3O37A

Crystal structure of trim24 phd-bromo complexed with h3(1-10)k4 peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
182
structure length
175
Chain Sequence
b'NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 51
structure length 175
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o37A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o37A01
5FH6A 3PHDA 3LRQA 3SOWA 4ALHA 5DX4A 5EV9A 4UYGA 5EA1A 5TBNA 5FE1A 4TYLA 2MIQA 2NAAA 3P1EA 2RNYA 5FE2A 2EODA 4O71A 2OSSA 3ONIA 4QSPA 4Y03A 5D25A 1Z6UA 4NYVA 4LLBA 4YYNA 5CUCA 3FKMX 4OGJA 4N4FA 4NYXA 3RTRB 5LKUA 2DVQA 2OO1A 4QB3A 5DKHA 5ETBA 3DAIA 5CRZA 4MR6A 5FG5A 5HLSA 2RNWA 4IOOA 5CQ6A 4N4IA 4XYAA 5TABA 5EP7A 5H1TA 5JG6A 5IBNA 2Y43A 4QR4A 4UIZA 5D3RA 5ENJA 4ZQLA 5I86A 5HENA 3O70A 5HQ6A 5LKZA 4WZ0A 4NR4A 5EVAA 5EWDA 1WEMA 4NQNA 2VJFB 2YU4A 5A5SA 3HTKC 3KV5A 5C87A 5AD2A 1Z2QA 4UP5A 4AKNA 5D1MB 4UIXA 2YT5A 4HXSA 2YEKA 3I3JA 5B8DA 2WP1A 4WHUA 2M6MA 4J1PA 4C67A 1JM7B 3D7CA 4MR4A 2VP7A 4NRBA 4MVTA 5AIUA 5FG4A 1WFKA 5DKAA 5HM0A 5H1VA 4QSSA 4IC2A 2AN6A 5TRBA 2K1JA 1Z60A 2L43A 4NR5A 3ZYQA 4O7EA 5EGUA 5E9YA 2FUIA 4YYGA 4N4GA 5DYAA 4BHWA 1WE9A 5DLXA 4P5OB 4HBWA 4S3OC 2CSZA 4CFLA 3KQIA 2DKWA 4YYKA 4IORA 5E3GA 5B79A 4LJNA 5KO4A 4NR6A 2YYRA 4QF2A 5J3XA 4R7EA 4V3LC 4TT4A 2UZGA 4QY4A 3UVDA 5D3SA 3FL2A 4IR5A 4YH4A 4QSRA 4ZC9A 5E0RA 5HELA 3JVJA 3N9LA 2KWNA 3AADA 3L11A 3DWYA 3U5MA 5KHMA 4A9OA 5JI8A 4Q6FA 5H85A 2I50A 3MULA 5HFQA 4YY4A 5K29A 3SVGA 5ENBA 4O77A 4QYDA 5L8TA 5A7CA 2KGGA 2VPGA 4GNGA 5IGKA 3MXFA 2YHOA 2LXPC 5DFDA 4I7BA 4QSVA 5G05B 5A81A 1K2FA 3PUQA 4QSXA 5I29A 2G43A 2VNFA 3HMFA 2YEMA 4CA1A 4L58A 4LKAA 3Q2FA 5I1QA 4O7AA 4XY9A 5E9IA 5EPSA 3UV4A 2MT5A 5I7XA 5E9KA 5D3NA 3ZYUA 2D8SA 4ZW1A 4UP0A 4UITA 5HRXA 5D1KB 1WENA 5IGNA 5COIA 4HXNA 2CT2A 2HDPA 4FO9A 2JRJA 4NR8A 5ETDA 2MNYA 4N3WA 4QR3A 2YW8A 5FE7A 4BW4A 5D26A 4QF3A 5LJ1A 5CUBA 4O78A 5E3DA 4LZSA 4A9LA 4CURA 4UYHA 5CPEA 5A5OA 2OXQC 1G25A 1WIMA 3ASLA 5FBXA 2L0BA 4HBXA 2LDRA 5CRMA 