5H1VA

Complex structure of trim24 phd-bromodomain and inhibitor 6
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
169
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQESMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
total genus 50
structure length 169
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1vA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1vA01
2DVQA 2IDAA 4NYVA 2VJFB 4O77A 3HMFA 2RNWA 4A9KA 2YSJA 5KH9A 5D7XA 4O72A 4L58A 2VPEA 5AMFA 4CUSA 2LSPB 5HFRA 4NQNA 1WGMA 5F2PA 4PS5A 5KHMA 5IGLA 3AQAA 4ZUXU 5G05B 3O34A 4LKAA 4QF3A 4A9EA 4A9FA 4KV1A 5C7NA 5A82A 4GNDA 4O74A 3SOXA 4C9ZA 5DINA 4N4GA 5F62A 2DVSA 1N72A 4O70A 5II2A 3N9OA 3U5OA 5HLSA 4AKNA 5C85A 5D3HA 1ZBDB 5LJ2A 1WEEA 3RCWA 3UVYA 5ENBA 2AN6A 4MSXA 4ALHA 3U5KA 3T6RA 5L8UA 5IBNA 4O78A 4NUEA 5CY9A 2L5UA 5I3LA 5TRBA 4N3WA 2KIZA 4HXOA 5G4SA 1CHCA 5B79A 2RI7A 4BW1A 4NS5A 5DKAA 5F61A 3LXJA 4KV4A 4QR3A 5FB1A 3MHSA 4XYAA 4O7BA 2KGGA 4QEVA 4CURA 5DYCA 2E7NA 2YQDA 4LYSA 4PCIA 5DYXA 4QSPA 4FO9A 2RS9B 1EQFA 5CUAA 3SVHA 5AITA 3DQVR 4AUQB 5DYUA 4IORA 4YYIA 4HXSA 4NUCA 4TT4A 5EWCA 3I2DA 4GPJA 3RPGB 5A85A 2H60A 4YYHA 1WEOA 3ZYQA 5CQ5A 2ECIA 2ECWA 2OO1A 4XUAA 1Z2QA 3GG3A 2KU3A 3RTRB 4Z1SA 4NRAA 4CCGX 5FE0A 4NR9A 2L80A 2YW8A 4QEWA 4YC9A 5EPRA 4QBMA 5FE1A 4NR5A 5DLXA 4ZC9A 4O7AA 4YBSA 5DY7A 5CQ6A 4TZ8A 2G6QA 4DONA 2HDPA 5TB6A 1E6IA 4YY6A 2QIZA 4UYFA 4CLBA 2KYUA 5C11A 2KTBB 5FEYA 2L43A 5DFBA 2WP2A 4YYJA 5EGUA 2WP1A 4O71A 4QY4A 5JWMA 5F3AA 3L1ZB 1MM3A 3PURA 5CFWA 4QSUA 4C67A 5FH8A 4QR4A 4LYWA 3UV4A 5I88A 5HQ5A 3NXBA 5K29A 1WEQA 4CL9A 5I86A 5BT5A 1WEUA 5EI4A 4WA6A 4A9MA 4PTBA 5E7DA 1ZS5A 2KWNA 2LGVA 5KTWA 5E0RA 4A9OA 4TKPB 4NR7A 5FH6A 2LRIC 5CQ7A 5L97A 4TU6A 3QZSA 3QZVA 3QZTA 5KTUA 4QNSA 2BAYA 4CUQA 4E96A 4LZ2A 1WUMA 3MB3A 4AYCB 3SOUA 5EPBA 5LJ1A 1U6GB 5ENJA 4HXLA 4FJCA 1JM7A 5DYAA 5FBXA 4A9JA 4AYCA 4LDFA 5C8GA 3U5NA 2RSDA 4HBWA 3ZTGA 1X0JA 4YAXA 3SVGA 5EU1A 5B77A 2KGIA 4CFLA 5ENCA 4GNFA 5A5QA 5EWHA 5E9KA 4R7EA 4A9IA 5E9VA 2LV9A 4TZ2A 4I7CA 4FLPA 5I80A 5D3LA 3P1CA 4LRGA 5CQ4A 5IGMA 4B86C 2E7OA 4UIWA 4YH3A 5J3XA 4I7DA 5IGKA 2YELA 4CUTA 1WESA 3IHPA 5F1LA 5LKUA 5F25A 5F63A 4XY8A 5L96A 4XY9A 2R0SA 4MEQA 5CUEA 5FE7A 2G45A 2MD7B 5LKXA 5LKTA 2FUIA 3I3JA 2MD8C 5CUBA 5D3NA 4QYLA 5IGNA 1WE9A 3C6WA 5HEMA 4LADB 1V87A 1WEWA 4QYDA 3FL2A 1BORA 5DKCA 3ZNIA 4QEUA 1FBVA 2M6MA 5F5ZA 3KNVA 2C2VS 4TQNA 5FE3A 4TS8A 5EICA 4WHWA 4UIXA 4QSSA 4WIVA 4NXJA 2YQMA 2MA6A 5G04B 5KTXA 3SVFA 4BW4A 4PPEA 2I8NA 3LJWA 4QSVA 4QSXA 2LGKA 2YURA 3KV6A 4MEOA 5DKHA 5FFVA 5HCLA 4OGJA 1WEPA 4QC1A 3P1FA 3LQHA 3UV5A 3IU6A 5EWWA 2PUYA 4A9NA 4WZ0A 2F6NA 5JI8A 2K16A 4Z93A 4YBMA 5D3PA 5L8TA 4QC3A 3M63A 4ALGA 5D3TA 2Y43A 4S3OB 5FERA 4UIYA 5ENHA 2I7KA 4BJXA 3MB4A 4QR5A 3TLPA 2LXPC 5EV9A 3RPGC 4LYIA 5HFQA 3N9NA 5CQ3A 3HCUA 3ZPV1 5F36A 2G4AA 5CQAA 1VD4A 2M85A 2EODA 4MR3A 4NYXA 2G43A 3UW9A 5LCWB 2D9EA 1WEVA 2MT5A 5I83A 4TTEA 5ACYA 5CRMA 5CZGA 4MVTA 5ENEA 4F52B 5E9YA 5HQ7A 5C89A 5KO4A 3JVMA 5EPSA 2KREA 2YT5A 4NR8A 2DKWA 2YEMA 2RNYA 5HM0A 2YYRA 3HTKC 3MHHA 5D1KB 3S91A 3HCTA 4XUBA 4NR4A 2UZGA 5KH7A 5A5NA 2KE1A 5CRZA 2RO1A 3ONIA 4UYHA 3G0JA 3JVKA 4O7CA 5I7XA 2KFTA 1IYMA 5A81A 4LJNA 2VJEA 2YU4A 3C5KA 5E74A 5L99A 2VJFA 5EYAF 4B7YC 2DX8A 3S92A 1K2FA 2EGPA 5HRVA 2MIQA 3O7AA 2YQLA 3N9PA 5DW1A 5HJCA 1RMDA 4YYGA 4UIZA 5E3DA 5II1A 1WILA 4O7FA 5B75A 4YY4A 5C4QA 1WEMA 5TDWA 2LDRA 4J0RA 4Q0NA 2YEKA 5EA1A 4R8PK 3JVLA 5FH7A 4IR6A 2Y1MA 5E9LA 2LGLA 3M99A 5C87A 3MUKA 5FE2A 4TYLA 4IR4A 5DKDA 4HBVA 4HBYA 4NRCA 1XWHA 4HXPA 4PCEA 5CU8A 3PHDA 2YREA 5F60A 5IIDA 5G4RA 4YYNA 3U5JA 3FKMX 3NG2A 3DWYA 5E9IA 5I7YA 4UIUA 1JSPB 4IR5A 5H85A 5IG6A 3P5OA 1MM2A 4Z6HA 4TT6A 5CP5A 5B76A 2MNYA 2E3KA 2MJVB 4AP4A 4HXNA 5DW2A 4O64A 2RFJA 5EP7A 2ECGA 2JRJA 5ETBA 5BT3A 1JOCA 1HYJA 5HELA 2C2LA 5CUGA 2DVRA 1T1HA 3U5MA 3UVXA 5CPEA 5CQ8A 3HCSA 2VP7A 4HXMA 2ECTA 3O36A 1E4UA 4NYWA 4YBTA 3MXFA 2NXBA 5HRXA 2CSYA 4IC3A 5AD3A 1VYXA 3DPLR 3N9MA 5HENA 4UYFB 5I1QA 5TDRA 3VK6A 4UIVA 4UYEA 2N9GA 5LKZA 4YYMA 2E6SA 5FE9A 3EB5A 4FIPA 2OSSA 4V3LC 5DX4A 2OUOA 3UV2A 4GNGA 3PUQA 2FSAA 5DLZA 5D25A 4YYDA 4QSWA 2ZETC 2ECJA 5HQ6A 5KH3A 2LGGA 5DFDA 2LN0A 2XB1A 1LDJB 2VJEB 3LQJA 2GRCA 4UYGA 4YYKA 2XEUA 3N9LA 5FG6A 5G0FA 1HYIA 4QUUA 2DATA 3MULA 2VPBA 3SOWA 1WFKA 4LC2A 1WIMA 1WENA 5D0CA 5LUUA 1F68A 5D1LB 2MA5A 5I40A 2K1JA 3L11A 4HXRA 4N4HA 1JM4B 4Q0OA 3DAIA 5FFWA 3O37A 5AMEA 4N4IA 5FDZA 2FUUA 3GL6A 4UI9B 1X4IA 5C13A 5A7CA 5TBNA 3UVDA 5LVQA 4RVRA 5D24A 4BW2A 4ZDTA 5EK9A 4S3OC 2CKLA 2L5EA 2EA6A 3ZVYA 5A5SA 3M62A 4F3IA 5AIUA 4NR6A 4GB0A 1LDKC 4BW3A 4MR6A 5F1HA 4V3KC 2JMDA 5FE5A 1FP0A 5L98A 4O76A 2NAAA 2QICA 4QSRA 2H0DA 5FB0A 4C66A 4LK9A 5D3JA 1Z60A 4YATA 2RNXA 4YABA 4J3IA 5ENGA 3AADA 2KWKA 2D8SA 2VNFA 3O35A 2I50A 3UVWA 5I89A 3HMEA 4J1PA 5ENIA 5FE6A 4WZ3B 5D1MB 3P1DA 2D82A 2CKLB 1G25A 1F62A 4QUTA 2L85A 1JM7B 4MENA 4A49A 4A4CA 2DVVA 4MR5A 5CUDA 3MQMA 4O7EA 2F42A 4A4BA 4A0CD 4Z6IA 4ZW1A 2CT2A 5A5PA 4J0SA 3O70A 4LZSA 3L1XA 4R2YA 5H9MA 4LLBA 3LRQA 2YUCA 3ZYUA 4IC2A 4Q6FA 2R10A 4OGIA 4TT2A 5FFYA 5COIA 5HRWA 4MR4A 4P5OB 5EVAA 2ECVA 3KV5A 4L7XA 5A5RA 5TCMA 5DFCA 2F6JA 2YW5A 4LR6A 4LZRA 1DVPA 2YSMA 3JVJA 4HBXA 5LVRA 3LQIA 4BBQA 4N4FA 4YADA 1WUGA 2YDWA 5I29A 4QSQA 4TU4A 5FG4A 5ETDA 3Q2EA 3KQIA 4GNEA 4XI1A 4CFKA 2K4DA 5CQTA 2KWOA 4HXKA 2JMJA 4IOOA 4CUUA 4X2IA 5H1TA 5CUCA 5D3SA 5LJ0A 2JMIA 4X3GA 3U5PA 4AVXA 2M1RA 4ZQLA 4WZ2A 4QZSA 5BT4A 3U5LA 3HMHA 4NN2A 2M3HA 5D3RA 4NQMA 5EM3A 2E6RA 2LQ6A 2CSZA 5FE4A 4Z1QA 2L84A 5DBMA 4Y03A 2VPGA 2LXHC 5EWVA 5CTLA 5ENFA 4CUPA 2Y1NA 2YHNA 4PKLA 4PY6A 4BHWA 2MNZA 3IU5A 5E9MA 3Q2FA 4YK0A 4W4UA 1X4JA 5JG6A 5FG5A 5J0DA 4KCXA 5H1VA 2L0BA 5TABA 3D7CA 2K17A 5B78A 1VFYA 2VPDA 4IOQA 5CGPA 2MUMA 3G0LA 2OXQC 2ECNA 2PNXA 4QF2A 5AD2A 5FE8A 3T7LA 4QSTA 4UP5A 2KWJA 2KR4A 4OUFA 3ZPVE 4UITA 4I7BA 4CA1A 2R0VA 3O33A 4QB3A 4YH4A 1Z6UA 2L75A 3V43A 2QJ0A 5B8DA 3EB6A 4A9LA 5EQ1A 2YYNA 3P1EA 5EWDA 5A5OA 5CS8A 1X4UA 4NUDA 5EISA 3ZVZB 1N87A 4IR3A 4UYDA 4UP0A 3GV4A 5E3GA 2DWWA 2R0YA 4NRBA 4WHUA 5D26A 4FK5A 3SHBA 4MEPA 4O75A 5A83A 3K2JA 3ASLA 4A9HA 2HYED 5E73A 2YHOA 5KU3A 3N9QA 5H1UA 2H0DB
