3O37A

Crystal structure of trim24 phd-bromo complexed with h3(1-10)k4 peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
182
structure length
175
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
molecule keywords Transcription intermediary factor 1-alpha
total genus 51
structure length 175
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o37A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o37A01
3N9NA 5HENA 5HRWA 5C87A 2NAAA 5KH7A 5EU1A 4YBSA 4WHWA 5A5OA 3K2JA 3QZVA 4Z6HA 2PNXA 4MR5A 3MQMA 2I8NA 5IBNA 1JSPB 5FEYA 1WUGA 4HBVA 4J0RA 1WE9A 4MVTA 2EA6A 4QC3A 5B79A 4AP4A 3PHDA 4Q0NA 5EWDA 4LR6A 5HJCA 4TYLA 3UVWA 5E0RA 4NN2A 4FLPA 5HRXA 4HBWA 5L8TA 3T6RA 2HDPA 5CQ8A 1U6GB 4QB3A 4PTBA 3S91A 4CUPA 4Z1SA 3O7AA 5F2PA 5L99A 2QJ0A 2HYED 2MA6A 5E73A 5HELA 5H1VA 2GRCA 5FE1A 5IGMA 5G04B 2N9GA 4B86C 3AADA 3MHSA 5FB1A 4O71A 3EB6A 5EM3A 2MD7B 2VJEA 2YDWA 3MULA 4QY4A 5DBMA 5CP5A 4QSXA 3SVFA 4PS5A 4A9OA 2H0DA 4W4UA 4HBXA 4UYFB 4NRCA 1LDJB 3O33A 2LV9A 4LYIA 5L96A 5E9KA 4QSWA 5DKAA 4I7CA 5DY7A 2KWJA 4CLBA 5A5PA 4OUFA 2RNWA 4ZW1A 3GV4A 4C67A 3L11A 3LRQA 3U5KA 3JVMA 2MNZA 3KV5A 5HLSA 4S3OC 3N9OA 3JVKA 3M99A 4XY9A 2DVSA 5IGKA 2DWWA 5AIUA 3ZYQA 4O7CA 4BW3A 5KH9A 4L7XA 5D26A 5IGNA 3P5OA 4LRGA 2YW8A 4N4FA 5H9MA 4CFKA 3U5NA 4MEPA 4BJXA 2MUMA 5A5SA 4YBTA 5BT5A 2QIZA 5JI8A 5CS8A 5B8DA 3HCUA 2FSAA 2G6QA 4E96A 1X4UA 2L43A 4CUQA 1Z2QA 5J0DA 5EISA 3RTRB 5FG6A 5A5RA 1ZS5A 4BW1A 5C4QA 2ZETC 4J3IA 5HCLA 5I83A 4A0CD 5I1QA 5TABA 4TS8A 3UV4A 4A4CA 4LYSA 5E74A 1JM7A 4ALGA 5CQTA 4IR3A 4TU4A 2YSJA 4UIUA 3QZSA 4C9ZA 5G4SA 5LKXA 5LKZA 5I3LA 5CU8A 4O70A 3ZPVE 4UYHA 2QICA 3LQIA 4Q0OA 5FFWA 4UIWA 4O7BA 4QEVA 5LKTA 2MNYA 4HXPA 3KV6A 4O7FA 5DYUA 2YURA 2KWKA 4YATA 2YQMA 5E9YA 3Q2EA 5EV9A 2VP7A 2ECVA 3ZPV1 4TZ2A 5CUDA 5D3NA 5C89A 4BW4A 4CFLA 2G45A 5D3LA 4AVXA 5ENEA 5EYAF 2VJFB 2KWNA 5IG6A 5ETBA 2JMIA 5E9MA 5ETDA 2K16A 4I7BA 3I3JA 5A82A 5LKUA 3TLPA 2CSYA 5E9LA 3I2DA 3JVJA 3AQAA 4YH3A 3Q2FA 2KE1A 4NUCA 4CUSA 1X4JA 5BT4A 4CURA 5KO4A 3GL6A 5H1UA 4R7EA 4UP5A 4CUUA 3QZTA 5LJ1A 2M6MA 4CCGX 5E9VA 3HMFA 3V43A 4ZQLA 2RO1A 3UV2A 5K29A 2RNYA 4HXLA 4PCIA 4FO9A 4LKAA 2R0SA 4ZC9A 4LZSA 4QR5A 3P1EA 4YYDA 4NR6A 4LADB 5B75A 5ENGA 4AYCB 5KH3A 4QC1A 4ALHA 4XY8A 4Y03A 1WEUA 3HCTA 2Y1NA 2L0BA 5FH7A 4N4GA 4OGIA 4NYVA 5IIDA 4BBQA 5F5ZA 2WP2A 3U5MA 4A9JA 4CUTA 4NS5A 2F42A 4BW2A 5CZGA 4FIPA 2YUCA 4NYWA 4YADA 3DPLR 5DW1A 2R10A 4XUAA 5H1TA 1FBVA 2ECWA 4A49A 5AD2A 3S92A 1WILA 1T1HA 4LK9A 4QSPA 2H0DB 1MM3A 4UP0A 4IR6A 5FDZA 4YYKA 5HFQA 4AKNA 4TT2A 2JMDA 4UYGA 5FE2A 2MIQA 5D1KB 2CKLB 5FE8A 1VYXA 4QUTA 2VJFA 4O7AA 5FBXA 4QR3A 4TT4A 1CHCA 3O70A 2IDAA 1HYJA 5D1LB 3C6WA 4IC2A 4NR5A 5I88A 5DLXA 1WGMA 4C66A 1DVPA 2YHOA 4FK5A 1F68A 3M62A 4GB0A 5C8GA 1F62A 5CQ3A 5CQ7A 5CUEA 1MM2A 1WEWA 5TDWA 3RPGC 5FE7A 5CUAA 2DVRA 4L58A 5JWMA 4YC9A 2JRJA 3HCSA 2CSZA 4MENA 5TCMA 4TU6A 3FL2A 3NXBA 1K2FA 5FE5A 2RI7A 5AMFA 5FE0A 2Y1MA 3DQVR 2L75A 2KWOA 5HQ7A 5DX4A 1N87A 5ENJA 4O72A 4MSXA 2YW5A 4HXNA 4QSQA 2LGGA 4YYMA 3IU5A 2LQ6A 4Z93A 5KHMA 5CQ4A 5D3RA 2Y43A 3LQJA 5ENCA 5DW2A 4J1PA 5D24A 2OO1A 4YYNA 3UVXA 4GNDA 3RPGB 4UYEA 4LLBA 5D3PA 4GNGA 4TQNA 5FB0A 4A9KA 5AD3A 5FH8A 2KR4A 4NUEA 3U5PA 1VD4A 4XYAA 1ZBDB 3ZVYA 4KV4A 2M85A 4Z6IA 1WFKA 2M3HA 4RVRA 5LJ2A 2K4DA 5F25A 5HM0A 5I86A 5D25A 3UVYA 5ACYA 2YELA 2YSMA 3O34A 5L98A 4HXSA 3UVDA 2YEMA 5EP7A 1V87A 5I29A 3D7CA 4QSRA 4UIXA 5F3AA 5ENBA 2FUIA 2YYRA 5G05B 4O78A 4O76A 4QF3A 5EPBA 3SOWA 2I7KA 5LCWB 4QSSA 2F6JA 2K17A 5EICA 2XB1A 2OSSA 5FFYA 5F60A 2ECGA 2KGGA 2YQDA 2MA5A 3N9MA 3L1XA 5D3SA 4MEOA 3O36A 4UITA 2E7NA 5CPEA 4NQNA 2YT5A 1JM4B 4QBMA 4YH4A 4QF2A 4J0SA 4NRBA 2ECJA 5EPSA 3L1ZB 1WEOA 2PUYA 2XEUA 3SVHA 2DVQA 4WZ2A 4DONA 5HQ5A 2LGVA 5D1MB 5DYXA 3ZNIA 4LJNA 3EB5A 2DATA 2G43A 5F61A 3G0JA 5EI4A 3HMEA 4NYXA 5L8UA 2WP1A 5FE6A 2L5UA 2YYNA 5EK9A 4XI1A 2YHNA 4AYCA 2L84A 5CQ6A 2BAYA 2MT5A 5TDRA 5JG6A 4MR4A 2DKWA 4TZ8A 4R2YA 4NXJA 4LDFA 5C11A 5F62A 5ENIA 5EQ1A 1HYIA 5EWCA 2D9EA 2AN6A 5J3XA 4NR8A 3ONIA 5EVAA 4YY4A 5F36A 5KU3A 3P1DA 4MR6A 3G0LA 4QZSA 4HXMA 4MR3A 4UIZA 5CGPA 5CTLA 2E6SA 5FG4A 3PUQA 3MB3A 5DKHA 5F63A 4BHWA 2M1RA 2R0YA 2F6NA 5H85A 5F1LA 4HBYA 2MJVB 5C13A 5CUCA 4QNSA 3ZTGA 5DYAA 3N9LA 4GNEA 4NR4A 3MB4A 3P1CA 4X2IA 4YAXA 1G25A 3KQIA 4QSTA 5TBNA 5FE4A 2RNXA 4FJCA 4A9HA 3U5LA 4IR5A 4S3OB 3IU6A 2DVVA 2E3KA 2DX8A 2YU4A 1JOCA 5FH6A 1WIMA 5CRZA 3IHPA 4UI9B 5FE3A 5I80A 5LVRA 3M63A 4IORA 4YY6A 3SHBA 4HXOA 4V3LC 5ENHA 2CKLA 5A5NA 2YREA 5DKCA 5DLZA 4I7DA 1EQFA 4QYLA 5KTWA 4IOQA 4PPEA 5COIA 5DFCA 5EGUA 4AUQB 4CA1A 3C5KA 5F1HA 5B77A 5LVQA 5LUUA 5DKDA 4YYIA 1FP0A 3O35A 2L5EA 5C85A 1Z6UA 4A9MA 5D7XA 5EA1A 4QEUA 4P5OB 1X0JA 5CUGA 5E3GA 5E3DA 4QUUA 4A9IA 3SOUA 2KIZA 2ECIA 5A81A 5II2A 3NG2A 3T7LA 4YK0A 3LXJA 4PCEA 2ECTA 2KTBB 4A9LA 2KREA 2H60A 3P1FA 5D3TA 5EPRA 4IOOA 4Z1QA 4KV1A 4WA6A 5I89A 5A85A 4N4HA 5EWWA 5L97A 5KTXA 5HQ6A 2KYUA 2VPGA 5B76A 5DFDA 4O64A 5G0FA 2C2LA 2NXBA 4IR4A 4TTEA 4IC3A 4V3KC 1JM7B 4QR4A 5II1A 4A9NA 2RSDA 5CQAA 4N4IA 4HXKA 5A5QA 1WEVA 1WEPA 3JVLA 4YYGA 5TB6A 4NQMA 5IGLA 2E6RA 5DINA 4WHUA 5A7CA 3O37A 1WENA 3SOXA 4PKLA 3U5OA 1VFYA 3HMHA 1Z60A 5HRVA 4QSUA 4YYJA 4WZ0A 5FFVA 5ENFA 2YQLA 4UIYA 2RS9B 4OGJA 2VJEB 2LGLA 5HFRA 3UV5A 4GPJA 4YABA 1N72A 2LRIC 4NR7A 4A9EA 2MD8C 4QYDA 5KTUA 3VK6A 5FERA 1E4UA 4NR9A 3GG3A 2KFTA 5DFBA 4A9FA 2FUUA 4KCXA 3KNVA 4LC2A 5CFWA 4YYHA 4CL9A 2JMJA 2LDRA 4O7EA 4YBMA 4PY6A 5A83A 5AITA 1RMDA 5I7YA 1BORA 4R8PK 3HTKC 2LSPB 2I50A 2C2VS 2LXHC 2RFJA 5CRMA 5I7XA 4TKPB 5CY9A 2KU3A 3U5JA 4X3GA 4ZDTA 2D8SA 2UZGA 5CQ5A 2VPDA 3DWYA 5FE9A 2LGKA 3FKMX 2E7OA 1XWHA 1WUMA 4NRAA 2L80A 4Q6FA 3N9PA 4O75A 4UIVA 3ZYUA 4HXRA 3PURA 1WEQA 5E9IA 2OXQC 2LXPC 2CT2A 4LZ2A 5EWHA 4TT6A 3MUKA 2L85A 2K1JA 4O74A 3ASLA 4XUBA 4GNFA 3LQHA 4UYDA 5LJ0A 4LZRA 4WIVA 5AMEA 4WZ3B 2LN0A 2YEKA 2KGIA 4LYWA 4QEWA 2EODA 3DAIA 5CUBA 3N9QA 4QSVA 2VPEA 3UW9A 1E6IA 5HEMA 2VNFA 5E7DA 2G4AA 4ZUXU 2OUOA 5B78A 1IYMA 2D82A 4UYFA 5G4RA 3RCWA 1WEEA 2R0VA 1LDKC 1WEMA 1X4IA 5D3HA 4F3IA 5TRBA 3MXFA 5EWVA 1WESA 4N3WA 2ECNA 3SVGA 3MHHA 5FG5A 4B7YC 4A4BA 3LJWA 5BT3A 3ZVZB 4MEQA 5D0CA 5D3JA 4O77A 5I40A 5DYCA 2EGPA 2VPBA 4NUDA 5C7NA 4F52B
