  5HRV A;  5EWD A;  2OO1 A;  2YW5 A;  4TZ2 A;  2K16 A;  5KTX A;  5KU3 A;  5LKT A;  5D3J A;  3M62 A;  2YEM A;  5DY7 A;  2KTB B;  5LCW B;  5IGM A;  3JVM A;  5ETD A;  3LJW A;  5DIN A;  4IOQ A;  4NR9 A;  4Z6H A;  4OUF A;  2E6S A;  5F3A A;  3G0J A;  5SVI B;  5CP5 A;  3U5K A;  4LRG A;  5CRZ A;  5IGN A;  4XY8 A;  4Z0R A;  5FE0 A;  4MVT A;  5FFW A;  2YYR A;  5FE7 A;  4AVX A;  3GV4 A;  2DWW A;  4NR4 A;  3G0L A;  4TTE A;  4YY6 A;  5HJC A;  2JUN A;  4TQN A;  5D3P A;  2VJE A;  4YAX A;  5HEN A;  5DKD A;  2CRW A;  4OGE A;  1E6I A;  3P1C A;  5EIC A;  5CY9 A;  3O36 A;  3FEH A;  4UP0 A;  4LK9 A;  4NYX A;  2RR4 A;  3P1E A;  2ECJ A;  2RNY A;  2YU4 A;  3N9L A;  3LVR E;  2YHN A;  5H1U A;  4GNG A;  5ENB A;  5ENE A;  1LDK C;  1HYI A;  5A5P A;  2DVS A;  2F6N A;  2YW8 A;  4YH3 A;  5A7C A;  3N9P A;  4MR6 A;  4W4U A;  5DKA A;  2L80 A;  2E7O A;  3UW9 A;  5IBN A;  4NQN A;  4QYD A;  4N3W A;  2L0B A;  4R8P K;  4O7E A;  5C89 A;  5BT4 A;  5D3R A;  3N9Q A;  4YYG A;  2NXB A;  5CQ3 A;  4AKH A;  3O70 A;  4FK5 A;  4UIX A;  5FE5 A;  1EQF A;  5A5R A;  3MXF A;  4HBY A;  4O7B A;  4QSR A;  4PPE A;  5FE9 A;  5J3X A;  5AME A;  5FH8 A;  5FG6 A;  2DX8 A;  3HMF A;  4IOO A;  2DVR A;  4Y03 A;  5CQ4 A;  5I83 A;  4QR4 A;  4OGJ A;  3JVK A;  2JMJ A;  2QIZ A;  3L1Z B;  4GB0 A;  4NN2 A;  2YT5 A;  4UIT A;  4J3I A;  4O75 A;  2VJE B;  4AI6 A;  2H0D B;  4MEN A;  1CHC A;  4HXN A;  2I8N A;  2L43 A;  1T1H A;  5AD3 A;  4TT6 A;  5DFD A;  3QZT A;  2YYN A;  3D7C A;  5F25 A;  3TLP A;  4L7X A;  5D0C A;  3MB4 A;  4A9M A;  5HQ7 A;  2Y1N A;  3L1X A;  5DYA A;  5KH3 A;  4O7A A;  2L75 A;  2KYU A;  2UZG A;  4ZUX U;  5HFR A;  3O47 A;  5CQ5 A;  5I29 A;  3FJU B;  3ASL A;  4HBV A;  3ZTG A;  5CUE A;  4V3K C;  4A49 A;  3LDY A;  4TZ8 A;  5E9V A;  4GPJ A;  4YBT A;  5E74 A;  2LAU A;  3HCU A;  3ZVZ B;  3IHP A;  2YUC A;  1IYM A;  4A9O A;  1WEM A;  2LRI C;  2XB1 A;  4FLP A;  4I7B A;  4QR5 A;  4WZ0 A;  3SOU A;  3MUK A;  2D8U A;  5D25 A;  3RPG C;  5ETB A;  5KTW A;  3LQH A;  5E9K A;  5A85 