chains in the Genus database with same CATH superfamily
2DVQA 2IDAA 2XOZA 4NYVA 2VJFB 4O77A 3HMFA 2RNWA 4A9KA 2YSJA 5KH9A 5D7XA 4O72A 4L58A 2VPEA 5AMFA 4CUSA 2LSPB 5HFRA 4NQNA 1WGMA 5F2PA 4PS5A 5KHMA 5IGLA 3AQAA 4ZUXU 5G05B 3O34A 4LKAA 4QF3A 4A9EA 2IQJA 4A9FA 4KV1A 5C7NA 5A82A 2CSVA 4O74A 1DCQA 4GNDA 3SOXA 3VKGA 5DINA 4C9ZA 4N4GA 5F62A 2DVSA 1N72A 4O70A 5II2A 3N9OA 3ERRA 3U5OA 5HLSA 2EXUA 4AKNA 5C85A 5D3HA 1ZBDB 2CRWA 5LJ2A 1WEEA 3RCWA 3UVYA 5ENBA 2AN6A 4MSXA 4ALHA 3U5KA 3T6RA 5L8UA 5IBNA 4O78A 4NUEA 5CY9A 2L5UA 5I3LA 3VKHA 4O62A 4N3WA 2KIZA 5TRBA 4HXOA 5G4SA 1CHCA 5B79A 2RI7A 4BW1A 5SVXA 4NS5A 5DKAA 5F61A 3LXJA 4KV4A 4QR3A 5FB1A 2RR4A 3MHSA 4XYAA 4O7BA 2KGGA 4QEVA 4CURA 5DYCA 2E7NA 2YQDA 4LYSA 4PCIA 5DYXA 4QSPA 4FO9A 2RS9B 1EQFA 2EJNA 5CUAA 3SVHA 5AITA 3DQVR 4AUQB 5DYUA 4IORA 4YYIA 2L7PA 4HXSA 4NUCA 4TT4A 5EWCA 2M13A 4GPJA 2KKYA 3I2DA 3RPGB 5A85A 2H60A 4AKGA 4YYHA 1WEOA 3ZYQA 5CQ5A 2ECIA 2ECWA 2OO1A 4XUAA 1Z2QA 3GG3A 2KU3A 3RTRB 4Z1SA 4NRAA 2CRRA 4CCGX 5FE0A 4NR9A 2L80A 2YW8A 1MBMA 4AI6A 4QEWA 4YC9A 5EPRA 4QBMA 5FE1A 4NR5A 5DLXA 4ZC9A 4O7AA 3FANA 4YBSA 5DY7A 5CQ6A 4TZ8A 2G6QA 4DONA 2HDPA 5TB6A 1E6IA 4YY6A 2QIZA 4UYFA 4CLBA 2KYUA 5C11A 2KTBB 5FEYA 2L43A 5DFBA 2WP2A 4YYJA 5EGUA 2WP1A 4O71A 4QY4A 5JWMA 5F3AA 3L1ZB 1MM3A 3PURA 5CFWA 4QSUA 4C67A 5FH8A 4QR4A 2FFWA 4LYWA 3UV4A 5I88A 5HQ5A 3NXBA 5K29A 1WEQA 4CL9A 5I86A 5BT5A 3LVRE 1WEUA 5EI4A 4WA6A 4A9MA 2XOCA 4PTBA 5E7DA 1ZS5A 2KWNA 2DJAA 2LGVA 5KTWA 5E0RA 4A9OA 4TKPB 3DDTA 4NR7A 5FH6A 2LRIC 5CQ7A 5L97A 4TU6A 4OGCA 3QZSA 3QZVA 3QZTA 5KTUA 4QNSA 2BAYA 4CUQA 4E96A 5SVIA 4LZ2A 1WUMA 3MB3A 4AYCB 3SOUA 5EPBA 5LJ1A 1U6GB 5ENJA 2YVRA 4HXLA 4FJCA 1JM7A 5DYAA 5FBXA 4A9JA 4AYCA 4LDFA 5C8GA 3U5NA 2RSDA 4HBWA 3ZTGA 1X0JA 4YAXA 3SVGA 5EU1A 5B77A 2KGIA 4CFLA 5ENCA 4GNFA 5A5QA 5EWHA 5E9KA 4R7EA 4A9IA 5E9VA 2LV9A 4TZ2A 4I7CA 4FLPA 5I80A 5D3LA 3P1CA 4LRGA 5CQ4A 5IGMA 4B86C 2E7OA 4UIWA 4YH3A 5J3XA 4I7DA 5IGKA 2YELA 4CUTA 1WESA 3IHPA 5F1LA 3LVQE 5LKUA 5F25A 5F63A 4XY8A 5L96A 4XY9A 2R0SA 4MEQA 5CUEA 5FE7A 2XOYA 2G45A 2MD7B 5LKXA 5LKTA 2FUIA 3I3JA 2MD8C 5CUBA 5D3NA 4QYLA 5IGNA 1WE9A 3C6WA 5HEMA 4LADB 1V87A 1WEWA 4QYDA 3FL2A 1BORA 5DKCA 3ZNIA 4QEUA 1FBVA 4AKHA 2M6MA 5F5ZA 3KNVA 2C2VS 4TQNA 5FE3A 4F1PA 4TS8A 5EICA 4WHWA 4UIXA 4QSSA 4WIVA 4NXJA 2YQMA 2MA6A 5G04B 5KTXA 3SVFA 4BW4A 4PPEA 2I8NA 3LJWA 4QSVA 4QSXA 2LGKA 2YURA 3KV6A 4MEOA 5DKHA 5FFVA 5HCLA 4OGJA 1WEPA 4QC1A 3P1FA 3LQHA 3UV5A 3IU6A 5EWWA 2PUYA 4A9NA 4WZ0A 2F6NA 5JI8A 2K16A 4Z93A 4YBMA 5D3PA 5L8TA 4QC3A 3M63A 4ALGA 5D3TA 2Y43A 4S3OB 5FERA 4UIYA 5ENHA 2I7KA 4BJXA 3MB4A 4QR5A 3TLPA 2LXPC 5EV9A 3RPGC 4LYIA 5HFQA 3N9NA 5CQ3A 3HCUA 3ZPV1 5F36A 2G4AA 5CQAA 1VD4A 2M85A 2EODA 4MR3A 4NYXA 3E2DA 2G43A 3UW9A 5LCWB 2D9EA 1WEVA 2MT5A 5I83A 4TTEA 5ACYA 5CRMA 5CZGA 4MVTA 5ENEA 4F52B 1PUOA 5E9YA 5HQ7A 5C89A 5KO4A 3JVMA 5EPSA 2KREA 2YT5A 2EGMA 4NR8A 2DKWA 2YEMA 2RNYA 5HM0A 2YYRA 3HTKC 3MHHA 1ZKRA 5D1KB 3FJUB 3S91A 3HCTA 4XUBA 3LJUX 4NR4A 2UZGA 5KH7A 5A5NA 2KE1A 5CRZA 3FEHA 2RO1A 3ONIA 4UYHA 3G0JA 3JVKA 4O7CA 5I7XA 2KFTA 3MDBC 1IYMA 5A81A 4LJNA 2VJEA 2YU4A 3C5KA 5E74A 5L99A 2VJFA 5EYAF 4B7YC 2DX8A 3SUBA 3S92A 1K2FA 2EGPA 5HRVA 2MIQA 3O7AA 2YQLA 3N9PA 5DW1A 5HJCA 1RMDA 4YYGA 4UIZA 3D1BA 3DWDA 5E3DA 5II1A 1WILA 4O7FA 5B75A 4YY4A 5C4QA 1WEMA 5TDWA 2LDRA 4J0RA 4Q0NA 2YEKA 5EA1A 4R8PK 3JVLA 5FH7A 4IR6A 2Y1MA 5E9LA 2LGLA 3M99A 3FM8C 5C87A 3MUKA 5FE2A 4TYLA 2KKXA 4IR4A 5DKDA 4HBVA 4HBYA 4NRCA 1XWHA 4HXPA 4PCEA 5CU8A 3PHDA 2YREA 5F60A 5IIDA 5G4RA 4YYNA 3U5JA 3FKMX 3NG2A 3DWYA 5E9IA 5I7YA 4UIUA 1JSPB 4IR5A 5H85A 5IG6A 3P5OA 1MM2A 4Z6HA 4TT6A 5CP5A 5B76A 2MNYA 2E3KA 2MJVB 4AP4A 4HXNA 5DW2A 4O64A 2RFJA 5EP7A 2ECGA 2JRJA 5ETBA 2D8UA 2FD4A 5BT3A 1JOCA 3PLWA 1HYJA 5HELA 2C2LA 5CUGA 2MKEA 2DVRA 1T1HA 3U5MA 3UVXA 5CPEA 5CQ8A 3HCSA 2VP7A 4HXMA 2ECTA 3O36A 1E4UA 4NYWA 4YBTA 3MXFA 3LDYA 2NXBA 5HRXA 2CSYA 4IC3A 5AD3A 1VYXA 3DPLR 3N9MA 5HENA 4UYFB 5I1QA 4Z0RA 5TDRA 3VK6A 4UIVA 4UYEA 2N9GA 5LKZA 4YYMA 2E6SA 5FE9A 3EB5A 4FIPA 2OSSA 4V3LC 5DX4A 2OUOA 3UV2A 4GNGA 3PUQA 2LAUA 2FSAA 5DLZA 5D25A 4YYDA 4QSWA 2ZETC 2ECJA 5HQ6A 5KH3A 2LGGA 5DFDA 2LN0A 2XB1A 1LDJB 2VJEB 2GRCA 3LQJA 4UYGA 4YYKA 2XEUA 3N9LA 5FG6A 5G0FA 1HYIA 3D1DA 4QUUA 2DSMA 2E61A 2DATA 3MULA 2VPBA 3SOWA 3KDEC 1WFKA 4LC2A 1WIMA 1WENA 5D0CA 5LUUA 1F68A 5D1LB 2MA5A 5I40A 2K1JA 5K3QA 3L11A 4HXRA 4N4HA 1JM4B 4Q0OA 3DAIA 5FFWA 3O37A 5AMEA 4N4IA 5FDZA 2FUUA 3GL6A 4UI9B 1X4IA 5C13A 2JUNA 5A7CA 5TBNA 3UVDA 5LVQA 4RVRA 5D24A 4BW2A 4ZDTA 5EK9A 4S3OC 2CKLA 2L5EA 4AKIA 2EA6A 5A5SA 3M62A 3ZVYA 3FAOA 4F3IA 5AIUA 4NR6A 4GB0A 1LDKC 4BW3A 4MR6A 5F1HA 4V3KC 2JMDA 5FE5A 1FP0A 5L98A 4O76A 2NAAA 2QICA 4QSRA 2H0DA 5FB0A 4C66A 4LK9A 5D3JA 4H9DA 1Z60A 4YATA 3H7HA 2RNXA 4YABA 4J3IA 5ENGA 3AADA 2KWKA 2D8SA 2VNFA 3O35A 2I50A 3UVWA 2P57A 5I89A 3HMEA 4J1PA 5ENIA 5FE6A 4WZ3B 5D1MB 3P1DA 2D82A 2CKLB 1G25A 1F62A 4QUTA 2L85A 1JM7B 4MENA 4A49A 4A4CA 2DVVA 2XP0A 4MR5A 5CUDA 3MQMA 4O7EA 2CONA 2F42A 4A4BA 4A0CD 4Z6IA 4ZW1A 2CT2A 5A5PA 4J0SA 3O70A 4LZSA 3L1XA 4R2YA 5H9MA 4LLBA 3LRQA 2OWAA 2YUCA 