chains in the Genus database with same CATH superfamily
3N9NA 5HENA 5HRWA 5C87A 2OWAA 2NAAA 5KH7A 5EU1A 4YBSA 4WHWA 5A5OA 3K2JA 3QZVA 4Z6HA 2PNXA 4MR5A 3MQMA 2I8NA 5IBNA 1JSPB 5FEYA 1WUGA 4HBVA 4J0RA 1WE9A 4MVTA 2EA6A 4QC3A 5B79A 4AP4A 3PHDA 4Q0NA 5EWDA 4LR6A 3JUEA 5HJCA 4TYLA 3UVWA 5E0RA 4NN2A 4FLPA 5HRXA 4HBWA 5L8TA 3T6RA 2HDPA 5CQ8A 1U6GB 4QB3A 4PTBA 3S91A 4CUPA 4Z1SA 3O7AA 5F2PA 5L99A 2QJ0A 2HYED 2MA6A 5E73A 5HELA 5H1VA 2GRCA 5FE1A 5IGMA 5G04B 2N9GA 4B86C 3AADA 3MHSA 5FB1A 4O71A 3EB6A 5EM3A 2MD7B 2VJEA 2YDWA 3MULA 2EGMA 2CSVA 4QY4A 5DBMA 5CP5A 4QSXA 3SVFA 4PS5A 4A9OA 2H0DA 4W4UA 4HBXA 4UYFB 4NRCA 1LDJB 3O33A 2LV9A 4LYIA 1DCQA 5L96A 5E9KA 4QSWA 5DKAA 4I7CA 5DY7A 2KWJA 4CLBA 5A5PA 4OUFA 2RNWA 4ZW1A 3GV4A 4C67A 2XP0A 3L11A 3LRQA 2DSMA 3D1BA 1PUOA 3U5KA 3JVMA 2MNZA 3KV5A 5HLSA 5SVYA 3FJUB 4S3OC 3N9OA 3JVKA 3M99A 4XY9A 2DVSA 5IGKA 2DWWA 5AIUA 3ZYQA 4O7CA 4BW3A 5KH9A 4L7XA 4Z0OA 5D26A 5IGNA 3P5OA 4LRGA 2YW8A 4N4FA 5H9MA 4CFKA 3U5NA 4MEPA 4BJXA 2MUMA 5A5SA 4YBTA 5BT5A 2QIZA 5JI8A 2EXUA 5CS8A 5B8DA 3HCUA 2FSAA 2G6QA 4E96A 1X4UA 2L43A 4CUQA 1Z2QA 5J0DA 2FD4A 5EISA 3RTRB 5FG6A 5A5RA 1ZS5A 4BW1A 5C4QA 2ZETC 4J3IA 5HCLA 5I83A 4A0CD 3D1DA 5I1QA 5TABA 4TS8A 3UV4A 4A4CA 4LYSA 5E74A 2KKXA 1JM7A 4ALGA 2XOZA 5CQTA 4IR3A 4TU4A 2YSJA 4UIUA 3QZSA 4C9ZA 5G4SA 5LKXA 2E61A 5LKZA 5I3LA 5CU8A 4O70A 2JUNA 3ZPVE 4UYHA 2QICA 3LQIA 4Q0OA 5FFWA 4UIWA 2YVRA 4O7BA 1ZKRA 4QEVA 5LKTA 4HXPA 2MNYA 4O7FA 5DYUA 2YURA 2KWKA 4YATA 3KV6A 2YQMA 5E9YA 3Q2EA 5EV9A 2VP7A 2ECVA 3ZPV1 4TZ2A 5CUDA 5D3NA 5C89A 4BW4A 4CFLA 2G45A 5D3LA 2XOCA 5ENEA 4AVXA 5EYAF 2VJFB 2KWNA 2CONA 3LDYA 5IG6A 5ETBA 2JMIA 5E9MA 5ETDA 2K16A 4I7BA 3I3JA 5A82A 4H9DA 5LKUA 3TLPA 2CSYA 5E9LA 3I2DA 3JVJA 3AQAA 4YH3A 3Q2FA 2JM3A 2KE1A 4NUCA 4CUSA 1X4JA 5BT4A 4CURA 5KO4A 3GL6A 5H1UA 4R7EA 4UP5A 4CUUA 3QZTA 5LJ1A 2M6MA 4CCGX 5E9VA 3HMFA 3V43A 4ZQLA 2RO1A 3UV2A 5SVIB 5K29A 2RNYA 4HXLA 4PCIA 4FO9A 4LKAA 2R0SA 4ZC9A 4LZSA 4QR5A 2LAUA 4OGEA 3P1EA 4YYDA 4NR6A 4LADB 5B75A 5ENGA 4AYCB 5KH3A 4QC1A 4ALHA 4XY8A 4Y03A 1WEUA 3HCTA 2Y1NA 2L0BA 5FH7A 3H7HA 4N4GA 4OGIA 4NYVA 5IIDA 4BBQA 5F5ZA 2WP2A 3U5MA 4A9JA 4CUTA 4NS5A 2F42A 4BW2A 5CZGA 4FIPA 2YUCA 4NYWA 4YADA 3DPLR 5DW1A 2R10A 4XUAA 5H1TA 1FBVA 2ECWA 4A49A 5AD2A 3S92A 1WILA 1T1HA 4LK9A 4QSPA 2H0DB 3FM8C 1MM3A 4UP0A 4IR6A 5FDZA 4YYKA 5HFQA 4AKNA 4TT2A 2JMDA 4UYGA 5FE2A 2MIQA 5D1KB 2CKLB 5FE8A 1VYXA 3KDEC 4QUTA 2VJFA 4O7AA 5FBXA 4QR3A 4TT4A 1CHCA 4F1PA 3O70A 2IDAA 1HYJA 3LJUX 4OGCA 5D1LB 3C6WA 4IC2A 4NR5A 5I88A 5DLXA 1WGMA 4C66A 1DVPA 2YHOA 4FK5A 1F68A 3M62A 4GB0A 5C8GA 1F62A 5CQ3A 5CQ7A 5CUEA 1MM2A 1WEWA 5TDWA 3RPGC 5DINA 5FE7A 4O62A 5CUAA 2DVRA 4L58A 5JWMA 4YC9A 2JRJA 3HCSA 2CSZA 2B0OE 4MENA 5TCMA 4TU6A 3FL2A 3NXBA 1K2FA 5FE5A 2RI7A 5AMFA 5FE0A 2Y1MA 3DQVR 2L75A 5SVXA 2KWOA 5HQ7A 5DX4A 1N87A 5ENJA 4O72A 3ERRA 4MSXA 2YW5A 4HXNA 4QSQA 2LGGA 4YYMA 3IU5A 2LQ6A 4Z93A 5KHMA 5CQ4A 5D3RA 5SVIA 2Y43A 3LQJA 5ENCA 5DW2A 4J1PA 5D24A 2OO1A 4YYNA 3UVXA 3VKGA 4GNDA 3RPGB 4UYEA 4LLBA 5D3PA 4GNGA 3LVRE 4TQNA 5FB0A 4A9KA 5AD3A 5FH8A 2KR4A 4NUEA 3U5PA 1VD4A 4XYAA 1ZBDB 3ZVYA 3E2DA 4KV4A 2M85A 4Z6IA 1WFKA 2M3HA 4RVRA 5LJ2A 2K4DA 5F25A 5HM0A 5I86A 5D25A 3UVYA 5ACYA 2YELA 2YSMA 3O34A 5L98A 4HXSA 3UVDA 2YEMA 5EP7A 1V87A 5I29A 3FANA 3D7CA 4QSRA 4UIXA 5F3AA 5ENBA 2FUIA 2YYRA 5G05B 4O78A 4O76A 4QF3A 5EPBA 3SOWA 2I7KA 4QQ4A 5LCWB 4QSSA 2F6JA 2K17A 5EICA 2XB1A 2OSSA 5FFYA 5F60A 2ECGA 2KGGA 2YQDA 2MA5A 3N9MA 3L1XA 5D3SA 4MEOA 2DJAA 3O36A 4UITA 2E7NA 5CPEA 4NQNA 2YT5A 1JM4B 2L7PA 4QBMA 4YH4A 4QF2A 4J0SA 4NRBA 2ECJA 4AKGA 5EPSA 3L1ZB 1WEOA 2PUYA 2XEUA 3SVHA 2DVQA 4WZ2A 4DONA 5HQ5A 2LGVA 5D1MB 5DYXA 3ZNIA 4LJNA 3EB5A 2DATA 2G43A 5F61A 3G0JA 5EI4A 3HMEA 4NYXA 5L8UA 2WP1A 5FE6A 2L5UA 2YYNA 5EK9A 3FAOA 2YHNA 4XI1A 2XOYA 4AYCA 2L84A 5CQ6A 2BAYA 2MT5A 5TDRA 5JG6A 4MR4A 2DKWA 4TZ8A 4R2YA 4NXJA 4LDFA 5C11A 5F62A 5ENIA 5EQ1A 1HYIA 5EWCA 2D9EA 2AN6A 5J3XA 4NR8A 3DDTA 4Z0RA 3ONIA 5EVAA 4YY4A 5F36A 2CRRA 5KU3A 3P1DA 4MR6A 3G0LA 4QZSA 4HXMA 4MR3A 4UIZA 5CGPA 5CTLA 2E6SA 5FG4A 3PUQA 3MB3A 5DKHA 5F63A 4BHWA 4AI6A 2M1RA 2R0YA 3DWDA 4AKHA 2F6NA 5H85A 5F1LA 4HBYA 2MJVB 5C13A 2KKYA 5CUCA 4QNSA 3ZTGA 5DYAA 3N9LA 4GNEA 4NR4A 3MB4A 3P1CA 4X2IA 4YAXA 1G25A 3KQIA 4QSTA 5TBNA 5FE4A 2RNXA 4FJCA 4A9HA 3U5LA 4IR5A 4S3OB 3IU6A 2DVVA 2E3KA 2DX8A 2YU4A 1JOCA 5FH6A 1WIMA 5CRZA 3IHPA 4UI9B 5FE3A 5I80A 5LVRA 3M63A 4IORA 4YY6A 3SHBA 4HXOA 4V3LC 5ENHA 2CKLA 5A5NA 2YREA 5DKCA 5DLZA 4I7DA 1EQFA 4QYLA 5KTWA 4IOQA 4PPEA 5COIA 5DFCA 5EGUA 4AUQB 3LVQE 4CA1A 3C5KA 5F1HA 5B77A 5LVQA 5LUUA 5DKDA 4YYIA 3T9KA 1FP0A 3O35A 2L5EA 5C85A 1Z6UA 4A9MA 5D7XA 5EA1A 4QEUA 4P5OB 1X0JA 5CUGA 5E3GA 5E3DA 4QUUA 4A9IA 3SOUA 2KIZA 2ECIA 5A81A 5II2A 3NG2A 3T7LA 4YK0A 3LXJA 4PCEA 2ECTA 2KTBB 3VKHA 2M13A 4A9LA 2KREA 2H60A 3P1FA 5D3TA 5EPRA 4IOOA 4Z1QA 4KV1A 4WA6A 5I89A 5A85A 4N4HA 5EWWA 5L97A 5KTXA 5HQ6A 2KYUA 1MBMA 2VPGA 5B76A 5DFDA 4O64A 5G0FA 2C2LA 2NXBA 4IR4A 4TTEA 4IC3A 4V3KC 1JM7B 4QR4A 5II1A 4A9NA 4AKIA 2RSDA 5CQAA 4N4IA 4HXKA 5A5QA 1WEVA 1WEPA 3JVLA 4YYGA 5TB6A 