A;  3SUB A;  3LVQ E;  3LQJ A;  3S92 A;  2ECN A;  1N72 A;  3DPL R;  4ALG A;  5C11 A;  5EPB A;  4OGC A;  2JMD A;  4Z6I A;  2ECG A;  4LLB A;  4NUE A;  5B76 A;  5AIT A;  4IR4 A;  4ZW1 A;  4YYJ A;  4NUD A;  4BW1 A;  2LSP B;  2YQL A;  5HRX A;  3ZPV 1;  5FFY A;  5D3T A;  4BW3 A;  4S3O C;  2F42 A;  5HM0 A;  4LC2 A;  5F63 A;  5I1Q A;  2DAT A;  4BBQ A;  3Q2E A;  5CU8 A;  4HXK A;  2FFW A;  5EQ1 A;  2LN0 A;  4CUT A;  4MEO A;  1WEV A;  2R10 A;  3VKH A;  3Q1D A;  2YDW A;  5EU1 A;  4YYN A;  1Z6U A;  4XYA A;  5TDR A;  1WUM A;  4QSS A;  2YSJ A;  5FG4 A;  5EIS A;  2C2V S;  4B86 C;  3EB6 A;  2RO1 A;  1DCQ A;  2C2L A;  5H9M A;  5KH9 A;  5ENF A;  2YEL A;  2WP1 A;  5JG6 A;  4O74 A;  3KQI A;  1WE9 A;  4J1P A;  4QY4 A;  3QZS A;  3QZV A;  4YBS A;  2LXP C;  2YRE A;  5TRB A;  5LKZ A;  4WHW A;  2KE1 A;  2PUY A;  3GL6 A;  3V43 A;  5ENC A;  4QC3 A;  5CQT A;  5FH6 A;  4LDF A;  2L84 A;  4FIP A;  5LJ2 A;  3AAD A;  5F61 A;  2HDP A;  2M6M A;  4LJN A;  4O7C A;  2YSM A;  2EOD A;  4TYL A;  2K1J A;  5EVA A;  4QR3 A;  5EWW A;  3T6R A;  3U5J A;  2ZET C;  1F62 A;  5E9L A;  4UYF A;  4UI9 B;  2D8S A;  3O34 A;  4NR8 A;  2MIQ A;  3D1D A;  4CCG X;  2QJ0 A;  4YK0 A;  5EPR A;  4J0R A;  2D82 A;  3P5O A;  5L8U A;  3K2J A;  4YY4 A;  3SVH A;  3LJU X;  3M63 A;  3HMH A;  4H9D A;  4UIY A;  5CUD A;  5HQ6 A;  2H0D A;  3ERR A;  4KV1 A;  4QF2 A;  5EK9 A;  2GRC A;  5IID A;  1F68 A;  2LGK A;  3I3J A;  5F1H A;  4A9I A;  5C7N A;  4TS8 A;  4MR4 A; 
#chains in the Genus database with same CATH homology
 4NRB A;  2RNX A;  2CSZ A;  1WGM A;  4A9E A;  4A9N A;  1ZS5 A;  2KIZ A;  5AD2 A;  2LDR A;  2G45 A;  3IU6 A;  4HXO A;  5A81 A;  1WFK A;  3C6W A;  3JVL A;  4QEU A;  5HLS A;  5G05 B;  4TKP B;  5C4Q A;  2CSY A;  1ZBD B;  2N9G A;  3EB5 A;  5D3S A;  3LRQ A;  4UYF B;  4UIU A;  2L5U A;  2QIC A;  4AUQ B;  4E96 A;  5FE3 A;  2KGI A;  3DQV R;  2CKL A;  1WEW A;  4CUU A;  2R0S A;  2M85 A;  4YYH A;  5TAB A;  2KRE A;  4O77 A;  4HBX A;  4NR6 A;  5DBM A;  4QSX A;  4UIW A;  3LXJ A;  5I80 