3M7KA 3ZYUA 4IC2A 4Q6FA 2R10A 4OGIA 4TT2A 5FFYA 5COIA 5HRWA 4MR4A 4P5OB 5EVAA 2ECVA 3KV5A 4L7XA 5A5RA 5TCMA 5DFCA 2F6JA 2YW5A 4LR6A 4LZRA 1DVPA 2YSMA 3JVJA 4HBXA 3JUEA 5LVRA 3LQIA 4BBQA 4N4FA 4YADA 1WUGA 2YDWA 5I29A 4QSQA 4TU4A 5FG4A 5ETDA 3Q2EA 3KQIA 4GNEA 4XI1A 4CFKA 2K4DA 5CQTA 2KWOA 4HXKA 2JMJA 4QQ4A 4IOOA 4CUUA 3Q1DA 4X2IA 5H1TA 5CUCA 5D3SA 5LJ0A 2JMIA 4X3GA 3U5PA 4AVXA 2M1RA 4ZQLA 4WZ2A 4QZSA 3T9KA 5BT4A 3U5LA 3HMHA 3O47A 4NN2A 4Z0OA 2M3HA 5D3RA 2B0OE 4NQMA 5EM3A 2E6RA 2LQ6A 2CSZA 5FE4A 4Z1QA 2L84A 5DBMA 4Y03A 2VPGA 2LXHC 5EWVA 5CTLA 5ENFA 4CUPA 2Y1NA 2YHNA 4PKLA 4PY6A 4BHWA 2MNZA 3IU5A 5E9MA 5SVYA 3Q2FA 4YK0A 4W4UA 1X4JA 5JG6A 5FG5A 5J0DA 4KCXA 5H1VA 2L0BA 5TABA 3D7CA 2K17A 5B78A 1VFYA 2VPDA 4IOQA 4OGEA 5CGPA 2MUMA 3G0LA 2OXQC 2ECNA 2PNXA 4QF2A 5AD2A 5FE8A 3T7LA 4QSTA 4UP5A 2KWJA 2KR4A 4OUFA 3ZPVE 4UITA 4I7BA 4CA1A 2R0VA 3O33A 4QB3A 4YH4A 1Z6UA 2L75A 5SVIB 2QJ0A 3V43A 5B8DA 3EB6A 4A9LA 5EQ1A 2YYNA 3P1EA 5EWDA 5A5OA 5CS8A 2JM3A 1X4UA 4NUDA 5EISA 3ZVZB 1N87A 4IR3A 4UYDA 4UP0A 3GV4A 5E3GA 2DWWA 2R0YA 4NRBA 4WHUA 5D26A 4FK5A 3SHBA 4MEPA 4O75A 5A83A 3K2JA 3ASLA 4A9HA 2HYED 5E73A 2YHOA 5KU3A 3N9QA 5H1UA 2H0DB
chains in the Genus database with same CATH topology
2DVQA 2IDAA 4NYVA 2VJFB 4O77A 3HMFA 2RNWA 4A9KA 2YSJA 5KH9A 5D7XA 4O72A 4L58A 2VPEA 5AMFA 4CUSA 2LSPB 5HFRA 4NQNA 1WGMA 5F2PA 4PS5A 5KHMA 5IGLA 3AQAA 4ZUXU 5G05B 3O34A 4LKAA 4QF3A 4A9EA 4A9FA 4KV1A 5C7NA 5A82A 4GNDA 4O74A 3SOXA 4C9ZA 5DINA 4N4GA 5F62A 2DVSA 1N72A 4O70A 5II2A 3N9OA 3U5OA 5HLSA 4AKNA 5C85A 5D3HA 1ZBDB 5LJ2A 1WEEA 3RCWA 3UVYA 5ENBA 2AN6A 4MSXA 4ALHA 3U5KA 3T6RA 5L8UA 5IBNA 4O78A 4NUEA 5CY9A 2L5UA 5I3LA 5TRBA 4N3WA 2KIZA 4HXOA 5G4SA 1CHCA 5B79A 2RI7A 4BW1A 4NS5A 5DKAA 5F61A 3LXJA 4KV4A 4QR3A 5FB1A 3MHSA 4XYAA 4O7BA 2KGGA 4QEVA 4CURA 5DYCA 2E7NA 2YQDA 4LYSA 4PCIA 5DYXA 4QSPA 4FO9A 2RS9B 1EQFA 5CUAA 3SVHA 5AITA 3DQVR 4AUQB 5DYUA 4IORA 4YYIA 4HXSA 4NUCA 4TT4A 5EWCA 3I2DA 4GPJA 3RPGB 5A85A 2H60A 4YYHA 1WEOA 3ZYQA 5CQ5A 2ECIA 2ECWA 2OO1A 4XUAA 1Z2QA 3GG3A 2KU3A 3RTRB 4Z1SA 4NRAA 4CCGX 5FE0A 4NR9A 2L80A 2YW8A 4QEWA 4YC9A 5EPRA 4QBMA 5FE1A 4NR5A 5DLXA 4ZC9A 4O7AA 4YBSA 5DY7A 5CQ6A 4TZ8A 2G6QA 4DONA 2HDPA 5TB6A 1E6IA 4YY6A 2QIZA 4UYFA 4CLBA 2KYUA 5C11A 2KTBB 5FEYA 2L43A 5DFBA 2WP2A 4YYJA 5EGUA 2WP1A 4O71A 4QY4A 5JWMA 5F3AA 3L1ZB 1MM3A 3PURA 5CFWA 4QSUA 4C67A 5FH8A 4QR4A 4LYWA 3UV4A 5I88A 5HQ5A 3NXBA 5K29A 1WEQA 4CL9A 5I86A 5BT5A 1WEUA 5EI4A 4WA6A 4A9MA 4PTBA 5E7DA 1ZS5A 2KWNA 2LGVA 5KTWA 5E0RA 4A9OA 4TKPB 4NR7A 5FH6A 2LRIC 5CQ7A 5L97A 4TU6A 3QZSA 3QZVA 3QZTA 5KTUA 4QNSA 2BAYA 4CUQA 4E96A 4LZ2A 1WUMA 3MB3A 4AYCB 3SOUA 5EPBA 5LJ1A 1U6GB 5ENJA 4HXLA 4FJCA 1JM7A 5DYAA 5FBXA 4A9JA 4AYCA 4LDFA 5C8GA 3U5NA 2RSDA 4HBWA 3ZTGA 1X0JA 4YAXA 3SVGA 5EU1A 5B77A 2KGIA 4CFLA 5ENCA 4GNFA 5A5QA 5EWHA 5E9KA 4R7EA 4A9IA 5E9VA 2LV9A 4TZ2A 4I7CA 4FLPA 5I80A 5D3LA 3P1CA 4LRGA 5CQ4A 5IGMA 4B86C 2E7OA 4UIWA 4YH3A 5J3XA 4I7DA 5IGKA 2YELA 4CUTA 1WESA 3IHPA 5F1LA 5LKUA 5F25A 5F63A 4XY8A 5L96A 4XY9A 2R0SA 4MEQA 5CUEA 5FE7A 2G45A 2MD7B 5LKXA 5LKTA 2FUIA 3I3JA 2MD8C 5CUBA 5D3NA 4QYLA 5IGNA 1WE9A 3C6WA 5HEMA 4LADB 1V87A 1WEWA 4QYDA 3FL2A 1BORA 5DKCA 3ZNIA 4QEUA 1FBVA 2M6MA 5F5ZA 3KNVA 2C2VS 4TQNA 5FE3A 4TS8A 5EICA 4WHWA 4UIXA 4QSSA 4WIVA 4NXJA 2YQMA 2MA6A 5G04B 5KTXA 3SVFA 4BW4A 4PPEA 2I8NA 3LJWA 4QSVA 4QSXA 2LGKA 2YURA 3KV6A 4MEOA 5DKHA 5FFVA 5HCLA 4OGJA 1WEPA 4QC1A 3P1FA 3LQHA 3UV5A 3IU6A 5EWWA 2PUYA 4A9NA 4WZ0A 2F6NA 5JI8A 2K16A 4Z93A 4YBMA 5D3PA 5L8TA 4QC3A 3M63A 4ALGA 5D3TA 2Y43A 4S3OB 5FERA 4UIYA 5ENHA 2I7KA 4BJXA 3MB4A 4QR5A 3TLPA 2LXPC 5EV9A 3RPGC 4LYIA 5HFQA 3N9NA 5CQ3A 3HCUA 3ZPV1 5F36A 2G4AA 5CQAA 1VD4A 2M85A 2EODA 4MR3A 4NYXA 2G43A 3UW9A 5LCWB 2D9EA 1WEVA 2MT5A 5I83A 4TTEA 5ACYA 5CRMA 5CZGA 4MVTA 5ENEA 4F52B 5E9YA 5HQ7A 5C89A 5KO4A 3JVMA 5EPSA 2KREA 2YT5A 4NR8A 2DKWA 2YEMA 2RNYA 5HM0A 2YYRA 3HTKC 3MHHA 5D1KB 3S91A 3HCTA 4XUBA 4NR4A 2UZGA 5KH7A 5A5NA 2KE1A 5CRZA 2RO1A 3ONIA 4UYHA 3G0JA 3JVKA 4O7CA 5I7XA 2KFTA 1IYMA 5A81A 4LJNA 2VJEA 2YU4A 3C5KA 5E74A 5L99A 2VJFA 5EYAF 4B7YC 2DX8A 3S92A 1K2FA 2EGPA 5HRVA 2MIQA 3O7AA 2YQLA 3N9PA 5DW1A 5HJCA 1RMDA 4YYGA 4UIZA 5E3DA 5II1A 1WILA 4O7FA 5B75A 4YY4A 5C4QA 1WEMA 5TDWA 2LDRA 4J0RA 4Q0NA 2YEKA 5EA1A 4R8PK 3JVLA 5FH7A 4IR6A 2Y1MA 5E9LA 2LGLA 3M99A 5C87A 3MUKA 5FE2A 4TYLA 4IR4A 5DKDA 4HBVA 4HBYA 4NRCA 1XWHA 4HXPA 4PCEA 5CU8A 3PHDA 2YREA 5F60A 5IIDA 5G4RA 4YYNA 3U5JA 3FKMX 3NG2A 3DWYA 5E9IA 5I7YA 4UIUA 1JSPB 4IR5A 5H85A 5IG6A 3P5OA 1MM2A 4Z6HA 4TT6A 5CP5A 5B76A 2MNYA 2E3KA 2MJVB 4AP4A 4HXNA 5DW2A 4O64A 2RFJA 5EP7A 2ECGA 2JRJA 5ETBA 5BT3A 1JOCA 1HYJA 5HELA 2C2LA 5CUGA 2DVRA 1T1HA 3U5MA 3UVXA 5CPEA 5CQ8A 3HCSA 2VP7A 4HXMA 2ECTA 3O36A 1E4UA 4NYWA 4YBTA 3MXFA 2NXBA 5HRXA 2CSYA 4IC3A 5AD3A 1VYXA 3DPLR 3N9MA 5HENA 4UYFB 5I1QA 5TDRA 3VK6A 4UIVA 4UYEA 2N9GA 5LKZA 4YYMA 2E6SA 5FE9A 3EB5A 4FIPA 2OSSA 4V3LC 5DX4A 2OUOA 3UV2A 4GNGA 3PUQA 2FSAA 5DLZA 5D25A 4YYDA 4QSWA 2ZETC 2ECJA 5HQ6A 5KH3A 2LGGA 5DFDA 2LN0A 2XB1A 1LDJB 2VJEB 3LQJA 2GRCA 4UYGA 4YYKA 2XEUA 3N9LA 5FG6A 5G0FA 1HYIA 4QUUA 2DATA 3MULA 2VPBA 3SOWA 1WFKA 4LC2A 1WIMA 1WENA 5D0CA 5LUUA 1F68A 5D1LB 2MA5A 5I40A 2K1JA 3L11A 4HXRA 4N4HA 1JM4B 4Q0OA 3DAIA 5FFWA 3O37A 5AMEA 4N4IA 5FDZA 2FUUA 3GL6A 4UI9B 1X4IA 5C13A 5A7CA 5TBNA 3UVDA 5LVQA 4RVRA 5D24A 4BW2A 4ZDTA 5EK9A 4S3OC 2CKLA 2L5EA 2EA6A 3ZVYA 5A5SA 3M62A 4F3IA 5AIUA 4NR6A 4GB0A 1LDKC 4BW3A 4MR6A 5F1HA 4V3KC 2JMDA 5FE5A 1FP0A 5L98A 4O76A 2NAAA 2QICA 4QSRA 2H0DA 5FB0A 4C66A 4LK9A 5D3JA 1Z60A 4YATA 2RNXA 4YABA 4J3IA 5ENGA 3AADA 2KWKA 2D8SA 2VNFA 3O35A 2I50A 3UVWA 5I89A 