4NQMA 5IGLA 2E6RA 2MKEA 3PLWA 4WHUA 5A7CA 3O37A 1WENA 3SOXA 4PKLA 3U5OA 1VFYA 3HMHA 1Z60A 5HRVA 4QSUA 4YYJA 4WZ0A 5FFVA 5ENFA 2YQLA 4UIYA 2RS9B 4OGJA 2VJEB 2LGLA 5HFRA 3UV5A 2FFWA 4GPJA 5K3QA 4YABA 1N72A 2LRIC 3MDBC 4NR7A 4A9EA 2MD8C 4QYDA 5KTUA 3VK6A 5FERA 1E4UA 4NR9A 2CRWA 2D8UA 3GG3A 2KFTA 5DFBA 4A9FA 2FUUA 4KCXA 3KNVA 4LC2A 5CFWA 4YYHA 4CL9A 2JMJA 2LDRA 4O7EA 4YBMA 4PY6A 5A83A 5AITA 1RMDA 5I7YA 1BORA 2IQJA 3O47A 4R8PK 3HTKC 2LSPB 2I50A 2C2VS 2LXHC 2RFJA 5CRMA 3FEHA 5I7XA 4TKPB 5CY9A 2KU3A 3U5JA 2RR4A 4X3GA 4ZDTA 2D8SA 2UZGA 5CQ5A 2VPDA 3DWYA 5FE9A 2LGKA 3FKMX 2E7OA 1XWHA 1WUMA 4NRAA 2L80A 4Q6FA 3N9PA 4O75A 4UIVA 3ZYUA 4HXRA 3PURA 1WEQA 5E9IA 2OXQC 2LXPC 3M7KA 2CT2A 4LZ2A 5EWHA 4TT6A 3MUKA 2L85A 2K1JA 4O74A 3ASLA 4XUBA 4GNFA 3LQHA 4UYDA 5LJ0A 4LZRA 4WIVA 5AMEA 4WZ3B 2LN0A 2YEKA 2KGIA 4LYWA 4QEWA 2EODA 3DAIA 5CUBA 3N9QA 4QSVA 2VPEA 3UW9A 1E6IA 5HEMA 2VNFA 5E7DA 2G4AA 3SUBA 2OUOA 5B78A 2P57A 4ZUXU 2D82A 1IYMA 4UYFA 2EJNA 5G4RA 3RCWA 1WEEA 2R0VA 1LDKC 1WEMA 1X4IA 5D3HA 4F3IA 5TRBA 3Q1DA 3MXFA 5EWVA 1WESA 4N3WA 2ECNA 3SVGA 3MHHA 5FG5A 4B7YC 4A4BA 3LJWA 5BT3A 3ZVZB 4MEQA 5D0CA 5D3JA 4O77A 5I40A 5DYCA 2EGPA 2VPBA 4NUDA 5C7NA 4F52B
chains in the Genus database with same CATH topology
3N9NA 5HENA 5HRWA 5C87A 2NAAA 5KH7A 5EU1A 4YBSA 4WHWA 5A5OA 3K2JA 3QZVA 4Z6HA 2PNXA 4MR5A 3MQMA 2I8NA 5IBNA 1JSPB 5FEYA 1WUGA 4HBVA 4J0RA 1WE9A 4MVTA 2EA6A 4QC3A 5B79A 4AP4A 3PHDA 4Q0NA 5EWDA 4LR6A 5HJCA 4TYLA 3UVWA 5E0RA 4NN2A 4FLPA 5HRXA 4HBWA 5L8TA 3T6RA 2HDPA 5CQ8A 1U6GB 4QB3A 4PTBA 3S91A 4CUPA 4Z1SA 3O7AA 5F2PA 5L99A 2QJ0A 2HYED 2MA6A 5E73A 5HELA 5H1VA 2GRCA 5FE1A 5IGMA 5G04B 2N9GA 4B86C 3AADA 3MHSA 5FB1A 4O71A 3EB6A 5EM3A 2MD7B 2VJEA 2YDWA 3MULA 4QY4A 5DBMA 5CP5A 4QSXA 3SVFA 4PS5A 4A9OA 2H0DA 4W4UA 4HBXA 4UYFB 4NRCA 1LDJB 3O33A 2LV9A 4LYIA 5L96A 5E9KA 4QSWA 5DKAA 4I7CA 5DY7A 2KWJA 4CLBA 5A5PA 4OUFA 2RNWA 4ZW1A 3GV4A 4C67A 3L11A 3LRQA 3U5KA 3JVMA 2MNZA 3KV5A 5HLSA 4S3OC 3N9OA 3JVKA 3M99A 4XY9A 2DVSA 5IGKA 2DWWA 5AIUA 3ZYQA 4O7CA 4BW3A 5KH9A 4L7XA 5D26A 5IGNA 3P5OA 4LRGA 2YW8A 4N4FA 5H9MA 4CFKA 3U5NA 4MEPA 4BJXA 2MUMA 5A5SA 4YBTA 5BT5A 2QIZA 5JI8A 5CS8A 5B8DA 3HCUA 2FSAA 2G6QA 4E96A 1X4UA 2L43A 4CUQA 1Z2QA 5J0DA 5EISA 3RTRB 5FG6A 5A5RA 1ZS5A 4BW1A 5C4QA 2ZETC 4J3IA 5HCLA 5I83A 4A0CD 5I1QA 5TABA 4TS8A 3UV4A 4A4CA 4LYSA 5E74A 1JM7A 4ALGA 5CQTA 4IR3A 4TU4A 2YSJA 4UIUA 3QZSA 4C9ZA 5G4SA 5LKXA 5LKZA 5I3LA 5CU8A 4O70A 3ZPVE 4UYHA 2QICA 3LQIA 4Q0OA 5FFWA 4UIWA 4O7BA 4QEVA 5LKTA 2MNYA 4HXPA 3KV6A 4O7FA 5DYUA 2YURA 2KWKA 4YATA 2YQMA 5E9YA 3Q2EA 5EV9A 2VP7A 2ECVA 3ZPV1 4TZ2A 5CUDA 5D3NA 5C89A 4BW4A 4CFLA 2G45A 5D3LA 4AVXA 5ENEA 5EYAF 2VJFB 2KWNA 5IG6A 5ETBA 2JMIA 5E9MA 5ETDA 2K16A 4I7BA 3I3JA 5A82A 5LKUA 3TLPA 2CSYA 5E9LA 3I2DA 3JVJA 3AQAA 4YH3A 3Q2FA 2KE1A 4NUCA 4CUSA 1X4JA 5BT4A 4CURA 5KO4A 3GL6A 5H1UA 4R7EA 4UP5A 4CUUA 3QZTA 5LJ1A 2M6MA 4CCGX 5E9VA 3HMFA 3V43A 4ZQLA 2RO1A 3UV2A 5K29A 2RNYA 4HXLA 4PCIA 4FO9A 4LKAA 2R0SA 4ZC9A 4LZSA 4QR5A 3P1EA 4YYDA 4NR6A 4LADB 5B75A 5ENGA 4AYCB 5KH3A 4QC1A 4ALHA 4XY8A 4Y03A 1WEUA 3HCTA 2Y1NA 2L0BA 5FH7A 4N4GA 4OGIA 4NYVA 5IIDA 4BBQA 5F5ZA 2WP2A 3U5MA 4A9JA 4CUTA 4NS5A 2F42A 4BW2A 5CZGA 4FIPA 2YUCA 4NYWA 4YADA 3DPLR 5DW1A 2R10A 4XUAA 5H1TA 1FBVA 2ECWA 4A49A 5AD2A 3S92A 1WILA 1T1HA 4LK9A 4QSPA 2H0DB 1MM3A 4UP0A 4IR6A 5FDZA 4YYKA 5HFQA 4AKNA 4TT2A 2JMDA 4UYGA 5FE2A 2MIQA 5D1KB 2CKLB 5FE8A 1VYXA 4QUTA 2VJFA 4O7AA 5FBXA 4QR3A 4TT4A 1CHCA 3O70A 2IDAA 1HYJA 5D1LB 3C6WA 4IC2A 4NR5A 5I88A 5DLXA 1WGMA 4C66A 1DVPA 2YHOA 4FK5A 1F68A 3M62A 4GB0A 5C8GA 1F62A 5CQ3A 5CQ7A 5CUEA 1MM2A 1WEWA 5TDWA 3RPGC 5FE7A 5CUAA 2DVRA 4L58A 5JWMA 4YC9A 2JRJA 3HCSA 2CSZA 4MENA 5TCMA 4TU6A 3FL2A 3NXBA 1K2FA 5FE5A 2RI7A 5AMFA 5FE0A 2Y1MA 3DQVR 2L75A 2KWOA 5HQ7A 5DX4A 1N87A 5ENJA 4O72A 4MSXA 2YW5A 4HXNA 4QSQA 2LGGA 4YYMA 3IU5A 2LQ6A 4Z93A 5KHMA 5CQ4A 5D3RA 2Y43A 3LQJA 5ENCA 5DW2A 4J1PA 5D24A 2OO1A 4YYNA 3UVXA 4GNDA 3RPGB 4UYEA 4LLBA 5D3PA 4GNGA 4TQNA 5FB0A 4A9KA 5AD3A 5FH8A 2KR4A 4NUEA 3U5PA 1VD4A 4XYAA 1ZBDB 3ZVYA 4KV4A 2M85A 4Z6IA 1WFKA 2M3HA 4RVRA 5LJ2A 2K4DA 5F25A 5HM0A 5I86A 5D25A 3UVYA 5ACYA 2YELA 2YSMA 3O34A 5L98A 4HXSA 3UVDA 2YEMA 5EP7A 1V87A 5I29A 3D7CA 4QSRA 4UIXA 5F3AA 5ENBA 2FUIA 2YYRA 5G05B 4O78A 4O76A 4QF3A 5EPBA 3SOWA 2I7KA 5LCWB 4QSSA 2F6JA 2K17A 5EICA 2XB1A 2OSSA 5FFYA 5F60A 2ECGA 2KGGA 2YQDA 2MA5A 3N9MA 3L1XA 5D3SA 4MEOA 3O36A 4UITA 2E7NA 5CPEA 4NQNA 2YT5A 1JM4B 4QBMA 4YH4A 4QF2A 4J0SA 4NRBA 2ECJA 5EPSA 3L1ZB 1WEOA 2PUYA 2XEUA 3SVHA 2DVQA 4WZ2A 4DONA 5HQ5A 2LGVA 5D1MB 5DYXA 3ZNIA 4LJNA 3EB5A 2DATA 2G43A 5F61A 3G0JA 5EI4A 3HMEA 4NYXA 5L8UA 2WP1A 5FE6A 2L5UA 2YYNA 5EK9A 4XI1A 2YHNA 4AYCA 2L84A 5CQ6A 2BAYA 2MT5A 5TDRA 5JG6A 4MR4A 2DKWA 4TZ8A 4R2YA 4NXJA 4LDFA 5C11A 5F62A 5ENIA 5EQ1A 1HYIA 5EWCA 2D9EA 2AN6A 5J3XA 4NR8A 3ONIA 5EVAA 4YY4A 5F36A 5KU3A 3P1DA 4MR6A 3G0LA 4QZSA 4HXMA 4MR3A 4UIZA 5CGPA 5CTLA 2E6SA 5FG4A 3PUQA 3MB3A 5DKHA 5F63A 4BHWA 2M1RA 2R0YA 2F6NA 5H85A 5F1LA 4HBYA 2MJVB 5C13A 5CUCA 4QNSA 3ZTGA 5DYAA 3N9LA 4GNEA 4NR4A 3MB4A 3P1CA 4X2IA 4YAXA 1G25A 3KQIA 4QSTA 5TBNA 5FE4A 2RNXA 4FJCA 4A9HA 3U5LA 4IR5A 4S3OB 3IU6A 2DVVA 2E3KA 2DX8A 2YU4A 1JOCA 5FH6A 1WIMA 5CRZA 3IHPA 4UI9B 5FE3A 5I80A 5LVRA 3M63A 4IORA 4YY6A 3SHBA 4HXOA 4V3LC 5ENHA 2CKLA 5A5NA 2YREA 5DKCA 5DLZA 4I7DA 1EQFA 4QYLA 5KTWA 4IOQA 4PPEA 5COIA 5DFCA 5EGUA 4AUQB 4CA1A 3C5KA 5F1HA 5B77A 5LVQA 5LUUA 5DKDA 4YYIA 1FP0A 3O35A 2L5EA 5C85A 1Z6UA 4A9MA 5D7XA 5EA1A 4QEUA 4P5OB 1X0JA 5CUGA 5E3GA 5E3DA 4QUUA 4A9IA 3SOUA 2KIZA 2ECIA 5A81A 5II2A 3NG2A 3T7LA 4YK0A 3LXJA 4PCEA 2ECTA 2KTBB 4A9LA 2KREA 