A;  4CFL A;  4F52 B;  4QUT A;  5LJ1 A;  5FE8 A;  3O7A A;  3HME A;  4O71 A;  5F62 A;  1X4I A;  4YH4 A;  3FKM X;  4IR6 A;  2IDA A;  2LGV A;  5EPS A;  3AQA A;  5KHM A;  4HXR A;  1RMD A;  3M99 A;  2L5E A;  2VJF B;  3PHD A;  3FL2 A;  4Q0N A;  2WP2 A;  4A9H A;  4FJC A;  4O76 A;  5E7D A;  2I7K A;  2R0Y A;  2YQD A;  4A9F A;  4F3I A;  5LJ0 A;  4X2I A;  2VPB A;  1V87 A;  4I7C A;  5LKX A;  1JSP B;  4QST A;  5CUA A;  1U6G B;  3DAI A;  5HEM A;  4NR7 A;  5II1 A;  5ACY A;  5AIU A;  2CKL B;  3RTR B;  2DVV A;  4LR6 A;  4MR3 A;  5J0D A;  4RVR A;  3SVG A;  4QSU A;  4QZS A;  5DX4 A;  4FO9 A;  3NXB A;  3RCW A;  4NYV A;  5E0R A;  4A9K A;  5DKH A;  2VPG A;  4N4I A;  2YUR A;  3HCS A;  3N9O A;  5EWC A;  3ZYU A;  4AP4 A;  4HXS A;  2YEK A;  4HBW A;  2D9E A;  3UVX A;  5EM3 A;  4KCX A;  5B78 A;  4XY9 A;  5CQ6 A;  4YYM A;  5I7Y A;  5CUB A;  5F5Z A;  5I88 A;  4QSQ A;  4QBM A;  3O35 A;  4O7F A;  5CQ7 A;  5A5S A;  4LAD B;  1JM7 A;  3SHB A;  1WEO A;  2Y1M A;  2XEU A;  4MSX A;  5HFQ A;  4QEW A;  5DYU A;  4ZC9 A;  5L96 A;  4BW4 A;  3O37 A;  2RNW A;  4NYW A;  5A5N A;  5AMF A;  2MA6 A;  3N9N A;  3PUR A;  4YYI A;  5FDZ A;  4QSP A;  2Y43 A;  3LQI A;  2OXQ C;  2KWN A;  3P1D A;  1WEQ A;  2K17 A;  3NG2 A;  3P1F A;  5HRW A;  3ZYQ A;  2MNY A;  1K2F A;  2OSS A;  5COI A;  2ECI A;  1LDJ B;  4YAT A;  4WIV A;  4QSW A;  5L8T A;  5FBX A;  4UIV A;  3MHS A;  5FEY A;  4TU6 A;  3SOX A;  2NAA A;  2MT5 A;  4N4F A;  4CUS A;  5CPE A;  4PY6 A;  5FB0 A;  5I40 A;  1XWH A;  2EA6 A;  4IC3 A;  2KU3 A;  5B77 A;  5I3L A;  2H60 A;  4O70 A;  5KTU A;  4LZR A;  5DW2 A;  3GG3 A;  3ONI A;  1WEE A;  5D7X A;  5FFV A;  2JMI A;  5TDW A;  1VFY A;  2KGG A;  5A5Q A;  2FSA A;  4AYC A;  3RPG B;  5EGU A;  4BHW A;  4Z1S A;  3IU5 A;  1JM7 B;  4WZ2 A;  5TCM A;  4CUP A;  2ECW A;  5II2 A;  4YAD A;  5DLZ A;  5EYA F;  5B8D A;  4LKA A;  4YC9 A;  4UYD A;  5ENH A;  4BW2 A;  5IGK A;  4Z93 A;  5HCL A;  4R2Y A;  4A4B A;  5EV9 A;  4Q6F A;  1X4U A;  2ECT A;  5IGL A;  4UYH A;  3UV5 A;  4QSV A;  4UP5 