3HMEA 4J1PA 5ENIA 5FE6A 4WZ3B 5D1MB 3P1DA 2D82A 2CKLB 1G25A 1F62A 4QUTA 2L85A 1JM7B 4MENA 4A49A 4A4CA 2DVVA 4MR5A 5CUDA 3MQMA 4O7EA 2F42A 4A4BA 4A0CD 4Z6IA 4ZW1A 2CT2A 5A5PA 4J0SA 3O70A 4LZSA 3L1XA 4R2YA 5H9MA 4LLBA 3LRQA 2YUCA 3ZYUA 4IC2A 4Q6FA 2R10A 4OGIA 4TT2A 5FFYA 5COIA 5HRWA 4MR4A 4P5OB 5EVAA 2ECVA 3KV5A 4L7XA 5A5RA 5TCMA 5DFCA 2F6JA 2YW5A 4LR6A 4LZRA 1DVPA 2YSMA 3JVJA 4HBXA 5LVRA 3LQIA 4BBQA 4N4FA 4YADA 1WUGA 2YDWA 5I29A 4QSQA 4TU4A 5FG4A 5ETDA 3Q2EA 3KQIA 4GNEA 4XI1A 4CFKA 2K4DA 5CQTA 2KWOA 4HXKA 2JMJA 4IOOA 4CUUA 4X2IA 5H1TA 5CUCA 5D3SA 5LJ0A 2JMIA 4X3GA 3U5PA 4AVXA 2M1RA 4ZQLA 4WZ2A 4QZSA 5BT4A 3U5LA 3HMHA 4NN2A 2M3HA 5D3RA 4NQMA 5EM3A 2E6RA 2LQ6A 2CSZA 5FE4A 4Z1QA 2L84A 5DBMA 4Y03A 2VPGA 2LXHC 5EWVA 5CTLA 5ENFA 4CUPA 2Y1NA 2YHNA 4PKLA 4PY6A 4BHWA 2MNZA 3IU5A 5E9MA 3Q2FA 4YK0A 4W4UA 1X4JA 5JG6A 5FG5A 5J0DA 4KCXA 5H1VA 2L0BA 5TABA 3D7CA 2K17A 5B78A 1VFYA 2VPDA 4IOQA 5CGPA 2MUMA 3G0LA 2OXQC 2ECNA 2PNXA 4QF2A 5AD2A 5FE8A 3T7LA 4QSTA 4UP5A 2KWJA 2KR4A 4OUFA 3ZPVE 4UITA 4I7BA 4CA1A 2R0VA 3O33A 4QB3A 4YH4A 1Z6UA 2L75A 3V43A 2QJ0A 5B8DA 3EB6A 4A9LA 5EQ1A 2YYNA 3P1EA 5EWDA 5A5OA 5CS8A 1X4UA 4NUDA 5EISA 3ZVZB 1N87A 4IR3A 4UYDA 4UP0A 3GV4A 5E3GA 2DWWA 2R0YA 4NRBA 4WHUA 5D26A 4FK5A 3SHBA 4MEPA 4O75A 5A83A 3K2JA 3ASLA 4A9HA 2HYED 5E73A 2YHOA 5KU3A 3N9QA 5H1UA 2H0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVQ A;  2IDA A;  4NYV A;  2VJF B;  4O77 A;  3HMF A;  2RNW A;  4A9K A;  2YSJ A;  5KH9 A;  5D7X A;  4O72 A;  4L58 A;  2VPE A;  5AMF A;  4CUS A;  2LSP B;  5HFR A;  4NQN A;  1WGM A;  5F2P A;  4PS5 A;  5KHM A;  5IGL A;  3AQA A;  4ZUX U;  5G05 B;  3O34 A;  4LKA A;  4QF3 A;  4A9E A;  4A9F A;  4KV1 A;  5C7N A;  5A82 A;  4GND A;  4O74 A;  3SOX A;  4C9Z A;  5DIN A;  4N4G A;  5F62 A;  2DVS A;  1N72 A;  4O70 A;  5II2 A;  3N9O A;  3U5O A;  5HLS A;  4AKN A;  5C85 A;  5D3H A;  1ZBD B;  5LJ2 A;  1WEE A;  3RCW A;  3UVY A;  5ENB A;  2AN6 A;  4MSX A;  4ALH A;  3U5K A;  3T6R A;  5L8U A;  5IBN A;  4O78 A;  4NUE A;  5CY9 A;  2L5U A;  5I3L A;  5TRB A;  4N3W A;  2KIZ A;  4HXO A;  5G4S A;  1CHC A;  5B79 A;  2RI7 A;  4BW1 A;  4NS5 A;  5DKA A;  5F61 A;  3LXJ A;  4KV4 A;  4QR3 A;  5FB1 A;  3MHS A;  4XYA A;  4O7B A;  2KGG A;  4QEV A;  4CUR A;  5DYC A;  2E7N A;  2YQD A;  4LYS A;  4PCI A;  5DYX A;  4QSP A;  4FO9 A;  2RS9 B;  1EQF A;  5CUA A;  3SVH A;  5AIT A;  3DQV R;  4AUQ B;  5DYU A;  4IOR A;  4YYI A;  4HXS A;  4NUC A;  4TT4 A;  5EWC A;  3I2D A;  4GPJ A;  3RPG B;  5A85 A;  2H60 A;  4YYH A;  1WEO A;  3ZYQ A;  5CQ5 A;  2ECI A;  2ECW A;  2OO1 A;  4XUA A;  1Z2Q A;  3GG3 A;  2KU3 A;  3RTR B;  4Z1S A;  4NRA A;  4CCG X;  5FE0 A;  4NR9 A;  2L80 A;  2YW8 A;  4QEW A;  4YC9 A;  5EPR A;  4QBM A;  5FE1 A;  4NR5 A;  5DLX A;  4ZC9 A;  4O7A A;  4YBS A;  5DY7 A;  5CQ6 A;  4TZ8 A;  2G6Q A;  4DON A;  2HDP A;  5TB6 A;  1E6I A;  4YY6 A;  2QIZ A;  4UYF A;  4CLB A;  2KYU A;  5C11 A;  2KTB B;  5FEY A;  2L43 A;  5DFB A;  2WP2 A;  4YYJ A;  5EGU A;  2WP1 A;  4O71 A;  4QY4 A;  5JWM A;  5F3A A;  3L1Z B;  1MM3 A;  3PUR A;  5CFW A;  4QSU A;  4C67 A;  5FH8 A;  4QR4 A;  4LYW A;  3UV4 A;  5I88 A;  5HQ5 A;  3NXB A;  5K29 A;  1WEQ A;  4CL9 A;  5I86 A;  5BT5 A;  1WEU A;  5EI4 A;  4WA6 A;  4A9M A;  4PTB A;  5E7D A;  1ZS5 A;  2KWN A;  2LGV A;  5KTW A;  5E0R A;  4A9O A;  4TKP B;  4NR7 A;  5FH6 A;  2LRI C;  5CQ7 A;  5L97 A;  4TU6 A;  3QZS A;  3QZV A;  3QZT A;  5KTU A;  4QNS A;  2BAY A;  4CUQ A;  4E96 A;  4LZ2 A;  1WUM A;  3MB3 A;  4AYC B;  3SOU A;  5EPB A;  5LJ1 A;  1U6G B;  5ENJ A;  4HXL A;  4FJC A;  1JM7 A;  5DYA A;  5FBX A;  4A9J A;  4AYC A;  4LDF A;  5C8G A;  3U5N A;  2RSD A;  4HBW A;  3ZTG A;  1X0J A;  4YAX A;  3SVG A;  5EU1 A;  5B77 A;  2KGI A;  4CFL A;  5ENC A;  4GNF A;  5A5Q A;  5EWH A;  5E9K A;  4R7E A;  4A9I A;  5E9V A;  2LV9 A;  4TZ2 A;  4I7C A;  4FLP A;  5I80 A;  5D3L A;  3P1C A;  4LRG A;  5CQ4 A;  5IGM A;  4B86 C;  2E7O A;  4UIW A;  4YH3 A;  5J3X A;  4I7D A;  5IGK A;  2YEL A;  4CUT A;  1WES A;  3IHP A;  5F1L A;  5LKU A;  5F25 A;  5F63 A;  4XY8 A;  5L96 A;  4XY9 A;  2R0S A;  4MEQ A;  5CUE A;  5FE7 A;  2G45 A;  2MD7 B;  5LKX A;  5LKT A;  2FUI A;  3I3J A;  2MD8 C;  5CUB A;  5D3N A;  4QYL A;  5IGN A;  1WE9 A;  3C6W A;  5HEM A;  4LAD B;  1V87 A;  1WEW A;  4QYD A;  3FL2 A;  1BOR A;  5DKC A;  3ZNI A;  4QEU A;  1FBV A;  2M6M A;  5F5Z A;  3KNV A;  2C2V S;  4TQN A;  5FE3 A;  4TS8 A;  5EIC A;  4WHW A;  4UIX A;  4QSS A;  4WIV A;  4NXJ A;  2YQM A;  2MA6 A;  5G04 B;  5KTX A;  3SVF A;  4BW4 A;  4PPE A;  2I8N A;  3LJW A;  4QSV A;  4QSX A;  2LGK A;  2YUR A;  3KV6 A;  4MEO A;  5DKH A;  5FFV A;  5HCL A;  4OGJ A;  1WEP A;  4QC1 A;  3P1F A;  3LQH A;  3UV5 A;  3IU6 A;  5EWW A;  2PUY A;  4A9N A;  4WZ0 A;  2F6N A;  5JI8 A;  2K16 A;  4Z93 A;  4YBM A;  5D3P A;  5L8T A;  4QC3 A;  3M63 A;  4ALG A;  5D3T A;  2Y43 A;  4S3O B;  5FER A;  4UIY A;  5ENH A;  2I7K A;  4BJX A;  3MB4 A;  4QR5 A;  3TLP A;  2LXP C;  5EV9 A;  3RPG C;  4LYI A;  5HFQ A;  3N9N A;  5CQ3 A;  3HCU A;  3ZPV 1;  5F36 A;  2G4A A;  5CQA A;  1VD4 A;  2M85 A;  2EOD A;  4MR3 A;  4NYX A;  2G43 A;  3UW9 A;  5LCW B;  2D9E A;  1WEV A;  2MT5 A;  5I83 A;  4TTE A;  5ACY A;  5CRM A;  5CZG A;  4MVT A;  5ENE A;  4F52 B;  5E9Y A;  5HQ7 A;  5C89 A;  5KO4 A;  3JVM A;  5EPS A;  2KRE A;  2YT5 A;  4NR8 A;  2DKW A;  2YEM A;  2RNY A;  5HM0 A;  2YYR A;  3HTK C;  3MHH A;  5D1K B;  3S91 A;  3HCT A;  4XUB A;  4NR4 A;  2UZG A;  5KH7 A;  5A5N A;  2KE1 A;  5CRZ A;  2RO1 A;  3ONI A;  4UYH A;  3G0J A;  3JVK A;  4O7C A;  5I7X A;  2KFT A;  1IYM A;  5A81 A;  4LJN A;  2VJE A;  2YU4 A;  3C5K