2H60A 3P1FA 5D3TA 5EPRA 4IOOA 4Z1QA 4KV1A 4WA6A 5I89A 5A85A 4N4HA 5EWWA 5L97A 5KTXA 5HQ6A 2KYUA 2VPGA 5B76A 5DFDA 4O64A 5G0FA 2C2LA 2NXBA 4IR4A 4TTEA 4IC3A 4V3KC 1JM7B 4QR4A 5II1A 4A9NA 2RSDA 5CQAA 4N4IA 4HXKA 5A5QA 1WEVA 1WEPA 3JVLA 4YYGA 5TB6A 4NQMA 5IGLA 2E6RA 5DINA 4WHUA 5A7CA 3O37A 1WENA 3SOXA 4PKLA 3U5OA 1VFYA 3HMHA 1Z60A 5HRVA 4QSUA 4YYJA 4WZ0A 5FFVA 5ENFA 2YQLA 4UIYA 2RS9B 4OGJA 2VJEB 2LGLA 5HFRA 3UV5A 4GPJA 4YABA 1N72A 2LRIC 4NR7A 4A9EA 2MD8C 4QYDA 5KTUA 3VK6A 5FERA 1E4UA 4NR9A 3GG3A 2KFTA 5DFBA 4A9FA 2FUUA 4KCXA 3KNVA 4LC2A 5CFWA 4YYHA 4CL9A 2JMJA 2LDRA 4O7EA 4YBMA 4PY6A 5A83A 5AITA 1RMDA 5I7YA 1BORA 4R8PK 3HTKC 2LSPB 2I50A 2C2VS 2LXHC 2RFJA 5CRMA 5I7XA 4TKPB 5CY9A 2KU3A 3U5JA 4X3GA 4ZDTA 2D8SA 2UZGA 5CQ5A 2VPDA 3DWYA 5FE9A 2LGKA 3FKMX 2E7OA 1XWHA 1WUMA 4NRAA 2L80A 4Q6FA 3N9PA 4O75A 4UIVA 3ZYUA 4HXRA 3PURA 1WEQA 5E9IA 2OXQC 2LXPC 2CT2A 4LZ2A 5EWHA 4TT6A 3MUKA 2L85A 2K1JA 4O74A 3ASLA 4XUBA 4GNFA 3LQHA 4UYDA 5LJ0A 4LZRA 4WIVA 5AMEA 4WZ3B 2LN0A 2YEKA 2KGIA 4LYWA 4QEWA 2EODA 3DAIA 5CUBA 3N9QA 4QSVA 2VPEA 3UW9A 1E6IA 5HEMA 2VNFA 5E7DA 2G4AA 4ZUXU 2OUOA 5B78A 1IYMA 2D82A 4UYFA 5G4RA 3RCWA 1WEEA 2R0VA 1LDKC 1WEMA 1X4IA 5D3HA 4F3IA 5TRBA 3MXFA 5EWVA 1WESA 4N3WA 2ECNA 3SVGA 3MHHA 5FG5A 4B7YC 4A4BA 3LJWA 5BT3A 3ZVZB 4MEQA 5D0CA 5D3JA 4O77A 5I40A 5DYCA 2EGPA 2VPBA 4NUDA 5C7NA 4F52B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9N A;  5HEN A;  5HRW A;  5C87 A;  2NAA A;  5KH7 A;  5EU1 A;  4YBS A;  4WHW A;  5A5O A;  3K2J A;  3QZV A;  4Z6H A;  2PNX A;  4MR5 A;  3MQM A;  2I8N A;  5IBN A;  1JSP B;  5FEY A;  1WUG A;  4HBV A;  4J0R A;  1WE9 A;  4MVT A;  2EA6 A;  4QC3 A;  5B79 A;  4AP4 A;  3PHD A;  4Q0N A;  5EWD A;  4LR6 A;  5HJC A;  4TYL A;  3UVW A;  5E0R A;  4NN2 A;  4FLP A;  5HRX A;  4HBW A;  5L8T A;  3T6R A;  2HDP A;  5CQ8 A;  1U6G B;  4QB3 A;  4PTB A;  3S91 A;  4CUP A;  4Z1S A;  3O7A A;  5F2P A;  5L99 A;  2QJ0 A;  2HYE D;  2MA6 A;  5E73 A;  5HEL A;  5H1V A;  2GRC A;  5FE1 A;  5IGM A;  5G04 B;  2N9G A;  4B86 C;  3AAD A;  3MHS A;  5FB1 A;  4O71 A;  3EB6 A;  5EM3 A;  2MD7 B;  2VJE A;  2YDW A;  3MUL A;  4QY4 A;  5DBM A;  5CP5 A;  4QSX A;  3SVF A;  4PS5 A;  4A9O A;  2H0D A;  4W4U A;  4HBX A;  4UYF B;  4NRC A;  1LDJ B;  3O33 A;  2LV9 A;  4LYI A;  5L96 A;  5E9K A;  4QSW A;  5DKA A;  4I7C A;  5DY7 A;  2KWJ A;  4CLB A;  5A5P A;  4OUF A;  2RNW A;  4ZW1 A;  3GV4 A;  4C67 A;  3L11 A;  3LRQ A;  3U5K A;  3JVM A;  2MNZ A;  3KV5 A;  5HLS A;  4S3O C;  3N9O A;  3JVK A;  3M99 A;  4XY9 A;  2DVS A;  5IGK A;  2DWW A;  5AIU A;  3ZYQ A;  4O7C A;  4BW3 A;  5KH9 A;  4L7X A;  5D26 A;  5IGN A;  3P5O A;  4LRG A;  2YW8 A;  4N4F A;  5H9M A;  4CFK A;  3U5N A;  4MEP A;  4BJX A;  2MUM A;  5A5S A;  4YBT A;  5BT5 A;  2QIZ A;  5JI8 A;  5CS8 A;  5B8D A;  3HCU A;  2FSA A;  2G6Q A;  4E96 A;  1X4U A;  2L43 A;  4CUQ A;  1Z2Q A;  5J0D A;  5EIS A;  3RTR B;  5FG6 A;  5A5R A;  1ZS5 A;  4BW1 A;  5C4Q A;  2ZET C;  4J3I A;  5HCL A;  5I83 A;  4A0C D;  5I1Q A;  5TAB A;  4TS8 A;  3UV4 A;  4A4C A;  4LYS A;  5E74 A;  1JM7 A;  4ALG A;  5CQT A;  4IR3 A;  4TU4 A;  2YSJ A;  4UIU A;  3QZS A;  4C9Z A;  5G4S A;  5LKX A;  5LKZ A;  5I3L A;  5CU8 A;  4O70 A;  3ZPV E;  4UYH A;  2QIC A;  3LQI A;  4Q0O A;  5FFW A;  4UIW A;  4O7B A;  4QEV A;  5LKT A;  2MNY A;  4HXP A;  3KV6 A;  4O7F A;  5DYU A;  2YUR A;  2KWK A;  4YAT A;  2YQM A;  5E9Y A;  3Q2E A;  5EV9 A;  2VP7 A;  2ECV A;  3ZPV 1;  4TZ2 A;  5CUD A;  5D3N A;  5C89 A;  4BW4 A;  4CFL A;  2G45 A;  5D3L A;  4AVX A;  5ENE A;  5EYA F;  2VJF B;  2KWN A;  5IG6 A;  5ETB A;  2JMI A;  5E9M A;  5ETD A;  2K16 A;  4I7B A;  3I3J A;  5A82 A;  5LKU A;  3TLP A;  2CSY A;  5E9L A;  3I2D A;  3JVJ A;  3AQA A;  4YH3 A;  3Q2F A;  2KE1 A;  4NUC A;  4CUS A;  1X4J A;  5BT4 A;  4CUR A;  5KO4 A;  3GL6 A;  5H1U A;  4R7E A;  4UP5 A;  4CUU A;  3QZT A;  5LJ1 A;  2M6M A;  4CCG X;  5E9V A;  3HMF A;  3V43 A;  4ZQL A;  2RO1 A;  3UV2 A;  5K29 A;  2RNY A;  4HXL A;  4PCI A;  4FO9 A;  4LKA A;  2R0S A;  4ZC9 A;  4LZS A;  4QR5 A;  3P1E A;  4YYD A;  4NR6 A;  4LAD B;  5B75 A;  5ENG A;  4AYC B;  5KH3 A;  4QC1 A;  4ALH A;  4XY8 A;  4Y03 A;  1WEU A;  3HCT A;  2Y1N A;  2L0B A;  5FH7 A;  4N4G A;  4OGI A;  4NYV A;  5IID A;  4BBQ A;  5F5Z A;  2WP2 A;  3U5M A;  4A9J A;  4CUT A;  4NS5 A;  2F42 A;  4BW2 A;  5CZG A;  4FIP A;  2YUC A;  4NYW A;  4YAD A;  3DPL R;  5DW1 A;  2R10 A;  4XUA A;  5H1T A;  1FBV A;  2ECW A;  4A49 A;  5AD2 A;  3S92 A;  1WIL A;  1T1H A;  4LK9 A;  4QSP A;  2H0D B;  1MM3 A;  4UP0 A;  4IR6 A;  5FDZ A;  4YYK A;  5HFQ A;  4AKN A;  4TT2 A;  2JMD A;  4UYG A;  5FE2 A;  2MIQ A;  5D1K B;  2CKL B;  5FE8 A;  1VYX A;  4QUT A;  2VJF A;  4O7A A;  5FBX A;  4QR3 A;  4TT4 A;  1CHC A;  3O70 A;  2IDA A;  1HYJ A;  5D1L B;  3C6W A;  4IC2 A;  4NR5 A;  5I88 A;  5DLX A;  1WGM A;  4C66 A;  1DVP A;  2YHO A;  4FK5 A;  1F68 A;  3M62 A;  4GB0 A;  5C8G A;  1F62 A;  5CQ3 A;  5CQ7 A;  5CUE A;  1MM2 A;  1WEW A;  5TDW A;  3RPG C;  5FE7 A;  5CUA A;  2DVR A;  4L58 A;  5JWM A;  4YC9 A;  2JRJ A;  3HCS A;  2CSZ A;  4MEN A;  5TCM A;  4TU6 A;  3FL2 A;  3NXB A;  1K2F A;  5FE5 A;  2RI7 A;  5AMF A;  5FE0 A;  2Y1M A;  3DQV R;  2L75 A;  2KWO A;  5HQ7 A;  5DX4 A;  1N87 A;  5ENJ A;  4O72 A;  4MSX A;  2YW5 A;  4HXN A;  4QSQ A;  2LGG A;  4YYM A;  3IU5 A;  2LQ6 A;  4Z93 A;  5KHM A;  5CQ4 A;  5D3R A;  2Y43 A;  3LQJ A;  5ENC A;  5DW2 A;  4J1P A;  5D24 A;  2OO1 A;  4YYN A;  3UVX A;  4GND A;  3RPG B;  4UYE A;  4LLB A;  5D3P A;  4GNG A;  4TQN A;  5FB0 A;  4A9K A;  5AD3 A;  5FH8 A;  2KR4 A;  4NUE A;  3U5P A;  1VD4 A;  4XYA A;  1ZBD B;  3ZVY A;  4KV4 