A;  5L99 A;  5DKC A;  4IC2 A;  4MR5 A;  5CTL A;  3UV4 A;  5EA1 A;  5LUU A;  2LQ6 A;  2ECV A;  5D3H A;  5CQA A;  5G4S A;  4BJX A;  4S3O B;  5BT5 A;  5FE6 A;  4UYE A;  2KWO A;  5I7X A;  2HYE D;  2M1R A;  2RI7 A;  5HQ5 A;  4HXP A;  4ALH A;  4NUC A;  3SVF A;  4Z1Q A;  2CT2 A;  4O64 A;  5BT3 A;  2LV9 A;  3KNV A;  4QEV A;  4DON A;  5D26 A;  5DLX A;  3ZVY A;  2VJF A;  5HEL A;  1X0J A;  1MM3 A;  2R0V A;  2E6R A;  1JM4 B;  2OUO A;  5JWM A;  4NXJ A;  5CS8 A;  4AYC B;  1G25 A;  4XUA A;  3MQM A;  2L85 A;  1Z2Q A;  5C8G A;  2VNF A;  4QYL A;  1WEU A;  5EI4 A;  5FE4 A;  4IOR A;  5F2P A;  5FG5 A;  5CUG A;  4ZDT A;  3UVD A;  4IR3 A;  5DYX A;  4CFK A;  2G4A A;  5ENJ A;  5G0F A;  2E3K A;  1FBV A;  3Q2F A;  2EGP A;  4CUR A;  1E4U A;  2F6J A;  4CL9 A;  5E3D A;  2RSD A;  4QB3 A;  5EWH A;  5ENI A;  4A4C A;  2BAY A;  2KFT A;  5D3L A;  4CA1 A;  5C85 A;  5LVR A;  5H85 A;  1BOR A;  2LXH C;  4WA6 A;  2I50 A;  2RS9 B;  4B7Y C;  4NRC A;  3PUQ A;  4OGI A;  1WES A;  2YQM A;  1X4J A;  5F36 A;  1DVP A;  3JVJ A;  5CZG A;  5FE2 A;  1WEP A;  5FH7 A;  1WIM A;  4TT4 A;  5L98 A;  3U5M A;  4YYD A;  4O78 A;  4PCI A;  2MUM A;  2VP7 A;  3S91 A;  5EP7 A;  1VYX A;  2VPE A;  4O72 A;  4YAB A;  3L11 A;  5CFW A;  4A9J A;  5CUC A;  2KWJ A;  3UVY A;  1WEN A;  3U5P A;  2AN6 A;  5D1K B;  5DFC A;  2JRJ A;  2RFJ A;  4AKN A;  3DWY A;  3C5K A;  5IG6 A;  1N87 A;  4ZQL A;  5I89 A;  3KV6 A;  4PKL A;  4HXM A;  4LYS A;  4NS5 A;  5CRM A;  5L97 A;  2LGL A;  4GND A;  5DFB A;  5E73 A;  4X3G A;  5EWV A;  4MEQ A;  4YYK A;  2VPD A;  4I7D A;  4P5O B;  2KR4 A;  4A0C D;  4QC1 A;  4QUU A;  4UIZ A;  5E3G A;  3HTK C;  4V3L C;  1JOC A;  2FUU A;  5E9Y A;  5ENG A;  4A9L A;  3MUL A;  1FP0 A;  3O33 A;  5LVQ A;  4TU4 A;  5FER A;  2MD7 B;  1MM2 A;  2MA5 A;  1Z60 A;  5TBN A;  4KV4 A;  4C67 A;  4QNS A;  5H1T A;  5KH7 A;  4NR5 A;  3U5L A;  5E9M A;  5A83 A;  3KV5 A;  4TT2 A;  4R7E A;  4NRA A;  5C87 A;  4GNF A;  3I2D A;  3MHH A;  4UYG A;  4Q0O A;  4J0S A;  2PNX A;  4LZS A;  2DVQ A;  5DYC