A;  5E74 A;  5L99 A;  2VJF A;  5EYA F;  4B7Y C;  2DX8 A;  3S92 A;  1K2F A;  2EGP A;  5HRV A;  2MIQ A;  3O7A A;  2YQL A;  3N9P A;  5DW1 A;  5HJC A;  1RMD A;  4YYG A;  4UIZ A;  5E3D A;  5II1 A;  1WIL A;  4O7F A;  5B75 A;  4YY4 A;  5C4Q A;  1WEM A;  5TDW A;  2LDR A;  4J0R A;  4Q0N A;  2YEK A;  5EA1 A;  4R8P K;  3JVL A;  5FH7 A;  4IR6 A;  2Y1M A;  5E9L A;  2LGL A;  3M99 A;  5C87 A;  3MUK A;  5FE2 A;  4TYL A;  4IR4 A;  5DKD A;  4HBV A;  4HBY A;  4NRC A;  1XWH A;  4HXP A;  4PCE A;  5CU8 A;  3PHD A;  2YRE A;  5F60 A;  5IID A;  5G4R A;  4YYN A;  3U5J A;  3FKM X;  3NG2 A;  3DWY A;  5E9I A;  5I7Y A;  4UIU A;  1JSP B;  4IR5 A;  5H85 A;  5IG6 A;  3P5O A;  1MM2 A;  4Z6H A;  4TT6 A;  5CP5 A;  5B76 A;  2MNY A;  2E3K A;  2MJV B;  4AP4 A;  4HXN A;  5DW2 A;  4O64 A;  2RFJ A;  5EP7 A;  2ECG A;  2JRJ A;  5ETB A;  5BT3 A;  1JOC A;  1HYJ A;  5HEL A;  2C2L A;  5CUG A;  2DVR A;  1T1H A;  3U5M A;  3UVX A;  5CPE A;  5CQ8 A;  3HCS A;  2VP7 A;  4HXM A;  2ECT A;  3O36 A;  1E4U A;  4NYW A;  4YBT A;  3MXF A;  2NXB A;  5HRX A;  2CSY A;  4IC3 A;  5AD3 A;  1VYX A;  3DPL R;  3N9M A;  5HEN A;  4UYF B;  5I1Q A;  5TDR A;  3VK6 A;  4UIV A;  4UYE A;  2N9G A;  5LKZ A;  4YYM A;  2E6S A;  5FE9 A;  3EB5 A;  4FIP A;  2OSS A;  4V3L C;  5DX4 A;  2OUO A;  3UV2 A;  4GNG A;  3PUQ A;  2FSA A;  5DLZ A;  5D25 A;  4YYD A;  4QSW A;  2ZET C;  2ECJ A;  5HQ6 A;  5KH3 A;  2LGG A;  5DFD A;  2LN0 A;  2XB1 A;  1LDJ B;  2VJE B;  3LQJ A;  2GRC A;  4UYG A;  4YYK A;  2XEU A;  3N9L A;  5FG6 A;  5G0F A;  1HYI A;  4QUU A;  2DAT A;  3MUL A;  2VPB A;  3SOW A;  1WFK A;  4LC2 A;  1WIM A;  1WEN A;  5D0C A;  5LUU A;  1F68 A;  5D1L B;  2MA5 A;  5I40 A;  2K1J A;  3L11 A;  4HXR A;  4N4H A;  1JM4 B;  4Q0O A;  3DAI A;  5FFW A;  3O37 A;  5AME A;  4N4I A;  5FDZ A;  2FUU A;  3GL6 A;  4UI9 B;  1X4I A;  5C13 A;  5A7C A;  5TBN A;  3UVD A;  5LVQ A;  4RVR A;  5D24 A;  4BW2 A;  4ZDT A;  5EK9 A;  4S3O C;  2CKL A;  2L5E A;  2EA6 A;  3ZVY A;  5A5S A;  3M62 A;  4F3I A;  5AIU A;  4NR6 A;  4GB0 A;  1LDK C;  4BW3 A;  4MR6 A;  5F1H A;  4V3K C;  2JMD A;  5FE5 A;  1FP0 A;  5L98 A;  4O76 A;  2NAA A;  2QIC A;  4QSR A;  2H0D A;  5FB0 A;  4C66 A;  4LK9 A;  5D3J A;  1Z60 A;  4YAT A;  2RNX A;  4YAB A;  4J3I A;  5ENG A;  3AAD A;  2KWK A;  2D8S A;  2VNF A;  3O35 A;  2I50 A;  3UVW A;  5I89 A;  3HME A;  4J1P A;  5ENI A;  5FE6 A;  4WZ3 B;  5D1M B;  3P1D A;  2D82 A;  2CKL B;  1G25 A;  1F62 A;  4QUT A;  2L85 A;  1JM7 B;  4MEN A;  4A49 A;  4A4C A;  2DVV A;  4MR5 A;  5CUD A;  3MQM A;  4O7E A;  2F42 A;  4A4B A;  4A0C D;  4Z6I A;  4ZW1 A;  2CT2 A;  5A5P A;  4J0S A;  3O70 A;  4LZS A;  3L1X A;  4R2Y A;  5H9M A;  4LLB A;  3LRQ A;  2YUC A;  3ZYU A;  4IC2 A;  4Q6F A;  2R10 A;  4OGI A;  4TT2 A;  5FFY A;  5COI A;  5HRW A;  4MR4 A;  4P5O B;  5EVA A;  2ECV A;  3KV5 A;  4L7X A;  5A5R A;  5TCM A;  5DFC A;  2F6J A;  2YW5 A;  4LR6 A;  4LZR A;  1DVP A;  2YSM A;  3JVJ A;  4HBX A;  5LVR A;  3LQI A;  4BBQ A;  4N4F A;  4YAD A;  1WUG A;  2YDW A;  5I29 A;  4QSQ A;  4TU4 A;  5FG4 A;  5ETD A;  3Q2E A;  3KQI A;  4GNE A;  4XI1 A;  4CFK A;  2K4D A;  5CQT A;  2KWO A;  4HXK A;  2JMJ A;  4IOO A;  4CUU A;  4X2I A;  5H1T A;  5CUC A;  5D3S A;  5LJ0 A;  2JMI A;  4X3G A;  3U5P A;  4AVX A;  2M1R A;  4ZQL A;  4WZ2 A;  4QZS A;  5BT4 A;  3U5L A;  3HMH A;  4NN2 A;  2M3H A;  5D3R A;  4NQM A;  5EM3 A;  2E6R A;  2LQ6 A;  2CSZ A;  5FE4 A;  4Z1Q A;  2L84 A;  5DBM A;  4Y03 A;  2VPG A;  2LXH C;  5EWV A;  5CTL A;  5ENF A;  4CUP A;  2Y1N A;  2YHN A;  4PKL A;  4PY6 A;  4BHW A;  2MNZ A;  3IU5 A;  5E9M A;  3Q2F A;  4YK0 A;  4W4U A;  1X4J A;  5JG6 A;  5FG5 A;  5J0D A;  4KCX A;  5H1V A;  2L0B A;  5TAB A;  3D7C A;  2K17 A;  5B78 A;  1VFY A;  2VPD A;  4IOQ A;  5CGP A;  2MUM A;  3G0L A;  2OXQ C;  2ECN A;  2PNX A;  4QF2 A;  5AD2 A;  5FE8 A;  3T7L A;  4QST A;  4UP5 A;  2KWJ A;  2KR4 A;  4OUF A;  3ZPV E;  4UIT A;  4I7B A;  4CA1 A;  2R0V A;  3O33 A;  4QB3 A;  4YH4 A;  1Z6U A;  2L75 A;  3V43 A;  2QJ0 A;  5B8D A;  3EB6 A;  4A9L A;  5EQ1 A;  2YYN A;  3P1E A;  5EWD A;  5A5O A;  5CS8 A;  1X4U A;  4NUD A;  5EIS A;  3ZVZ B;  1N87 A;  4IR3 A;  4UYD A;  4UP0 A;  3GV4 A;  5E3G A;  2DWW A;  2R0Y A;  4NRB A;  4WHU A;  5D26 A;  4FK5 A;  3SHB A;  4MEP A;  4O75 A;  5A83 A;  3K2J A;  3ASL A;  4A9H A;  2HYE D;  5E73 A;  2YHO A;  5KU3 A;  3N9Q A;  5H1U A;  2H0D B; 
#chains in the Genus database with same CATH topology
 2DVQ A;  2IDA A;  2XOZ A;  4NYV A;  2VJF B;  4O77 A;  3HMF A;  2RNW A;  4A9K A;  2YSJ A;  5KH9 A;  5D7X A;  4O72 A;  4L58 A;  2VPE A;  5AMF A;  4CUS A;  2LSP B;  5HFR A;  4NQN A;  1WGM A;  5F2P A;  4PS5 A;  5KHM A;  5IGL A;  3AQA A;  4ZUX U;  5G05 B;  3O34 A;  4LKA A;  4QF3 A;  4A9E A;  2IQJ A;  4A9F A;  4KV1 A;  5C7N A;  5A82 A;  2CSV A;  4O74 A;  1DCQ A;  4GND A;  3SOX A;  3VKG A;  5DIN A;  4C9Z A;  4N4G A;  5F62 A;  2DVS A;  1N72 A;  4O70 A;  5II2 A;  3N9O A;  3ERR A;  3U5O A;  5HLS A;  2EXU A;  4AKN A;  5C85 A;  5D3H A;  1ZBD B;  2CRW A;  5LJ2 A;  1WEE A;  3RCW A;  3UVY A;  5ENB A;  2AN6 A;  4MSX A;  4ALH A;  3U5K A;  3T6R A;  5L8U A;  5IBN A;  4O78 A;  4NUE A;  5CY9 A;  2L5U A;  5I3L A;  3VKH A;  4O62 A;  4N3W A;  2KIZ A;  5TRB A;  4HXO A;  5G4S A;  1CHC A;  5B79 A;  2RI7 A;  4BW1 A;  5SVX A;  4NS5 A;  5DKA A;  5F61 A;  3LXJ A;  4KV4 A;  4QR3 A;  5FB1 A;  2RR4 A;  3MHS A;  4XYA A;  4O7B A;  2KGG A;  4QEV A;  4CUR A;  5DYC A;  2E7N A;  2YQD A;  4LYS A;  4PCI A;  5DYX A;  4QSP A;  4FO9 A;  2RS9 B;  1EQF A;  2EJN A;  5CUA A;  3SVH A;  5AIT A;  3DQV R;  4AUQ B;  5DYU A;  4IOR A;  4YYI A;  2L7P A;  4HXS A;  4NUC