5FERA 5EPBA 4A9KA 1X4UA 1F62A 5D1LB 5F3AA 4AYCA 4LADB 4YYDA 1MM2A 2LV9A 3N9PA 4YYMA 5C4QA 1V87A 4BW1A 4QZSA 5FFVA 2CKLA 5D24A 4PCIA 4Z6IA 2JMJA 4YY6A 5B75A 5F25A 4TT6A 3N9QA 1JOCA 4FJCA 3NG2A 4B7YC 2NXBA 2YELA 4A9IA 4I7DA 4UYFB 3O35A 2G6QA 4TU4A 5E9LA 4WZ2A 2QICA 4QUTA 5TB6A 3UVXA 2KR4A 5LJ2A 3C6WA 4X2IA 5LVQA 5A5NA 3SHBA 3P1DA 4YC9A 5AMEA 3KNVA 4QNSA 5HEMA 3UW9A 1WUGA 3HCSA 2DX8A 2XEUA 3ZPVE 2GRCA 4NR9A 4CUPA 4YK0A 4TS8A 3GL6A 5E9VA 4XI1A 2F6NA 5FH8A 5DFCA 5A5PA 3UV2A 4DONA 4A4BA 4YYIA 5IG6A 2E6SA 4TT2A 1X0JA 5F2PA 5EISA 2YQMA 4YAXA 3QZVA 2XB1A 2YSMA 4WA6A 4TZ8A 5TCMA 4XUBA 2Y1MA 5FE5A 2L5UA 1N72A 3I2DA 4NN2A 4A9EA 2L85A 5CUGA 4QC1A 5FE8A 4BW3A 2EA6A 2VPEA 2HYED 5KH9A 5II1A 4UIVA 5ENIA 4CUUA 5E9MA 2KIZA 4AYCB 5CP5A 2JMIA 4YBMA 5F60A 4LYWA 4YYHA 2CKLB 4LZRA 4O76A 5FFWA 5L96A 5C89A 2D82A 3MB3A 4NRAA 5I88A 4V3KC 3T7LA 4A9MA 2L84A 5I40A 4QSUA 5KTWA 2I8NA 2PUYA 3SOUA 4QSQA 2C2VS 5HFRA 1WEWA 4IR4A 5I89A 2MJVB 5CU8A 3ZPV1 1IYMA 5CY9A 5D7XA 2YURA 3VK6A 2R0SA 5FG6A 2K4DA 4CUTA 4Q0OA 5E74A 5ACYA 4LYSA 5CQTA 3QZTA 5CZGA 1E6IA 4A9NA 4CLBA 5A82A 2EGPA 2LRIC 5F1LA 4QSTA 2YUCA 4FIPA 5A83A 4MEQA 3LJWA 5LJ0A 4LRGA 3EB6A 4S3OB 4QSWA 2K16A 2H60A 4IOQA 4O7FA 5IIDA 3O37A 4IR3A 2ECNA 1FP0A 5DINA 4F3IA 5C13A 2KE1A 1JM4B 5ENGA 2F6JA 1X4JA 1RMDA 3NXBA 4MEOA 4MEPA 3AQAA 3O7AA 5II2A 3GG3A 5EK9A 5CTLA 2MA6A 5FE9A 4TKPB 3N9NA 4HBYA 4QUUA 4CUSA 2LGVA 5ENCA 4O7BA 4HBVA 4NQMA 3JVKA 4CL9A 4ZDTA 4J3IA 1X4IA 4YBSA 3IU6A 5C8GA 5FDZA 5FB1A 5G04B 4NUDA 5DLZA 4J0SA 3LQIA 4E96A 1FBVA 4MSXA 5DFBA 5BT3A 4F52B 4CCGX 2I7KA 4L7XA 4GNEA 4AVXA 4QEWA 3LQHA 3L1ZB 5B78A 5H1UA 4MR3A 4CFKA 5TDRA 5F63A 5KTXA 4C66A 4R8PK 5FE4A 4CUQA 2MUMA 2KREA 2LXHC 5DKDA 5A5RA 2ECVA 4HXLA 4WHWA 1EQFA 5LKXA 3MB4A 4A0CD 4XY8A 2YHNA 5HRWA 1WESA 5I83A 3P1CA 3P5OA 5ENEA 5FFYA 2ECWA 4LR6A 2R0YA 3MHHA 1BORA 4HXKA 5D3LA 5A5QA 5D0CA 5CGPA 5EWWA 5EU1A 5E7DA 5EWHA 4Z6HA 4QC3A 5CUAA 5EI4A 5C85A 5DW2A 2RNXA 2ECJA 2LSPB 1DVPA 4O7CA 2H0DA 1WEUA 3DQVR 2G4AA 