A;  5B79 A;  4C9Z A;  2G43 A;  3MB3 A;  5LKU A;  2E7N A;  4HXL A;  5D24 A;  4PS5 A;  5TB6 A;  4PTB A;  5I86 A;  4QF3 A;  1WIL A;  2G6Q A;  2K4D A;  4N4G A;  5D1L B;  4LYI A;  1VD4 A;  4IR5 A;  3N9M A;  2MNZ A;  5D1M B;  4LZ2 A;  5E9I A;  2LGG A;  5F1L A;  3SOW A;  3ZNI A;  5CQ8 A;  4N4H A;  3T7L A;  4XI1 A;  2DKW A;  5G4R A;  1HYJ A;  4C66 A;  3U5N A;  4LYW A;  5FB1 A;  2MJV B;  2FUI A;  3HCT A;  1WUG A;  4L58 A;  4GNE A;  4CLB A;  5KO4 A;  4CUQ A;  5B75 A;  2KWK A;  5JI8 A;  3U5O A;  5C13 A;  2MD8 C;  5D3N A;  5A5O A;  5DW1 A;  4XUB A;  4WZ3 B;  4WHU A;  5A82 A;  5K29 A;  3ZPV E;  5FE1 A;  2YHO A;  5H1V A;  4YBM A;  3VK6 A;  4NQM A;  2M3H A;  5CGP A;  5G04 B;  4PCE A;  5F60 A;  3UVW A;  4MEP A;  3UV2 A;  5HRV A;  5EWD A;  2OO1 A;  2YW5 A;  4TZ2 A;  2K16 A;  5KTX A;  5KU3 A;  5LKT A;  5D3J A;  3M62 A;  2YEM A;  5DY7 A;  2KTB B;  5LCW B;  5IGM A;  3JVM A;  5ETD A;  3LJW A;  5DIN A;  4IOQ A;  4NR9 A;  4Z6H A;  4OUF A;  2E6S A;  5F3A A;  3G0J A;  5CP5 A;  3U5K A;  4LRG A;  5CRZ A;  5IGN A;  4XY8 A;  5FE0 A;  4MVT A;  5FFW A;  2YYR A;  5FE7 A;  4AVX A;  3GV4 A;  2DWW A;  4NR4 A;  3G0L A;  4TTE A;  4YY6 A;  5HJC A;  4TQN A;  5D3P A;  2VJE A;  4YAX A;  5HEN A;  5DKD A;  1E6I A;  3P1C A;  5EIC A;  5CY9 A;  3O36 A;  4UP0 A;  4LK9 A;  4NYX A;  3P1E A;  2ECJ A;  2RNY A;  2YU4 A;  3N9L A;  2YHN A;  5H1U A;  4GNG A;  5ENB A;  5ENE A;  1LDK C;  1HYI A;  5A5P A;  2DVS A;  2F6N A;  2YW8 A;  4YH3 A;  5A7C A;  3N9P A;  4MR6 A;  4W4U A;  5DKA A;  2L80 A;  2E7O A;  3UW9 A;  5IBN A;  4NQN A;  4QYD A;  4N3W A;  2L0B A;  4R8P K;  4O7E A;  5C89 A;  5BT4 A;  5D3R A;  3N9Q A;  4YYG A;  2NXB A;  5CQ3 A;  3O70 A;  4FK5 A;  4UIX A;  5FE5 A;  1EQF A;  5A5R A;  3MXF A;  4HBY A;  4O7B A;  4QSR A;  4PPE A;  5FE9 A;  5J3X A;  5AME A;  5FH8 A;  5FG6 A;  2DX8 A;  3HMF A;  4IOO A;  2DVR A;  4Y03 A;  5CQ4 A;  5I83 A;  4QR4 A;  4OGJ A;  3JVK A;  2JMJ A;  2QIZ A;  3L1Z B;  4GB0 A;  4NN2 A;  2YT5 A;  4UIT A;  4J3I A;  4O75 A;  2VJE B;  2H0D