A;  4TT4 A;  5EWC A;  2M13 A;  4GPJ A;  2KKY A;  3I2D A;  3RPG B;  5A85 A;  2H60 A;  4AKG A;  4YYH A;  1WEO A;  3ZYQ A;  5CQ5 A;  2ECI A;  2ECW A;  2OO1 A;  4XUA A;  1Z2Q A;  3GG3 A;  2KU3 A;  3RTR B;  4Z1S A;  4NRA A;  2CRR A;  4CCG X;  5FE0 A;  4NR9 A;  2L80 A;  2YW8 A;  1MBM A;  4AI6 A;  4QEW A;  4YC9 A;  5EPR A;  4QBM A;  5FE1 A;  4NR5 A;  5DLX A;  4ZC9 A;  4O7A A;  3FAN A;  4YBS A;  5DY7 A;  5CQ6 A;  4TZ8 A;  2G6Q A;  4DON A;  2HDP A;  5TB6 A;  1E6I A;  4YY6 A;  2QIZ A;  4UYF A;  4CLB A;  2KYU A;  5C11 A;  2KTB B;  5FEY A;  2L43 A;  5DFB A;  2WP2 A;  4YYJ A;  5EGU A;  2WP1 A;  4O71 A;  4QY4 A;  5JWM A;  5F3A A;  3L1Z B;  1MM3 A;  3PUR A;  5CFW A;  4QSU A;  4C67 A;  5FH8 A;  4QR4 A;  2FFW A;  4LYW A;  3UV4 A;  5I88 A;  5HQ5 A;  3NXB A;  5K29 A;  1WEQ A;  4CL9 A;  5I86 A;  5BT5 A;  3LVR E;  1WEU A;  5EI4 A;  4WA6 A;  4A9M A;  2XOC A;  4PTB A;  5E7D A;  1ZS5 A;  2KWN A;  2DJA A;  2LGV A;  5KTW A;  5E0R A;  4A9O A;  4TKP B;  3DDT A;  4NR7 A;  5FH6 A;  2LRI C;  5CQ7 A;  5L97 A;  4TU6 A;  4OGC A;  3QZS A;  3QZV A;  3QZT A;  5KTU A;  4QNS A;  2BAY A;  4CUQ A;  4E96 A;  5SVI A;  4LZ2 A;  1WUM A;  3MB3 A;  4AYC B;  3SOU A;  5EPB A;  5LJ1 A;  1U6G B;  5ENJ A;  2YVR A;  4HXL A;  4FJC A;  1JM7 A;  5DYA A;  5FBX A;  4A9J A;  4AYC A;  4LDF A;  5C8G A;  3U5N A;  2RSD A;  4HBW A;  3ZTG A;  1X0J A;  4YAX A;  3SVG A;  5EU1 A;  5B77 A;  2KGI A;  4CFL A;  5ENC A;  4GNF A;  5A5Q A;  5EWH A;  5E9K A;  4R7E A;  4A9I A;  5E9V A;  2LV9 A;  4TZ2 A;  4I7C A;  4FLP A;  5I80 A;  5D3L A;  3P1C A;  4LRG A;  5CQ4 A;  5IGM A;  4B86 C;  2E7O A;  4UIW A;  4YH3 A;  5J3X A;  4I7D A;  5IGK A;  2YEL A;  4CUT A;  1WES A;  3IHP A;  5F1L A;  3LVQ E;  5LKU A;  5F25 A;  5F63 A;  4XY8 A;  5L96 A;  4XY9 A;  2R0S A;  4MEQ A;  5CUE A;  5FE7 A;  2XOY A;  2G45 A;  2MD7 B;  5LKX A;  5LKT A;  2FUI A;  3I3J A;  2MD8 C;  5CUB A;  5D3N A;  4QYL A;  5IGN A;  1WE9 A;  3C6W A;  5HEM A;  4LAD B;  1V87 A;  1WEW A;  4QYD A;  3FL2 A;  1BOR A;  5DKC A;  3ZNI A;  4QEU A;  1FBV A;  4AKH A;  2M6M A;  5F5Z A;  3KNV A;  2C2V S;  4TQN A;  5FE3 A;  4F1P A;  4TS8 A;  5EIC A;  4WHW A;  4UIX A;  4QSS A;  4WIV A;  4NXJ A;  2YQM A;  2MA6 A;  5G04 B;  5KTX A;  3SVF A;  4BW4 A;  4PPE A;  2I8N A;  3LJW A;  4QSV A;  4QSX A;  2LGK A;  2YUR A;  3KV6 A;  4MEO A;  5DKH A;  5FFV A;  5HCL A;  4OGJ A;  1WEP A;  4QC1 A;  3P1F A;  3LQH A;  3UV5 A;  3IU6 A;  5EWW A;  2PUY A;  4A9N A;  4WZ0 A;  2F6N A;  5JI8 A;  2K16 A;  4Z93 A;  4YBM A;  5D3P A;  5L8T A;  4QC3 A;  3M63 A;  4ALG A;  5D3T A;  2Y43 A;  4S3O B;  5FER A;  4UIY A;  5ENH A;  2I7K A;  4BJX A;  3MB4 A;  4QR5 A;  3TLP A;  2LXP C;  5EV9 A;  3RPG C;  4LYI A;  5HFQ A;  3N9N A;  5CQ3 A;  3HCU A;  3ZPV 1;  5F36 A;  2G4A A;  5CQA A;  1VD4 A;  2M85 A;  2EOD A;  4MR3 A;  4NYX A;  3E2D A;  2G43 A;  3UW9 A;  5LCW B;  2D9E A;  1WEV A;  2MT5 A;  5I83 A;  4TTE A;  5ACY A;  5CRM A;  5CZG A;  4MVT A;  5ENE A;  4F52 B;  1PUO A;  5E9Y A;  5HQ7 A;  5C89 A;  5KO4 A;  3JVM A;  5EPS A;  2KRE A;  2YT5 A;  2EGM A;  4NR8 A;  2DKW A;  2YEM A;  2RNY A;  5HM0 A;  2YYR A;  3HTK C;  3MHH A;  1ZKR A;  5D1K B;  3FJU B;  3S91 A;  3HCT A;  4XUB A;  3LJU X;  4NR4 A;  2UZG A;  5KH7 A;  5A5N A;  2KE1 A;  5CRZ A;  3FEH A;  2RO1 A;  3ONI A;  4UYH A;  3G0J A;  3JVK A;  4O7C A;  5I7X A;  2KFT A;  3MDB C;  1IYM A;  5A81 A;  4LJN A;  2VJE A;  2YU4 A;  3C5K A;  5E74 A;  5L99 A;  2VJF A;  5EYA F;  4B7Y C;  2DX8 A;  3SUB A;  3S92 A;  1K2F A;  2EGP A;  5HRV A;  2MIQ A;  3O7A A;  2YQL A;  3N9P A;  5DW1 A;  5HJC A;  1RMD A;  4YYG A;  4UIZ A;  3D1B A;  3DWD A;  5E3D A;  5II1 A;  1WIL A;  4O7F A;  5B75 A;  4YY4 A;  5C4Q A;  1WEM A;  5TDW A;  2LDR A;  4J0R A;  4Q0N A;  2YEK A;  5EA1 A;  4R8P K;  3JVL A;  5FH7 A;  4IR6 A;  2Y1M A;  5E9L A;  2LGL A;  3M99 A;  3FM8 C;  5C87 A;  3MUK A;  5FE2 A;  4TYL A;  2KKX A;  4IR4 A;  5DKD A;  4HBV A;  4HBY A;  4NRC A;  1XWH A;  4HXP A;  4PCE A;  5CU8 A;  3PHD A;  2YRE A;  5F60 A;  5IID A;  5G4R A;  4YYN A;  3U5J A;  3FKM X;  3NG2 A;  3DWY A;  5E9I A;  5I7Y A;  4UIU A;  1JSP B;  4IR5 A;  5H85 A;  5IG6 A;  3P5O A;  1MM2 A;  4Z6H A;  4TT6 A;  5CP5 A;  5B76 A;  2MNY A;  2E3K A;  2MJV B;  4AP4 A;  4HXN A;  5DW2 A;  4O64 A;  2RFJ A;  5EP7 A;  2ECG A;  2JRJ A;  5ETB A;  2D8U A;  2FD4 A;  5BT3 A;  1JOC A;  3PLW A;  1HYJ A;  5HEL A;  2C2L A;  5CUG A;  2MKE A;  2DVR A;  1T1H A;  3U5M A;  3UVX A;  5CPE A;  5CQ8 A;  3HCS A;  2VP7 A;  4HXM A;  2ECT A;  3O36 A;  1E4U A;  4NYW A;  4YBT A;  3MXF A;  3LDY A;  2NXB A;  5HRX A;  2CSY A;  4IC3 A;  5AD3 A;  1VYX A;  3DPL R;  3N9M A;  5HEN A;  4UYF B;  5I1Q A;  4Z0R A;  5TDR A;  3VK6 A;  4UIV A;  4UYE A;  2N9G A;  5LKZ A;  4YYM A;  2E6S A;  5FE9 A;  3EB5 A;  4FIP A;  2OSS A;  4V3L C;  5DX4 A;  2OUO A;  3UV2 A;  4GNG A;  3PUQ A;  2LAU A;  2FSA A;  5DLZ A;  5D25 A;  4YYD A;  4QSW A;  2ZET C;  2ECJ A;  5HQ6 A;  5KH3 A;  2LGG A;  5DFD A;  2LN0 A;  2XB1 A;  1LDJ B;  2VJE B;  2GRC A;  3LQJ A;  4UYG A;  4YYK A;  2XEU A;  3N9L A;  5FG6 A;  5G0F A;  1HYI A;  3D1D A;  4QUU A;  2DSM A;  2E61 A;  2DAT A;  3MUL A;  2VPB A;  3SOW A;  3KDE C;  1WFK A;  4LC2 A;  1WIM A;  1WEN A;  5D0C A;  5LUU A;  1F68 A;  5D1L B;  2MA5 A;  5I40 A;  2K1J A;  5K3Q A;  3L11 A;  4HXR A;  4N4H A;  1JM4 B;  4Q0O A;  3DAI A;  5FFW A;  3O37 A;  5AME A;  4N4I A;  5FDZ A;  2FUU A;  3GL6 A;  4UI9 B;  1X4I A;  5C13 A;  2JUN A;  5A7C A;  5TBN A;  3UVD A;  5LVQ A;  4RVR A;  5D24 A;  4BW2 A;  4ZDT A;  5EK9 A;  4S3O C;  2CKL A;  2L5E A;  4AKI A;  2EA6 A;  5A5S A;  3M62 A;  3ZVY A;  3FAO A;  4F3I