1LDKC 3PURA 2FUUA 4GNDA 5HQ5A 5I80A 4RVRA 2KYUA 5HCLA 2KTBB 1VD4A 2L80A 1WEQA 5L8UA 2WP2A 3UVWA 2ECTA 5EPRA 4A4CA 4LZ2A 2M85A 3P1FA 1WEOA 2DWWA 2R0VA 4KCXA 4W4UA 4QR5A 4HXRA 4NR7A 2MNZA 2VPDA 5LCWB 5TDWA 4O75A 3ZVZB 3GV4A 2E3KA 4MR5A 5A85A 4TQNA 5L99A 2YREA 4UYEA 5CQ8A 3UVYA 2ECGA 4QBMA 2KWKA 3O36A 3U5KA 5DYXA 3M63A 3Q2EA 5DW1A 3K2JA 2ECIA 4QYLA 4Q0NA 2E7OA 2CSYA 3V43A 3N9OA 5CQAA 4NUCA 1WEEA 3N9MA 3ZVYA 4AUQB 3JVLA 4ALGA 5D3PA 3U5NA 3M99A 2QIZA 4ZUXU 3MUKA 2LGLA 5C11A 1WGMA 3HMEA 2JMDA 2M1RA 4WZ3B 2MA5A 2BAYA 4HXPA 5J0DA 5DBMA 2MD7B 4TTEA 2LGKA 2D9EA 4GB0A 3O33A 1WEPA 4PKLA 5DYUA 2H0DB 4BBQA 5CQ5A 4PS5A 2KWOA 2K17A 5ENFA 4A9FA 5CFWA 5FE3A 3DPLR 4PPEA 4BJXA 4OUFA 2L75A 2LGGA 4YYJA 3JVMA 5AD3A 5CQ3A 2YQDA 2DVVA 3U5OA 3ZNIA 1E4UA 2L5EA 4C9ZA 2R10A 3LQJA 4NUEA 4KV1A 2F42A 4UI9B 3HMHA 4HXMA 4O64A 3ZTGA 2YSJA 2YYNA 4LYIA 5EWVA 4Z93A 5JWMA 5KH3A 2RS9B 4UIWA 1WILA 1WEVA 5DY7A 2DVSA 4FLPA 2QJ0A 4X3GA 4LDFA 3RPGC 5ENHA 4HXOA 5EYAF 4IC3A 5F5ZA 1T1HA 5FEYA 4J0RA 5BT4A 2MD8C 5FE6A 1VFYA 5E73A 5CUEA 5EQ1A 5B76A 3RCWA 5BT5A 4QEUA 5G4RA 5IGMA 4TZ2A 3EB5A 2YDWA 4PY6A 3TLPA 5CQ4A 4Z1QA 2LQ6A 2VJEA 5H9MA 4BW2A 2RSDA 4UYDA 4UIYA 5KH7A 5CUDA 4O70A 4O72A 4YBTA 3SVHA 4GNFA 5D3HA 4NRCA 5HRVA 1CHCA 1HYJA 3G0LA 2VPBA 5AITA 3QZSA 3SVFA 2PNXA 4LK9A 4QEVA 4YH3A 2Y1NA 3MHSA 3RPGB 5C7NA 3IU5A 5EM3A 3C5KA 1JSPB 4GPJA 4MENA 5DYCA 1ZBDB 1ZS5A 2C2LA 4A49A 5DKCA 2OUOA 4A9HA 5AMFA 5F62A 5F61A 5I7YA 5KU3A 1F68A 1WUMA 3S91A 3UV5A 4LC2A 4O74A 5EWCA 5L98A 1MM3A 2IDAA 4R2YA 5G0FA 2DATA 1HYIA 5EICA 2DVRA 4IR6A 5F1HA 4A9JA 4KV4A 2G45A 4N4HA 5KTUA 2KFTA 3U5LA 4AP4A 3U5PA 5FB0A 2FSAA 3O34A 2YQLA 4UYFA 5LUUA 2E7NA 5LVRA 4NYWA 4NXJA 5I3LA 5LKTA 5G4SA 3S92A 5IGLA 4PTBA 3LXJA 4WIVA 4XUAA 1N87A 2KU3A 2LN0A 2N9GA 2E6RA 2RI7A 4NS5A 4Z1SA 3G0JA 5CQ7A 5FE0A 3HCUA 3M62A 3T6RA 4YADA 2M3HA 2VJFA 5HQ7A 4UIUA 4YABA 4FK5A 3U5JA 2KGIA 3MQMA 3KV6A 5B77A 4I7CA 2RO1A 5CS8A 2VJEB 4OGIA 4PCEA 4YATA 5D3TA 5HJCA 1LDJB 2KWJA 3L1XA 1U6GB 3SOXA 2RFJA 1VYXA 1XWHA 5L97A 2ZETC 5FH7A 1JM7A 3IHPA 4TU6A 2YW5A 4B86C 5F36A 5D3JA 3HCTA