B;  4MEN A;  1CHC A;  4HXN A;  2I8N A;  2L43 A;  1T1H A;  5AD3 A;  4TT6 A;  5DFD A;  3QZT A;  2YYN A;  3D7C A;  5F25 A;  3TLP A;  4L7X A;  5D0C A;  3MB4 A;  4A9M A;  5HQ7 A;  2Y1N A;  3L1X A;  5DYA A;  5KH3 A;  4O7A A;  2L75 A;  2KYU A;  2UZG A;  4ZUX U;  5HFR A;  5CQ5 A;  5I29 A;  3ASL A;  4HBV A;  3ZTG A;  5CUE A;  4V3K C;  4A49 A;  4TZ8 A;  5E9V A;  4GPJ A;  4YBT A;  5E74 A;  3HCU A;  3ZVZ B;  3IHP A;  2YUC A;  1IYM A;  4A9O A;  1WEM A;  2LRI C;  2XB1 A;  4FLP A;  4I7B A;  4QR5 A;  4WZ0 A;  3SOU A;  3MUK A;  5D25 A;  3RPG C;  5ETB A;  5KTW A;  3LQH A;  5E9K A;  5A85 A;  3LQJ A;  3S92 A;  2ECN A;  1N72 A;  3DPL R;  4ALG A;  5C11 A;  5EPB A;  2JMD A;  4Z6I A;  2ECG A;  4LLB A;  4NUE A;  5B76 A;  5AIT A;  4IR4 A;  4ZW1 A;  4YYJ A;  4NUD A;  4BW1 A;  2LSP B;  2YQL A;  5HRX A;  3ZPV 1;  5FFY A;  5D3T A;  4BW3 A;  4S3O C;  2F42 A;  5HM0 A;  4LC2 A;  5F63 A;  5I1Q A;  2DAT A;  4BBQ A;  3Q2E A;  5CU8 A;  4HXK A;  5EQ1 A;  2LN0 A;  4CUT A;  4MEO A;  1WEV A;  2R10 A;  2YDW A;  5EU1 A;  4YYN A;  1Z6U A;  4XYA A;  5TDR A;  1WUM A;  4QSS A;  2YSJ A;  5FG4 A;  5EIS A;  2C2V S;  4B86 C;  3EB6 A;  2RO1 A;  2C2L A;  5H9M A;  5KH9 A;  5ENF A;  2YEL A;  2WP1 A;  5JG6 A;  4O74 A;  3KQI A;  1WE9 A;  4J1P A;  4QY4 A;  3QZS A;  3QZV A;  4YBS A;  2LXP C;  2YRE A;  5TRB A;  5LKZ A;  4WHW A;  2KE1 A;  2PUY A;  3GL6 A;  3V43 A;  5ENC A;  4QC3 A;  5CQT A;  5FH6 A;  4LDF A;  2L84 A;  4FIP A;  5LJ2 A;  3AAD A;  5F61 A;  2HDP A;  2M6M A;  4LJN A;  4O7C A;  2YSM A;  2EOD A;  4TYL A;  2K1J A;  5EVA A;  4QR3 A;  5EWW A;  3T6R A;  3U5J A;  2ZET C;  1F62 A;  5E9L A;  4UYF A;  4UI9 B;  2D8S A;  3O34 A;  4NR8 A;  2MIQ A;  4CCG X;  2QJ0 A;  4YK0 A;  5EPR A;  4J0R A;  2D82 A;  3P5O A;  5L8U A;  3K2J A;  4YY4 A;  3SVH A;  3M63 A;  3HMH A;  4UIY A;  5CUD A;  5HQ6 A;  2H0D A;  4KV1 A;  4QF2 A;  5EK9 A;  2GRC A;  5IID A;  1F68 A;  2LGK A;  3I3J A;  5F1H A;  4A9I A;  5C7N A;  4TS8 A;  4MR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...