A;  5AIU A;  4NR6 A;  4GB0 A;  1LDK C;  4BW3 A;  4MR6 A;  5F1H A;  4V3K C;  2JMD A;  5FE5 A;  1FP0 A;  5L98 A;  4O76 A;  2NAA A;  2QIC A;  4QSR A;  2H0D A;  5FB0 A;  4C66 A;  4LK9 A;  5D3J A;  4H9D A;  1Z60 A;  4YAT A;  3H7H A;  2RNX A;  4YAB A;  4J3I A;  5ENG A;  3AAD A;  2KWK A;  2D8S A;  2VNF A;  3O35 A;  2I50 A;  3UVW A;  2P57 A;  5I89 A;  3HME A;  4J1P A;  5ENI A;  5FE6 A;  4WZ3 B;  5D1M B;  3P1D A;  2D82 A;  2CKL B;  1G25 A;  1F62 A;  4QUT A;  2L85 A;  1JM7 B;  4MEN A;  4A49 A;  4A4C A;  2DVV A;  2XP0 A;  4MR5 A;  5CUD A;  3MQM A;  4O7E A;  2CON A;  2F42 A;  4A4B A;  4A0C D;  4Z6I A;  4ZW1 A;  2CT2 A;  5A5P A;  4J0S A;  3O70 A;  4LZS A;  3L1X A;  4R2Y A;  5H9M A;  4LLB A;  3LRQ A;  2OWA A;  2YUC A;  3M7K A;  3ZYU A;  4IC2 A;  4Q6F A;  2R10 A;  4OGI A;  4TT2 A;  5FFY A;  5COI A;  5HRW A;  4MR4 A;  4P5O B;  5EVA A;  2ECV A;  3KV5 A;  4L7X A;  5A5R A;  5TCM A;  5DFC A;  2F6J A;  2YW5 A;  4LR6 A;  4LZR A;  1DVP A;  2YSM A;  3JVJ A;  4HBX A;  3JUE A;  5LVR A;  3LQI A;  4BBQ A;  4N4F A;  4YAD A;  1WUG A;  2YDW A;  5I29 A;  4QSQ A;  4TU4 A;  5FG4 A;  5ETD A;  3Q2E A;  3KQI A;  4GNE A;  4XI1 A;  4CFK A;  2K4D A;  5CQT A;  2KWO A;  4HXK A;  2JMJ A;  4QQ4 A;  4IOO A;  4CUU A;  3Q1D A;  4X2I A;  5H1T A;  5CUC A;  5D3S A;  5LJ0 A;  2JMI A;  4X3G A;  3U5P A;  4AVX A;  2M1R A;  4ZQL A;  4WZ2 A;  4QZS A;  3T9K A;  5BT4 A;  3U5L A;  3HMH A;  3O47 A;  4NN2 A;  4Z0O A;  2M3H A;  5D3R A;  2B0O E;  4NQM A;  5EM3 A;  2E6R A;  2LQ6 A;  2CSZ A;  5FE4 A;  4Z1Q A;  2L84 A;  5DBM A;  4Y03 A;  2VPG A;  2LXH C;  5EWV A;  5CTL A;  5ENF A;  4CUP A;  2Y1N A;  2YHN A;  4PKL A;  4PY6 A;  4BHW A;  2MNZ A;  3IU5 A;  5E9M A;  5SVY A;  3Q2F A;  4YK0 A;  4W4U A;  1X4J A;  5JG6 A;  5FG5 A;  5J0D A;  4KCX A;  5H1V A;  2L0B A;  5TAB A;  3D7C A;  2K17 A;  5B78 A;  1VFY A;  2VPD A;  4IOQ A;  4OGE A;  5CGP A;  2MUM A;  3G0L A;  2OXQ C;  2ECN A;  2PNX A;  4QF2 A;  5AD2 A;  5FE8 A;  3T7L A;  4QST A;  4UP5 A;  2KWJ A;  2KR4 A;  4OUF A;  3ZPV E;  4UIT A;  4I7B A;  4CA1 A;  2R0V A;  3O33 A;  4QB3 A;  4YH4 A;  1Z6U A;  2L75 A;  5SVI B;  2QJ0 A;  3V43 A;  5B8D A;  3EB6 A;  4A9L A;  5EQ1 A;  2YYN A;  3P1E A;  5EWD A;  5A5O A;  5CS8 A;  2JM3 A;  1X4U A;  4NUD A;  5EIS A;  3ZVZ B;  1N87 A;  4IR3 A;  4UYD A;  4UP0 A;  3GV4 A;  5E3G A;  2DWW A;  2R0Y A;  4NRB A;  4WHU A;  5D26 A;  4FK5 A;  3SHB A;  4MEP A;  4O75 A;  5A83 A;  3K2J A;  3ASL A;  4A9H A;  2HYE D;  5E73 A;  2YHO A;  5KU3 A;  3N9Q A;  5H1U A;  2H0D B; 
#chains in the Genus database with same CATH homology
 2DVQ A;  2IDA A;  4NYV A;  2VJF B;  4O77 A;  3HMF A;  2RNW A;  4A9K A;  2YSJ A;  5KH9 A;  5D7X A;  4O72 A;  4L58 A;  2VPE A;  5AMF A;  4CUS A;  2LSP B;  5HFR A;  4NQN A;  1WGM A;  5F2P A;  4PS5 A;  5KHM A;  5IGL A;  3AQA A;  4ZUX U;  5G05 B;  3O34 A;  4LKA A;  4QF3 A;  4A9E A;  4A9F A;  4KV1 A;  5C7N A;  5A82 A;  4GND A;  4O74 A;  3SOX A;  4C9Z A;  5DIN A;  4N4G A;  5F62 A;  2DVS A;  1N72 A;  4O70 A;  5II2 A;  3N9O A;  3U5O A;  5HLS A;  4AKN A;  5C85 A;  5D3H A;  1ZBD B;  5LJ2 A;  1WEE A;  3RCW A;  3UVY A;  5ENB A;  2AN6 A;  4MSX A;  4ALH A;  3U5K A;  3T6R A;  5L8U A;  5IBN A;  4O78 A;  4NUE A;  5CY9 A;  2L5U A;  5I3L A;  5TRB A;  4N3W A;  2KIZ A;  4HXO A;  5G4S A;  1CHC A;  5B79 A;  2RI7 A;  4BW1 A;  4NS5 A;  5DKA A;  5F61 A;  3LXJ A;  4KV4 A;  4QR3 A;  5FB1 A;  3MHS A;  4XYA A;  4O7B A;  2KGG A;  4QEV A;  4CUR A;  5DYC A;  2E7N A;  2YQD A;  4LYS A;  4PCI A;  5DYX A;  4QSP A;  4FO9 A;  2RS9 B;  1EQF A;  5CUA A;  3SVH A;  5AIT A;  3DQV R;  4AUQ B;  5DYU A;  4IOR A;  4YYI A;  4HXS A;  4NUC A;  4TT4 A;  5EWC A;  3I2D A;  4GPJ A;  3RPG B;  5A85 A;  2H60 A;  4YYH A;  1WEO A;  3ZYQ A;  5CQ5 A;  2ECI A;  2ECW A;  2OO1 A;  4XUA A;  1Z2Q A;  3GG3 A;  2KU3 A;  3RTR B;  4Z1S A;  4NRA A;  4CCG X;  5FE0 A;  4NR9 A;  2L80 A;  2YW8 A;  4QEW A;  4YC9 A;  5EPR A;  4QBM A;  5FE1 A;  4NR5 A;  5DLX A;  4ZC9 A;  4O7A A;  4YBS A;  5DY7 A;  5CQ6 A;  4TZ8 A;  2G6Q A;  4DON A;  2HDP A;  5TB6 A;  1E6I A;  4YY6 A;  2QIZ A;  4UYF A;  4CLB A;  2KYU A;  5C11 A;  2KTB B;  5FEY A;  2L43 A;  5DFB A;  2WP2 A;  4YYJ A;  5EGU A;  2WP1 A;  4O71 A;  4QY4 A;  5JWM A;  5F3A A;  3L1Z B;  1MM3 A;  3PUR A;  5CFW A;  4QSU A;  4C67 A;  5FH8 A;  4QR4 A;  4LYW A;  3UV4 A;  5I88 A;  5HQ5 A;  3NXB A;  5K29 A;  1WEQ A;  4CL9 A;  5I86 A;  5BT5 A;  1WEU A;  5EI4 A;  4WA6 A;  4A9M A;  4PTB A;  5E7D A;  1ZS5 A;  2KWN A;  2LGV A;  5KTW A;  5E0R A;  4A9O A;  4TKP B;  4NR7 A;  5FH6 A;  2LRI C;  5CQ7 A;  5L97 A;  4TU6 A;  3QZS A;  3QZV A;  3QZT A;  5KTU A;  4QNS A;  2BAY A;  4CUQ A;  4E96 A;  4LZ2 A;  1WUM A;  3MB3 A;  4AYC B;  3SOU A;  5EPB A;  5LJ1 A;  1U6G B;  5ENJ A;  4HXL A;  4FJC A;  1JM7 A;  5DYA A;  5FBX A;  4A9J A;  4AYC A;  4LDF A;  5C8G A;  3U5N A;  2RSD A;  4HBW A;  3ZTG A;  1X0J A;  4YAX A;  3SVG A;  5EU1 A;  5B77 A;  2KGI A;  4CFL A;  5ENC A;  4GNF A;  5A5Q A;  5EWH A;  5E9K A;  4R7E A;  4A9I A;  5E9V A;  2LV9 A;  4TZ2 A;  4I7C A;  4FLP A;  5I80 A;  5D3L A;  3P1C A;  4LRG A;  5CQ4 A;  5IGM A;  4B86 C;  2E7O A;  4UIW A;  4YH3 A;  5J3X A;  4I7D A;  5IGK A;  2YEL A;  4CUT A;  1WES A;  3IHP A;  5F1L A;  5LKU A;  5F25 A;  5F63 A;  4XY8 A;  5L96 A;  4XY9 A;  2R0S A;  4MEQ A;  5CUE A;  5FE7 A;  2G45 A;  2MD7 B;  5LKX A;  5LKT A;  2FUI A;  3I3J A;  2MD8 C;  5CUB A;  5D3N A;  4QYL A;  5IGN A;  1WE9 A;  3C6W A;  5HEM A;  4LAD B;  1V87 A;  1WEW A;  4QYD A;  3FL2 A;  1BOR A;  5DKC A;  3ZNI A;  4QEU A;  1FBV A;  2M6M A;  5F5Z A;  3KNV A;  2C2V S;  4TQN A;  5FE3 A;  4TS8 A;  5EIC