A;  2M85 A;  4Z6I A;  1WFK A;  2M3H A;  4RVR A;  5LJ2 A;  2K4D A;  5F25 A;  5HM0 A;  5I86 A;  5D25 A;  3UVY A;  5ACY A;  2YEL A;  2YSM A;  3O34 A;  5L98 A;  4HXS A;  3UVD A;  2YEM A;  5EP7 A;  1V87 A;  5I29 A;  3D7C A;  4QSR A;  4UIX A;  5F3A A;  5ENB A;  2FUI A;  2YYR A;  5G05 B;  4O78 A;  4O76 A;  4QF3 A;  5EPB A;  3SOW A;  2I7K A;  5LCW B;  4QSS A;  2F6J A;  2K17 A;  5EIC A;  2XB1 A;  2OSS A;  5FFY A;  5F60 A;  2ECG A;  2KGG A;  2YQD A;  2MA5 A;  3N9M A;  3L1X A;  5D3S A;  4MEO A;  3O36 A;  4UIT A;  2E7N A;  5CPE A;  4NQN A;  2YT5 A;  1JM4 B;  4QBM A;  4YH4 A;  4QF2 A;  4J0S A;  4NRB A;  2ECJ A;  5EPS A;  3L1Z B;  1WEO A;  2PUY A;  2XEU A;  3SVH A;  2DVQ A;  4WZ2 A;  4DON A;  5HQ5 A;  2LGV A;  5D1M B;  5DYX A;  3ZNI A;  4LJN A;  3EB5 A;  2DAT A;  2G43 A;  5F61 A;  3G0J A;  5EI4 A;  3HME A;  4NYX A;  5L8U A;  2WP1 A;  5FE6 A;  2L5U A;  2YYN A;  5EK9 A;  4XI1 A;  2YHN A;  4AYC A;  2L84 A;  5CQ6 A;  2BAY A;  2MT5 A;  5TDR A;  5JG6 A;  4MR4 A;  2DKW A;  4TZ8 A;  4R2Y A;  4NXJ A;  4LDF A;  5C11 A;  5F62 A;  5ENI A;  5EQ1 A;  1HYI A;  5EWC A;  2D9E A;  2AN6 A;  5J3X A;  4NR8 A;  3ONI A;  5EVA A;  4YY4 A;  5F36 A;  5KU3 A;  3P1D A;  4MR6 A;  3G0L A;  4QZS A;  4HXM A;  4MR3 A;  4UIZ A;  5CGP A;  5CTL A;  2E6S A;  5FG4 A;  3PUQ A;  3MB3 A;  5DKH A;  5F63 A;  4BHW A;  2M1R A;  2R0Y A;  2F6N A;  5H85 A;  5F1L A;  4HBY A;  2MJV B;  5C13 A;  5CUC A;  4QNS A;  3ZTG A;  5DYA A;  3N9L A;  4GNE A;  4NR4 A;  3MB4 A;  3P1C A;  4X2I A;  4YAX A;  1G25 A;  3KQI A;  4QST A;  5TBN A;  5FE4 A;  2RNX A;  4FJC A;  4A9H A;  3U5L A;  4IR5 A;  4S3O B;  3IU6 A;  2DVV A;  2E3K A;  2DX8 A;  2YU4 A;  1JOC A;  5FH6 A;  1WIM A;  5CRZ A;  3IHP A;  4UI9 B;  5FE3 A;  5I80 A;  5LVR A;  3M63 A;  4IOR A;  4YY6 A;  3SHB A;  4HXO A;  4V3L C;  5ENH A;  2CKL A;  5A5N A;  2YRE A;  5DKC A;  5DLZ A;  4I7D A;  1EQF A;  4QYL A;  5KTW A;  4IOQ A;  4PPE A;  5COI A;  5DFC A;  5EGU A;  4AUQ B;  4CA1 A;  3C5K A;  5F1H A;  5B77 A;  5LVQ A;  5LUU A;  5DKD A;  4YYI A;  1FP0 A;  3O35 A;  2L5E A;  5C85 A;  1Z6U A;  4A9M A;  5D7X A;  5EA1 A;  4QEU A;  4P5O B;  1X0J A;  5CUG A;  5E3G A;  5E3D A;  4QUU A;  4A9I A;  3SOU A;  2KIZ A;  2ECI A;  5A81 A;  5II2 A;  3NG2 A;  3T7L A;  4YK0 A;  3LXJ A;  4PCE A;  2ECT A;  2KTB B;  4A9L A;  2KRE A;  2H60 A;  3P1F A;  5D3T A;  5EPR A;  4IOO A;  4Z1Q A;  4KV1 A;  4WA6 A;  5I89 A;  5A85 A;  4N4H A;  5EWW A;  5L97 A;  5KTX A;  5HQ6 A;  2KYU A;  2VPG A;  5B76 A;  5DFD A;  4O64 A;  5G0F A;  2C2L A;  2NXB A;  4IR4 A;  4TTE A;  4IC3 A;  4V3K C;  1JM7 B;  4QR4 A;  5II1 A;  4A9N A;  2RSD A;  5CQA A;  4N4I A;  4HXK A;  5A5Q A;  1WEV A;  1WEP A;  3JVL A;  4YYG A;  5TB6 A;  4NQM A;  5IGL A;  2E6R A;  5DIN A;  4WHU A;  5A7C A;  3O37 A;  1WEN A;  3SOX A;  4PKL A;  3U5O A;  1VFY A;  3HMH A;  1Z60 A;  5HRV A;  4QSU A;  4YYJ A;  4WZ0 A;  5FFV A;  5ENF A;  2YQL A;  4UIY A;  2RS9 B;  4OGJ A;  2VJE B;  2LGL A;  5HFR A;  3UV5 A;  4GPJ A;  4YAB A;  1N72 A;  2LRI C;  4NR7 A;  4A9E A;  2MD8 C;  4QYD A;  5KTU A;  3VK6 A;  5FER A;  1E4U A;  4NR9 A;  3GG3 A;  2KFT A;  5DFB A;  4A9F A;  2FUU A;  4KCX A;  3KNV A;  4LC2 A;  5CFW A;  4YYH A;  4CL9 A;  2JMJ A;  2LDR A;  4O7E A;  4YBM A;  4PY6 A;  5A83 A;  5AIT A;  1RMD A;  5I7Y A;  1BOR A;  4R8P K;  3HTK C;  2LSP B;  2I50 A;  2C2V S;  2LXH C;  2RFJ A;  5CRM A;  5I7X A;  4TKP B;  5CY9 A;  2KU3 A;  3U5J A;  4X3G A;  4ZDT A;  2D8S A;  2UZG A;  5CQ5 A;  2VPD A;  3DWY A;  5FE9 A;  2LGK A;  3FKM X;  2E7O A;  1XWH A;  1WUM A;  4NRA A;  2L80 A;  4Q6F A;  3N9P A;  4O75 A;  4UIV A;  3ZYU A;  4HXR A;  3PUR A;  1WEQ A;  5E9I A;  2OXQ C;  2LXP C;  2CT2 A;  4LZ2 A;  5EWH A;  4TT6 A;  3MUK A;  2L85 A;  2K1J A;  4O74 A;  3ASL A;  4XUB A;  4GNF A;  3LQH A;  4UYD A;  5LJ0 A;  4LZR A;  4WIV A;  5AME A;  4WZ3 B;  2LN0 A;  2YEK A;  2KGI A;  4LYW A;  4QEW A;  2EOD A;  3DAI A;  5CUB A;  3N9Q A;  4QSV A;  2VPE A;  3UW9 A;  1E6I A;  5HEM A;  2VNF A;  5E7D A;  2G4A A;  4ZUX U;  2OUO A;  5B78 A;  1IYM A;  2D82 A;  4UYF A;  5G4R A;  3RCW A;  1WEE A;  2R0V A;  1LDK C;  1WEM A;  1X4I A;  5D3H A;  4F3I A;  5TRB A;  3MXF A;  5EWV A;  1WES A;  4N3W A;  2ECN A;  3SVG A;  3MHH A;  5FG5 A;  4B7Y C;  4A4B A;  3LJW A;  5BT3 A;  3ZVZ B;  4MEQ A;  5D0C A;  5D3J A;  4O77 A;  5I40 A;  5DYC A;  2EGP A;  2VPB A;  4NUD A;  5C7N A;  4F52 B; 
#chains in the Genus database with same CATH topology
 3N9N A;  5HEN A;  5HRW A;  5C87 A;  2OWA A;  2NAA A;  5KH7 A;  5EU1 A;  4YBS A;  4WHW A;  5A5O A;  3K2J A;  3QZV A;  4Z6H A;  2PNX A;  4MR5 A;  3MQM A;  2I8N A;  5IBN A;  1JSP B;  5FEY A;  1WUG A;  4HBV A;  4J0R A;  1WE9 A;  4MVT A;  2EA6 A;  4QC3 A;  5B79 A;  4AP4 A;  3PHD A;  4Q0N A;  5EWD A;  4LR6 A;  3JUE A;  5HJC A;  4TYL A;  3UVW A;  5E0R A;  4NN2 A;  4FLP A;  5HRX A;  4HBW A;  5L8T A;  3T6R A;  2HDP A;  5CQ8 A;  1U6G B;  4QB3 A;  4PTB A;  3S91 A;  4CUP A;  4Z1S A;  3O7A A;  5F2P A;  5L99 A;  2QJ0 A;  2HYE D;  2MA6 A;  5E73 A;  5HEL A;  5H1V A;  2GRC A;  5FE1 A;  5IGM A;  5G04 B;  2N9G A;  4B86 C;  3AAD A;  3MHS A;  5FB1 A;  4O71 A;  3EB6 A;  5EM3 A;  2MD7 B;  2VJE A;  2YDW A;  3MUL A;  2EGM A;  2CSV A;  4QY4 A;  5DBM A;  5CP5 A;  4QSX A;  3SVF A;  4PS5 A;  4A9O A;  2H0D A;  4W4U A;  4HBX A;  4UYF B;  4NRC A;  1LDJ B;  3O33 A;  2LV9 A;  4LYI A;  1DCQ A;  5L96 A;  5E9K A;  4QSW A;  5DKA A;  4I7C A;  5DY7 A;  2KWJ A;  4CLB A;  5A5P A;  4OUF A;  2RNW A;  4ZW1 A;  3GV4 A;  4C67 A;  2XP0 A;  3L11 A;  3LRQ A;  2DSM A;  3D1B A;  1PUO A;  3U5K A;  3JVM A;  2MNZ A;  3KV5 A;  5HLS A;  5SVY A;  3FJU B;  