A;  4WHW A;  4UIX A;  4QSS A;  4WIV A;  4NXJ A;  2YQM A;  2MA6 A;  5G04 B;  5KTX A;  3SVF A;  4BW4 A;  4PPE A;  2I8N A;  3LJW A;  4QSV A;  4QSX A;  2LGK A;  2YUR A;  3KV6 A;  4MEO A;  5DKH A;  5FFV A;  5HCL A;  4OGJ A;  1WEP A;  4QC1 A;  3P1F A;  3LQH A;  3UV5 A;  3IU6 A;  5EWW A;  2PUY A;  4A9N A;  4WZ0 A;  2F6N A;  5JI8 A;  2K16 A;  4Z93 A;  4YBM A;  5D3P A;  5L8T A;  4QC3 A;  3M63 A;  4ALG A;  5D3T A;  2Y43 A;  4S3O B;  5FER A;  4UIY A;  5ENH A;  2I7K A;  4BJX A;  3MB4 A;  4QR5 A;  3TLP A;  2LXP C;  5EV9 A;  3RPG C;  4LYI A;  5HFQ A;  3N9N A;  5CQ3 A;  3HCU A;  3ZPV 1;  5F36 A;  2G4A A;  5CQA A;  1VD4 A;  2M85 A;  2EOD A;  4MR3 A;  4NYX A;  2G43 A;  3UW9 A;  5LCW B;  2D9E A;  1WEV A;  2MT5 A;  5I83 A;  4TTE A;  5ACY A;  5CRM A;  5CZG A;  4MVT A;  5ENE A;  4F52 B;  5E9Y A;  5HQ7 A;  5C89 A;  5KO4 A;  3JVM A;  5EPS A;  2KRE A;  2YT5 A;  4NR8 A;  2DKW A;  2YEM A;  2RNY A;  5HM0 A;  2YYR A;  3HTK C;  3MHH A;  5D1K B;  3S91 A;  3HCT A;  4XUB A;  4NR4 A;  2UZG A;  5KH7 A;  5A5N A;  2KE1 A;  5CRZ A;  2RO1 A;  3ONI A;  4UYH A;  3G0J A;  3JVK A;  4O7C A;  5I7X A;  2KFT A;  1IYM A;  5A81 A;  4LJN A;  2VJE A;  2YU4 A;  3C5K A;  5E74 A;  5L99 A;  2VJF A;  5EYA F;  4B7Y C;  2DX8 A;  3S92 A;  1K2F A;  2EGP A;  5HRV A;  2MIQ A;  3O7A A;  2YQL A;  3N9P A;  5DW1 A;  5HJC A;  1RMD A;  4YYG A;  4UIZ A;  5E3D A;  5II1 A;  1WIL A;  4O7F A;  5B75 A;  4YY4 A;  5C4Q A;  1WEM A;  5TDW A;  2LDR A;  4J0R A;  4Q0N A;  2YEK A;  5EA1 A;  4R8P K;  3JVL A;  5FH7 A;  4IR6 A;  2Y1M A;  5E9L A;  2LGL A;  3M99 A;  5C87 A;  3MUK A;  5FE2 A;  4TYL A;  4IR4 A;  5DKD A;  4HBV A;  4HBY A;  4NRC A;  1XWH A;  4HXP A;  4PCE A;  5CU8 A;  3PHD A;  2YRE A;  5F60 A;  5IID A;  5G4R A;  4YYN A;  3U5J A;  3FKM X;  3NG2 A;  3DWY A;  5E9I A;  5I7Y A;  4UIU A;  1JSP B;  4IR5 A;  5H85 A;  5IG6 A;  3P5O A;  1MM2 A;  4Z6H A;  4TT6 A;  5CP5 A;  5B76 A;  2MNY A;  2E3K A;  2MJV B;  4AP4 A;  4HXN A;  5DW2 A;  4O64 A;  2RFJ A;  5EP7 A;  2ECG A;  2JRJ A;  5ETB A;  5BT3 A;  1JOC A;  1HYJ A;  5HEL A;  2C2L A;  5CUG A;  2DVR A;  1T1H A;  3U5M A;  3UVX A;  5CPE A;  5CQ8 A;  3HCS A;  2VP7 A;  4HXM A;  2ECT A;  3O36 A;  1E4U A;  4NYW A;  4YBT A;  3MXF A;  2NXB A;  5HRX A;  2CSY A;  4IC3 A;  5AD3 A;  1VYX A;  3DPL R;  3N9M A;  5HEN A;  4UYF B;  5I1Q A;  5TDR A;  3VK6 A;  4UIV A;  4UYE A;  2N9G A;  5LKZ A;  4YYM A;  2E6S A;  5FE9 A;  3EB5 A;  4FIP A;  2OSS A;  4V3L C;  5DX4 A;  2OUO A;  3UV2 A;  4GNG A;  3PUQ A;  2FSA A;  5DLZ A;  5D25 A;  4YYD A;  4QSW A;  2ZET C;  2ECJ A;  5HQ6 A;  5KH3 A;  2LGG A;  5DFD A;  2LN0 A;  2XB1 A;  1LDJ B;  2VJE B;  3LQJ A;  2GRC A;  4UYG A;  4YYK A;  2XEU A;  3N9L A;  5FG6 A;  5G0F A;  1HYI A;  4QUU A;  2DAT A;  3MUL A;  2VPB A;  3SOW A;  1WFK A;  4LC2 A;  1WIM A;  1WEN A;  5D0C A;  5LUU A;  1F68 A;  5D1L B;  2MA5 A;  5I40 A;  2K1J A;  3L11 A;  4HXR A;  4N4H A;  1JM4 B;  4Q0O A;  3DAI A;  5FFW A;  3O37 A;  5AME A;  4N4I A;  5FDZ A;  2FUU A;  3GL6 A;  4UI9 B;  1X4I A;  5C13 A;  5A7C A;  5TBN A;  3UVD A;  5LVQ A;  4RVR A;  5D24 A;  4BW2 A;  4ZDT A;  5EK9 A;  4S3O C;  2CKL A;  2L5E A;  2EA6 A;  3ZVY A;  5A5S A;  3M62 A;  4F3I A;  5AIU A;  4NR6 A;  4GB0 A;  1LDK C;  4BW3 A;  4MR6 A;  5F1H A;  4V3K C;  2JMD A;  5FE5 A;  1FP0 A;  5L98 A;  4O76 A;  2NAA A;  2QIC A;  4QSR A;  2H0D A;  5FB0 A;  4C66 A;  4LK9 A;  5D3J A;  1Z60 A;  4YAT A;  2RNX A;  4YAB A;  4J3I A;  5ENG A;  3AAD A;  2KWK A;  2D8S A;  2VNF A;  3O35 A;  2I50 A;  3UVW A;  5I89 A;  3HME A;  4J1P A;  5ENI A;  5FE6 A;  4WZ3 B;  5D1M B;  3P1D A;  2D82 A;  2CKL B;  1G25 A;  1F62 A;  4QUT A;  2L85 A;  1JM7 B;  4MEN A;  4A49 A;  4A4C A;  2DVV A;  4MR5 A;  5CUD A;  3MQM A;  4O7E A;  2F42 A;  4A4B A;  4A0C D;  4Z6I A;  4ZW1 A;  2CT2 A;  5A5P A;  4J0S A;  3O70 A;  4LZS A;  3L1X A;  4R2Y A;  5H9M A;  4LLB A;  3LRQ A;  2YUC A;  3ZYU A;  4IC2 A;  4Q6F A;  2R10 A;  4OGI A;  4TT2 A;  5FFY A;  5COI A;  5HRW A;  4MR4 A;  4P5O B;  5EVA A;  2ECV A;  3KV5 A;  4L7X A;  5A5R A;  5TCM A;  5DFC A;  2F6J A;  2YW5 A;  4LR6 A;  4LZR A;  1DVP A;  2YSM A;  3JVJ A;  4HBX A;  5LVR A;  3LQI A;  4BBQ A;  4N4F A;  4YAD A;  1WUG A;  2YDW A;  5I29 A;  4QSQ A;  4TU4 A;  5FG4 A;  5ETD A;  3Q2E A;  3KQI A;  4GNE A;  4XI1 A;  4CFK A;  2K4D A;  5CQT A;  2KWO A;  4HXK A;  2JMJ A;  4IOO A;  4CUU A;  4X2I A;  5H1T A;  5CUC A;  5D3S A;  5LJ0 A;  2JMI A;  4X3G A;  3U5P A;  4AVX A;  2M1R A;  4ZQL A;  4WZ2 A;  4QZS A;  5BT4 A;  3U5L A;  3HMH A;  4NN2 A;  2M3H A;  5D3R A;  4NQM A;  5EM3 A;  2E6R A;  2LQ6 A;  2CSZ A;  5FE4 A;  4Z1Q A;  2L84 A;  5DBM A;  4Y03 A;  2VPG A;  2LXH C;  5EWV A;  5CTL A;  5ENF A;  4CUP A;  2Y1N A;  2YHN A;  4PKL A;  4PY6 A;  4BHW A;  2MNZ A;  3IU5 A;  5E9M A;  3Q2F A;  4YK0 A;  4W4U A;  1X4J A;  5JG6 A;  5FG5 A;  5J0D A;  4KCX A;  5H1V A;  2L0B A;  5TAB A;  3D7C A;  2K17 A;  5B78 A;  1VFY A;  2VPD A;  4IOQ A;  5CGP A;  2MUM A;  3G0L A;  2OXQ C;  2ECN A;  2PNX A;  4QF2 A;  5AD2 A;  5FE8 A;  3T7L A;  4QST A;  4UP5 A;  2KWJ A;  2KR4 A;  4OUF A;  3ZPV E;  4UIT A;  4I7B A;  4CA1 A;  2R0V A;  3O33 A;  4QB3 A;  4YH4 A;  1Z6U A;  2L75 A;  3V43 A;  2QJ0 A;  5B8D A;  3EB6 A;  4A9L A;  5EQ1 A;  2YYN A;  3P1E A;  5EWD A;  5A5O A;  5CS8 A;  1X4U A;  4NUD A;  5EIS A;  3ZVZ B;  1N87 A;  4IR3 A;  4UYD A;  4UP0 A;  3GV4 A;  5E3G A;  2DWW A;  2R0Y A;  4NRB A;  4WHU A;  5D26 A;  4FK5 A;  3SHB A;  4MEP A;  4O75 A;  5A83 A;  3K2J A;  3ASL A;  4A9H A;  2HYE D;  5E73 A;  2YHO A;  5KU3 A;  3N9Q A;  5H1U A;  2H0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...