4S3O C;  3N9O A;  3JVK A;  3M99 A;  4XY9 A;  2DVS A;  5IGK A;  2DWW A;  5AIU A;  3ZYQ A;  4O7C A;  4BW3 A;  5KH9 A;  4L7X A;  4Z0O A;  5D26 A;  5IGN A;  3P5O A;  4LRG A;  2YW8 A;  4N4F A;  5H9M A;  4CFK A;  3U5N A;  4MEP A;  4BJX A;  2MUM A;  5A5S A;  4YBT A;  5BT5 A;  2QIZ A;  5JI8 A;  2EXU A;  5CS8 A;  5B8D A;  3HCU A;  2FSA A;  2G6Q A;  4E96 A;  1X4U A;  2L43 A;  4CUQ A;  1Z2Q A;  5J0D A;  2FD4 A;  5EIS A;  3RTR B;  5FG6 A;  5A5R A;  1ZS5 A;  4BW1 A;  5C4Q A;  2ZET C;  4J3I A;  5HCL A;  5I83 A;  4A0C D;  3D1D A;  5I1Q A;  5TAB A;  4TS8 A;  3UV4 A;  4A4C A;  4LYS A;  5E74 A;  2KKX A;  1JM7 A;  4ALG A;  2XOZ A;  5CQT A;  4IR3 A;  4TU4 A;  2YSJ A;  4UIU A;  3QZS A;  4C9Z A;  5G4S A;  5LKX A;  2E61 A;  5LKZ A;  5I3L A;  5CU8 A;  4O70 A;  2JUN A;  3ZPV E;  4UYH A;  2QIC A;  3LQI A;  4Q0O A;  5FFW A;  4UIW A;  2YVR A;  4O7B A;  1ZKR A;  4QEV A;  5LKT A;  4HXP A;  2MNY A;  4O7F A;  5DYU A;  2YUR A;  2KWK A;  4YAT A;  3KV6 A;  2YQM A;  5E9Y A;  3Q2E A;  5EV9 A;  2VP7 A;  2ECV A;  3ZPV 1;  4TZ2 A;  5CUD A;  5D3N A;  5C89 A;  4BW4 A;  4CFL A;  2G45 A;  5D3L A;  2XOC A;  5ENE A;  4AVX A;  5EYA F;  2VJF B;  2KWN A;  2CON A;  3LDY A;  5IG6 A;  5ETB A;  2JMI A;  5E9M A;  5ETD A;  2K16 A;  4I7B A;  3I3J A;  5A82 A;  4H9D A;  5LKU A;  3TLP A;  2CSY A;  5E9L A;  3I2D A;  3JVJ A;  3AQA A;  4YH3 A;  3Q2F A;  2JM3 A;  2KE1 A;  4NUC A;  4CUS A;  1X4J A;  5BT4 A;  4CUR A;  5KO4 A;  3GL6 A;  5H1U A;  4R7E A;  4UP5 A;  4CUU A;  3QZT A;  5LJ1 A;  2M6M A;  4CCG X;  5E9V A;  3HMF A;  3V43 A;  4ZQL A;  2RO1 A;  3UV2 A;  5SVI B;  5K29 A;  2RNY A;  4HXL A;  4PCI A;  4FO9 A;  4LKA A;  2R0S A;  4ZC9 A;  4LZS A;  4QR5 A;  2LAU A;  4OGE A;  3P1E A;  4YYD A;  4NR6 A;  4LAD B;  5B75 A;  5ENG A;  4AYC B;  5KH3 A;  4QC1 A;  4ALH A;  4XY8 A;  4Y03 A;  1WEU A;  3HCT A;  2Y1N A;  2L0B A;  5FH7 A;  3H7H A;  4N4G A;  4OGI A;  4NYV A;  5IID A;  4BBQ A;  5F5Z A;  2WP2 A;  3U5M A;  4A9J A;  4CUT A;  4NS5 A;  2F42 A;  4BW2 A;  5CZG A;  4FIP A;  2YUC A;  4NYW A;  4YAD A;  3DPL R;  5DW1 A;  2R10 A;  4XUA A;  5H1T A;  1FBV A;  2ECW A;  4A49 A;  5AD2 A;  3S92 A;  1WIL A;  1T1H A;  4LK9 A;  4QSP A;  2H0D B;  3FM8 C;  1MM3 A;  4UP0 A;  4IR6 A;  5FDZ A;  4YYK A;  5HFQ A;  4AKN A;  4TT2 A;  2JMD A;  4UYG A;  5FE2 A;  2MIQ A;  5D1K B;  2CKL B;  5FE8 A;  1VYX A;  3KDE C;  4QUT A;  2VJF A;  4O7A A;  5FBX A;  4QR3 A;  4TT4 A;  1CHC A;  4F1P A;  3O70 A;  2IDA A;  1HYJ A;  3LJU X;  4OGC A;  5D1L B;  3C6W A;  4IC2 A;  4NR5 A;  5I88 A;  5DLX A;  1WGM A;  4C66 A;  1DVP A;  2YHO A;  4FK5 A;  1F68 A;  3M62 A;  4GB0 A;  5C8G A;  1F62 A;  5CQ3 A;  5CQ7 A;  5CUE A;  1MM2 A;  1WEW A;  5TDW A;  3RPG C;  5DIN A;  5FE7 A;  4O62 A;  5CUA A;  2DVR A;  4L58 A;  5JWM A;  4YC9 A;  2JRJ A;  3HCS A;  2CSZ A;  2B0O E;  4MEN A;  5TCM A;  4TU6 A;  3FL2 A;  3NXB A;  1K2F A;  5FE5 A;  2RI7 A;  5AMF A;  5FE0 A;  2Y1M A;  3DQV R;  2L75 A;  5SVX A;  2KWO A;  5HQ7 A;  5DX4 A;  1N87 A;  5ENJ A;  4O72 A;  3ERR A;  4MSX A;  2YW5 A;  4HXN A;  4QSQ A;  2LGG A;  4YYM A;  3IU5 A;  2LQ6 A;  4Z93 A;  5KHM A;  5CQ4 A;  5D3R A;  5SVI A;  2Y43 A;  3LQJ A;  5ENC A;  5DW2 A;  4J1P A;  5D24 A;  2OO1 A;  4YYN A;  3UVX A;  3VKG A;  4GND A;  3RPG B;  4UYE A;  4LLB A;  5D3P A;  4GNG A;  3LVR E;  4TQN A;  5FB0 A;  4A9K A;  5AD3 A;  5FH8 A;  2KR4 A;  4NUE A;  3U5P A;  1VD4 A;  4XYA A;  1ZBD B;  3ZVY A;  3E2D A;  4KV4 A;  2M85 A;  4Z6I A;  1WFK A;  2M3H A;  4RVR A;  5LJ2 A;  2K4D A;  5F25 A;  5HM0 A;  5I86 A;  5D25 A;  3UVY A;  5ACY A;  2YEL A;  2YSM A;  3O34 A;  5L98 A;  4HXS A;  3UVD A;  2YEM A;  5EP7 A;  1V87 A;  5I29 A;  3FAN A;  3D7C A;  4QSR A;  4UIX A;  5F3A A;  5ENB A;  2FUI A;  2YYR A;  5G05 B;  4O78 A;  4O76 A;  4QF3 A;  5EPB A;  3SOW A;  2I7K A;  4QQ4 A;  5LCW B;  4QSS A;  2F6J A;  2K17 A;  5EIC A;  2XB1 A;  2OSS A;  5FFY A;  5F60 A;  2ECG A;  2KGG A;  2YQD A;  2MA5 A;  3N9M A;  3L1X A;  5D3S A;  4MEO A;  2DJA A;  3O36 A;  4UIT A;  2E7N A;  5CPE A;  4NQN A;  2YT5 A;  1JM4 B;  2L7P A;  4QBM A;  4YH4 A;  4QF2 A;  4J0S A;  4NRB A;  2ECJ A;  4AKG A;  5EPS A;  3L1Z B;  1WEO A;  2PUY A;  2XEU A;  3SVH A;  2DVQ A;  4WZ2 A;  4DON A;  5HQ5 A;  2LGV A;  5D1M B;  5DYX A;  3ZNI A;  4LJN A;  3EB5 A;  2DAT A;  2G43 A;  5F61 A;  3G0J A;  5EI4 A;  3HME A;  4NYX A;  5L8U A;  2WP1 A;  5FE6 A;  2L5U A;  2YYN A;  5EK9 A;  3FAO A;  2YHN A;  4XI1 A;  2XOY A;  4AYC A;  2L84 A;  5CQ6 A;  2BAY A;  2MT5 A;  5TDR A;  5JG6 A;  4MR4 A;  2DKW A;  4TZ8 A;  4R2Y A;  4NXJ A;  4LDF A;  5C11 A;  5F62 A;  5ENI A;  5EQ1 A;  1HYI A;  5EWC A;  2D9E A;  2AN6 A;  5J3X A;  4NR8 A;  3DDT A;  4Z0R A;  3ONI A;  5EVA A;  4YY4 A;  5F36 A;  2CRR A;  5KU3 A;  3P1D A;  4MR6 A;  3G0L A;  4QZS A;  4HXM A;  4MR3 A;  4UIZ A;  5CGP A;  5CTL A;  2E6S A;  5FG4 A;  3PUQ A;  3MB3 A;  5DKH A;  5F63 A;  4BHW A;  4AI6 A;  2M1R A;  2R0Y A;  3DWD A;  4AKH A;  2F6N A;  5H85 A;  5F1L A;  4HBY A;  2MJV B;  5C13 A;  2KKY A;  5CUC A;  4QNS A;  3ZTG A;  5DYA A;  3N9L A;  4GNE A;  4NR4 A;  3MB4 A;  3P1C A;  4X2I A;  4YAX A;  1G25 A;  3KQI A;  4QST A;  5TBN A;  5FE4 A;  2RNX A;  4FJC A;  4A9H A;  3U5L A;  4IR5 A;  4S3O B;  3IU6 A;  2DVV A;  2E3K A;  2DX8 A;  2YU4 A;  1JOC A;  5FH6 A;  1WIM A;  5CRZ A;  3IHP A;  4UI9 B;  5FE3 A;  5I80 A;  5LVR A;  3M63 A;  4IOR A;  4YY6 A;  3SHB A;  4HXO A;  4V3L C;  5ENH A;  2CKL A;  5A5N A;  2YRE A;  5DKC A;  5DLZ A;  4I7D A;  1EQF A;  4QYL A;  5KTW A;  4IOQ A;  4PPE A;  5COI A;  5DFC A;  5EGU A;  4AUQ B;  3LVQ E;  4CA1 A;  3C5K A;  5F1H A;  5B77 A;  5LVQ A;  5LUU A;  5DKD A;  4YYI A;  3T9K A;  1FP0 A;  3O35 A;  2L5E A;  5C85 A;  1Z6U A;  4A9M A;  5D7X A;  5EA1 A;  4QEU A;  4P5O B;  1X0J A;  5CUG A;  5E3G A;  5E3D A;  4QUU A;  4A9I A;  3SOU A;  2KIZ A;  2ECI A;  5A81 A;  5II2 A;  3NG2 A;  3T7L A;  4YK0 A;  3LXJ A;  4PCE A;  2ECT A;  2KTB B;  3VKH A;  2M13 A;  4A9L A;  2KRE A;  2H60 A;  3P1F A;  5D3T A;  5EPR A;  4IOO A;  4Z1Q A;  4KV1 A;  4WA6 A;  5I89 A;  5A85 A;  4N4H A;  5EWW A;  5L97 A;  5KTX A;  5HQ6 A;  2KYU A;  1MBM A;  2VPG A;  5B76 A;  5DFD A;  4O64 A;  5G0F A;  2C2L A;  2NXB A;  4IR4 A;  4TTE A;  4IC3 A;  4V3K C;  1JM7 B;  4QR4 A;  5II1 A;  4A9N A;  4AKI A;  2RSD A;  5CQA A;  4N4I A;  4HXK A;  5A5Q A;  1WEV A;  1WEP A;  3JVL A;  4YYG A;  5TB6 A;  4NQM A;  5IGL A;  2E6R A;  2MKE A;  3PLW A;  4WHU A;  5A7C A;  3O37 A;  1WEN A;  3SOX A;  4PKL A;  3U5O A;  1VFY A;  3HMH A;  1Z60 A;  5HRV A;  4QSU A;  4YYJ A;  4WZ0 A;  5FFV A;  5ENF A;  2YQL A;  4UIY A;  2RS9 B;  4OGJ A;  2VJE B;  2LGL A;  5HFR A;  3UV5 A;  2FFW A;  4GPJ A;  5K3Q A;  4YAB A;  1N72 A;  2LRI C;  3MDB C;  4NR7 A;  4A9E A;  2MD8 C;  4QYD A;  5KTU A;  3VK6 A;  5FER A;  1E4U A;  4NR9 A;  2CRW A;  2D8U A;  3GG3 A;  2KFT A;  5DFB A;  4A9F A;  2FUU A;  4KCX A;  3KNV A;  4LC2 A;  5CFW A;  4YYH A;  4CL9 A;  2JMJ A;  2LDR A;  4O7E A;  4YBM A;  4PY6 A;  5A83 A;  5AIT A;  1RMD A;  5I7Y A;  1BOR A;  2IQJ A;  3O47 A;  4R8P K;  3HTK C;  2LSP B;  2I50 A;  2C2V S;  2LXH C;  2RFJ A;  5CRM A;  3FEH A;  5I7X A;  4TKP B;  5CY9 A;  2KU3 A;  3U5J A;  2RR4 A;  4X3G A;  4ZDT A;  2D8S A;  2UZG A;  5CQ5 A;  2VPD A;  3DWY A;  5FE9 A;  2LGK A;  3FKM X;  2E7O A;  1XWH A;  1WUM A;  4NRA A;  2L80 A;  4Q6F A;  3N9P A;  4O75 A;  4UIV A;  3ZYU A;  4HXR A;  3PUR A;  1WEQ A;  5E9I A;  2OXQ C;  2LXP C;  3M7K A;  2CT2 A;  4LZ2 A;  5EWH A;  4TT6 A;  3MUK A;  2L85 A;  2K1J A;  4O74 A;  3ASL A;  4XUB A;  4GNF A;  3LQH A;  4UYD A;  5LJ0 A;  4LZR A;  4WIV A;  5AME A;  4WZ3 B;  2LN0 A;  2YEK A;  2KGI A;  4LYW A;  4QEW A;  2EOD A;  3DAI A;  5CUB A;  3N9Q A;  4QSV A;  2VPE A;  3UW9 A;  1E6I A;  5HEM A;  2VNF A;  5E7D A;  2G4A A;  3SUB A;  2OUO A;  5B78 A;  2P57 A;  4ZUX U;  2D82 A;  1IYM A;  4UYF A;  2EJN A;  5G4R A;  3RCW A;  1WEE A;  2R0V A;  1LDK C;  1WEM A;  1X4I A;  5D3H A;  4F3I A;  5TRB A;  3Q1D A;  3MXF A;  5EWV A;  1WES A;  4N3W A;  2ECN A;  3SVG A;  3MHH A;  5FG5 A;  4B7Y C;  4A4B A;  3LJW A;  5BT3 A;  3ZVZ B;  4MEQ A;  5D0C A;  5D3J A;  4O77 A;  5I40 A;  5DYC A;  2EGP A;  2VPB A;  4NUD A;  5C7N A;  4F52 B; 
#chains in the Genus database with same CATH homology
 3N9N A;  5HEN A;  5HRW A;  5C87 A;  2NAA A;  5KH7 A;  5EU1 A;  4YBS A;  4WHW A;  5A5O A;  3K2J A;  3QZV A;  4Z6H A;  2PNX A;  4MR5 A;  3MQM A;  2I8N A;  5IBN A;  1JSP B;  5FEY A;  1WUG A;  4HBV A;  4J0R A;  1WE9 A;  4MVT A;  2EA6 A;  4QC3 A;  5B79 A;  4AP4 A;  3PHD A;  4Q0N A;  5EWD A;  4LR6 A;  5HJC A;  4TYL A;  3UVW A;  5E0R A;  4NN2 A;  4FLP A;  5HRX A;  4HBW A;  5L8T A;  3T6R A;  2HDP A;  5CQ8 A;  1U6G B;  4QB3 A;  4PTB A;  3S91 A;  4CUP A;  4Z1S A;  3O7A A;  5F2P A;  5L99 A;  2QJ0 A;  2HYE D;  2MA6 A;  5E73 A;  5HEL A;  5H1V A;  2GRC A;  5FE1 A;  5IGM A;  5G04 B;  2N9G A;  4B86 C;  3AAD A;  3MHS A;  5FB1 A;  4O71 A;  3EB6 A;  5EM3 A;  2MD7 B;  2VJE A;  2YDW A;  3MUL A;  4QY4 A;  5DBM A;  5CP5 A;  4QSX A;  3SVF A;  4PS5 A;  4A9O A;  2H0D A;  4W4U A;  4HBX A;  4UYF B;  4NRC A;  1LDJ B;  3O33 A;  2LV9 A;  4LYI A;  5L96 A;  5E9K A;  4QSW A;  5DKA A;  4I7C A;  5DY7 A;  2KWJ A;  4CLB A;  5A5P A;  4OUF A;  2RNW A;  4ZW1 A;  3GV4 A;  4C67 A;  3L11 A;  3LRQ A;  3U5K A;  3JVM A;  2MNZ A;  3KV5 A;  5HLS A;  4S3O C;  3N9O A;  3JVK A;  3M99 A;  4XY9 A;  2DVS A;  5IGK A;  2DWW A;  5AIU A;  3ZYQ A;  4O7C A;  4BW3 A;  5KH9 A;  4L7X A;  5D26 A;  5IGN A;  3P5O A;  4LRG A;  2YW8 A;  4N4F A;  5H9M A;  4CFK A;  3U5N A;  4MEP A;  4BJX A;  2MUM A;  5A5S A;  4YBT A;  5BT5 A;  2QIZ A;  5JI8 A;  5CS8 A;  5B8D A;  3HCU A;  2FSA A;  2G6Q A;  4E96 A;  1X4U A;  2L43 A;  4CUQ A;  1Z2Q A;  5J0D A;  5EIS A;  3RTR B;  5FG6 A;  5A5R A;  1ZS5 A;  4BW1 A;  5C4Q A;  2ZET C;  4J3I A;  5HCL A;  5I83 A;  4A0C D;  5I1Q A;  5TAB A;  4TS8 A;  3UV4 A;  4A4C A;  4LYS A;  5E74 A;  1JM7 A;  4ALG A;  5CQT A;  4IR3 A;  4TU4 A;  2YSJ A;  4UIU A;  3QZS A;  4C9Z A;  5G4S A;  5LKX A;  5LKZ A;  5I3L A;  5CU8 A;  4O70 A;  3ZPV E;  4UYH A;  2QIC A;  3LQI A;  4Q0O A;  5FFW A;  4UIW A;  4O7B A;  4QEV A;  5LKT A;  2MNY A;  4HXP A;  3KV6 A;  4O7F A;  5DYU A;  2YUR A;  2KWK A;  4YAT A;  2YQM A;  5E9Y A;  3Q2E A;  5EV9 A;  2VP7 A;  2ECV A;  3ZPV 1;  4TZ2 A;  5CUD A;  5D3N A;  5C89 A;  4BW4 A;  4CFL A;  2G45 A;  5D3L A;  4AVX A;  5ENE A;  5EYA F;  2VJF B;  2KWN A;  5IG6 A;  5ETB A;  2JMI A;  5E9M A;  5ETD A;  2K16 A;  4I7B A;  3I3J A;  5A82 A;  5LKU A;  3TLP A;  2CSY A;  5E9L A;  3I2D A;  3JVJ A;  3AQA A;  4YH3 A;  3Q2F A;  2KE1 A;  4NUC A;  4CUS A;  1X4J A;  5BT4 A;  4CUR A;  5KO4 A;  3GL6 A;  5H1U A;  4R7E A;  4UP5 A;  4CUU A;  3QZT A;  5LJ1 A;  2M6M A;  4CCG X;  5E9V A;  3HMF A;  3V43 A;  4ZQL A;  2RO1 A;  3UV2 A;  5K29 A;  2RNY A;  4HXL A;  4PCI A;  4FO9 A;  4LKA A;  2R0S A;  4ZC9 A;  4LZS A;  4QR5 A;  3P1E A;  4YYD A;  4NR6 A;  4LAD B;  5B75 A;  5ENG A;  4AYC B;  5KH3 A;  4QC1 A;  4ALH A;  4XY8 A;  4Y03 A;  1WEU A;  3HCT A;  2Y1N A;  2L0B A;  5FH7 A;  4N4G A;  4OGI A;  4NYV A;  5IID A;  4BBQ A;  5F5Z A;  2WP2 A;  3U5M A;  4A9J A;  4CUT A;  4NS5 A;  2F42 A;  4BW2 A;  5CZG A;  4FIP A;  2YUC A;  4NYW A;  4YAD A;  3DPL R;  5DW1 A;  2R10 A;  4XUA A;  5H1T A;  1FBV A;  2ECW A;  4A49 A;  5AD2 A;  3S92 A;  1WIL A;  1T1H A;  4LK9 A;  4QSP A;  2H0D B;  1MM3 A;  4UP0 A;  4IR6 A;  5FDZ A;  4YYK A;  5HFQ A;  4AKN A;  4TT2 A;  2JMD A;  4UYG A;  5FE2 A;  2MIQ A;  5D1K B;  2CKL B;  5FE8 A;  1VYX A;  4QUT A;  2VJF A;  4O7A A;  5FBX A;  4QR3 A;  4TT4 A;  1CHC A;  3O70 A;  2IDA A;  1HYJ A;  5D1L B;  3C6W A;  4IC2 A;  4NR5 A;  5I88 A;  5DLX A;  1WGM A;  4C66 A;  1DVP A;  2YHO A;  4FK5 A;  1F68 A;  3M62 A;  4GB0 A;  5C8G A;  1F62 A;  5CQ3 A;  5CQ7 A;  5CUE A;  1MM2 A;  1WEW A;  5TDW A;  3RPG C;  5FE7 A;  5CUA A;  2DVR A;  4L58 A;  5JWM A;  4YC9 A;  2JRJ A;  3HCS A;  2CSZ A;  4MEN A;  5TCM A;  4TU6 A;  3FL2 A;  3NXB A;  1K2F A;  5FE5 A;  2RI7 A;  5AMF A;  5FE0 A;  2Y1M A;  3DQV R;  2L75 A;  2KWO A;  5HQ7 A;  5DX4 A;  1N87 A;  5ENJ A;  4O72 A;  4MSX A;  2YW5 A;  4HXN A;  4QSQ A;  2LGG A;  4YYM A;  3IU5 A;  2LQ6 A;  4Z93 A;  5KHM A;  5CQ4 A;  5D3R A;  2Y43 A;  3LQJ A;  5ENC A;  5DW2 A;  4J1P A;  5D24 A;  2OO1 A;  4YYN A;  3UVX A;  4GND A;  3RPG B;  4UYE A;  4LLB A;  5D3P A;  4GNG A;  4TQN A;  5FB0 A;  4A9K A;  5AD3 A;  5FH8 A;  2KR4 A;  4NUE A;  3U5P A;  1VD4 A;  4XYA A;  1ZBD B;  3ZVY A;  4KV4 A;  2M85 A;  4Z6I A;  1WFK A;  2M3H A;  4RVR A;  5LJ2 A;  2K4D A;  5F25 A;  5HM0 A;  5I86 A;  5D25 A;  3UVY A;  5ACY A;  2YEL A;  2YSM A;  3O34 A;  5L98 A;  4HXS A;  3UVD A;  2YEM A;  5EP7 A;  1V87 A;  5I29 A;  3D7C A;  4QSR A;  4UIX A;  5F3A A;  5ENB A;  2FUI A;  2YYR A;  5G05 B;  4O78 A;  4O76 A;  4QF3 A;  5EPB A;  3SOW A;  2I7K A;  5LCW B;  4QSS A;  2F6J A;  2K17 A;  5EIC A;  2XB1 A;  2OSS A;  5FFY A;  5F60 A;  2ECG A;  2KGG A;  2YQD A;  2MA5 A;  3N9M A;  3L1X A;  5D3S A;  4MEO A;  3O36 A;  4UIT A;  2E7N A;  5CPE A;  4NQN A;  2YT5 A;  1JM4 B;  4QBM A;  4YH4 A;  4QF2 A;  4J0S A;  4NRB A;  2ECJ A;  5EPS A;  3L1Z B;  1WEO A;  2PUY A;  2XEU A;  3SVH A;  2DVQ A;  4WZ2 A;  4DON A;  5HQ5 A;  2LGV A;  5D1M B;  5DYX A;  3ZNI A;  4LJN A;  3EB5 A;  2DAT A;  2G43 A;  5F61 A;  3G0J A;  5EI4 A;  3HME A;  4NYX A;  5L8U A;  2WP1 A;  5FE6 A;  2L5U A;  2YYN A;  5EK9 A;  4XI1 A;  2YHN A;  4AYC A;  2L84 A;  5CQ6 A;  2BAY A;  2MT5 A;  5TDR A;  5JG6 A;  4MR4 A;  2DKW A;  4TZ8 A;  4R2Y A;  4NXJ A;  4LDF A;  5C11 A;  5F62 A;  5ENI A;  5EQ1 A;  1HYI A;  5EWC A;  2D9E A;  2AN6 A;  5J3X A;  4NR8 A;  3ONI A;  5EVA A;  4YY4 A;  5F36 A;  5KU3 A;  3P1D A;  4MR6 A;  3G0L A;  4QZS A;  4HXM A;  4MR3 A;  4UIZ A;  5CGP A;  5CTL A;  2E6S A;  5FG4 A;  3PUQ A;  3MB3 A;  5DKH A;  5F63 A;  4BHW A;  2M1R A;  2R0Y A;  2F6N A;  5H85 A;  5F1L A;  4HBY A;  2MJV B;  5C13 A;  5CUC A;  4QNS A;  3ZTG A;  5DYA A;  3N9L A;  4GNE A;  4NR4 A;  3MB4 A;  3P1C A;  4X2I A;  4YAX A;  1G25 A;  3KQI A;  4QST A;  5TBN A;  5FE4 A;  2RNX A;  4FJC A;  4A9H A;  3U5L A;  4IR5 A;  4S3O B;  3IU6 A;  2DVV A;  2E3K A;  2DX8 A;  2YU4 A;  1JOC A;  5FH6 A;  1WIM A;  5CRZ A;  3IHP A;  4UI9 B;  5FE3 A;  5I80 A;  5LVR A;  3M63 A;  4IOR A;  4YY6 A;  3SHB A;  4HXO A;  4V3L C;  5ENH A;  2CKL A;  5A5N A;  2YRE A;  5DKC A;  5DLZ A;  4I7D A;  1EQF A;  4QYL A;  5KTW A;  4IOQ A;  4PPE A;  5COI A;  5DFC A;  5EGU A;  4AUQ B;  4CA1 A;  3C5K A;  5F1H A;  5B77 A;  5LVQ A;  5LUU A;  5DKD A;  4YYI A;  1FP0 A;  3O35 A;  2L5E A;  5C85 A;  1Z6U A;  4A9M A;  5D7X A;  5EA1 A;  4QEU A;  4P5O B;  1X0J A;  5CUG A;  5E3G A;  5E3D A;  4QUU A;  4A9I A;  3SOU A;  2KIZ A;  2ECI A;  5A81 A;  5II2 A;  3NG2 A;  3T7L A;  4YK0 A;  3LXJ A;  4PCE A;  2ECT A;  2KTB B;  4A9L A;  2KRE A;  2H60 A;  3P1F A;  5D3T A;  5EPR A;  4IOO A;  4Z1Q A;  4KV1 A;  4WA6 A;  5I89 A;  5A85 A;  4N4H A;  5EWW A;  5L97 A;  5KTX A;  5HQ6 A;  2KYU A;  2VPG A;  5B76 A;  5DFD A;  4O64 A;  5G0F A;  2C2L A;  2NXB A;  4IR4 A;  4TTE A;  4IC3 A;  4V3K C;  1JM7 B;  4QR4 A;  5II1 A;  4A9N A;  2RSD A;  5CQA A;  4N4I A;  4HXK A;  5A5Q A;  1WEV A;  1WEP A;  3JVL A;  4YYG A;  5TB6 A;  4NQM A;  5IGL A;  2E6R A;  5DIN A;  4WHU A;  5A7C A;  3O37 A;  1WEN A;  3SOX A;  4PKL A;  3U5O A;  1VFY A;  3HMH A;  1Z60 A;  5HRV A;  4QSU A;  4YYJ A;  4WZ0 A;  5FFV A;  5ENF A;  2YQL A;  4UIY A;  2RS9 B;  4OGJ A;  2VJE B;  2LGL A;  5HFR A;  3UV5 A;  4GPJ A;  4YAB A;  1N72 A;  2LRI C;  4NR7 A;  4A9E A;  2MD8 C;  4QYD A;  5KTU A;  3VK6 A;  5FER A;  1E4U A;  4NR9 A;  3GG3 A;  2KFT A;  5DFB A;  4A9F A;  2FUU A;  4KCX A;  3KNV A;  4LC2 A;  5CFW A;  4YYH A;  4CL9 A;  2JMJ A;  2LDR A;  4O7E A;  4YBM A;  4PY6 A;  5A83 A;  5AIT A;  1RMD A;  5I7Y A;  1BOR A;  4R8P K;  3HTK C;  2LSP B;  2I50 A;  2C2V S;  2LXH C;  2RFJ A;  5CRM A;  5I7X A;  4TKP B;  5CY9 A;  2KU3 A;  3U5J A;  4X3G A;  4ZDT A;  2D8S A;  2UZG A;  5CQ5 A;  2VPD A;  3DWY A;  5FE9 A;  2LGK A;  3FKM X;  2E7O A;  1XWH A;  1WUM A;  4NRA A;  2L80 A;  4Q6F A;  3N9P A;  4O75 A;  4UIV A;  3ZYU A;  4HXR A;  3PUR A;  1WEQ A;  5E9I A;  2OXQ C;  2LXP C;  2CT2 A;  4LZ2 A;  5EWH A;  4TT6 A;  3MUK A;  2L85 A;  2K1J A;  4O74 A;  3ASL A;  4XUB A;  4GNF A;  3LQH A;  4UYD A;  5LJ0 A;  4LZR A;  4WIV A;  5AME A;  4WZ3 B;  2LN0 A;  2YEK A;  2KGI A;  4LYW A;  4QEW A;  2EOD A;  3DAI A;  5CUB A;  3N9Q A;  4QSV A;  2VPE A;  3UW9 A;  1E6I A;  5HEM A;  2VNF A;  5E7D A;  2G4A A;  4ZUX U;  2OUO A;  5B78 A;  1IYM A;  2D82 A;  4UYF A;  5G4R A;  3RCW A;  1WEE A;  2R0V A;  1LDK C;  1WEM A;  1X4I A;  5D3H A;  4F3I A;  5TRB A;  3MXF A;  5EWV A;  1WES A;  4N3W A;  2ECN A;  3SVG A;  3MHH A;  5FG5 A;  4B7Y C;  4A4B A;  3LJW A;  5BT3 A;  3ZVZ B;  4MEQ A;  5D0C A;  5D3J A;  4O77 A;  5I40 A;  5DYC A;  2EGP A;  2VPB A;  4NUD A;  5C7N A;  4F52 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...