chains in the Genus database with same CATH superfamily
5FH6A 3PHDA 3LRQA 3SOWA 4ALHA 5DX4A 5EV9A 4UYGA 5EA1A 5TBNA 5FE1A 4TYLA 2MIQA 2NAAA 3P1EA 2RNYA 5FE2A 2EODA 4O71A 2OSSA 3ONIA 4QSPA 4Y03A 5D25A 1Z6UA 2LAUA 3MDBC 4NYVA 4LLBA 4YYNA 5CUCA 3FKMX 4QQ4A 4OGJA 4N4FA 4NYXA 3RTRB 5LKUA 2DVQA 2OO1A 4QB3A 5DKHA 5ETBA 3DAIA 5CRZA 4MR6A 5FG5A 5HLSA 2RNWA 4IOOA 5CQ6A 4N4IA 4XYAA 5TABA 5EP7A 5H1TA 5JG6A 5IBNA 2Y43A 4QR4A 4UIZA 5D3RA 5ENJA 4ZQLA 5I86A 5HENA 3O70A 5HQ6A 5LKZA 4WZ0A 4NR4A 5EVAA 5EWDA 1WEMA 4NQNA 2VJFB 2YU4A 5A5SA 3HTKC 3KV5A 5C87A 5AD2A 1Z2QA 4UP5A 4AKNA 5D1MB 4UIXA 2YT5A 4HXSA 2YEKA 3I3JA 4F1PA 5B8DA 2WP1A 4WHUA 2M6MA 4J1PA 4C67A 1JM7B 3D7CA 4MR4A 2VP7A 5SVXA 4NRBA 4MVTA 5AIUA 5FG4A 1WFKA 5DKAA 5HM0A 3M7KA 5H1VA 4AI6A 4QSSA 4IC2A 2AN6A 5TRBA 2K1JA 1Z60A 2L43A 4NR5A 3ZYQA 4O7EA 5EGUA 5E9YA 2FUIA 4YYGA 4N4GA 5DYAA 4BHWA 1WE9A 5DLXA 2XP0A 4P5OB 4HBWA 4S3OC 2CSZA 2KKXA 4CFLA 3KQIA 2FD4A 2DKWA 3LJUX 4YYKA 4IORA 5E3GA 5B79A 4LJNA 5KO4A 4NR6A 2YYRA 4QF2A 5J3XA 4R7EA 4V3LC 4TT4A 2UZGA 4QY4A 3UVDA 5D3SA 3FL2A 4IR5A 4YH4A 4QSRA 4OGCA 3VKGA 4ZC9A 5E0RA 5HELA 3JVJA 3N9LA 2KWNA 3DDTA 3AADA 3L11A 3DWYA 3U5MA 5KHMA 4A9OA 5JI8A 4Q6FA 5H85A 2I50A 3MULA 2CONA 5HFQA 4YY4A 5K29A 3SVGA 5ENBA 4O77A 4QYDA 5L8TA 2JM3A 5A7CA 2KGGA 2EXUA 2VPGA 4GNGA 5IGKA 3MXFA 2YHOA 2LXPC 5DFDA 4I7BA 4QSVA 5G05B 5A81A 1K2FA 3PUQA 4QSXA 5I29A 2G43A 2VNFA 3HMFA 2YEMA 4CA1A 4L58A 4LKAA 3Q2FA 5I1QA 4O7AA 4XY9A 5E9IA 5EPSA 3UV4A 2MT5A 5I7XA 5E9KA 5D3NA 3ZYUA 2D8SA 2JUNA 4ZW1A 3H7HA 4UITA 5HRXA 4UP0A 5D1KB 1WENA 5IGNA 2XOYA 2EGMA 5COIA 4HXNA 2CT2A 2HDPA 4FO9A 2JRJA 4NR8A 5ETDA 2MNYA 4N3WA 4QR3A 2YW8A 5FE7A 4BW4A 5D26A 4QF3A 5SVYA 5LJ1A 5CUBA 4O78A 5E3DA 4LZSA 4A9LA 4CURA 4UYHA 5CPEA 5A5OA 2OXQC 1G25A 1WIMA 3D1BA 3ASLA 5FBXA 2L0BA 4HBXA 2LDRA 5CRMA 5FERA 5EPBA 4A9KA 1X4UA 1F62A 5D1LB 5F3AA 4AYCA 4LADB 4YYDA 1MM2A 2LV9A 3N9PA 4YYMA 5C4QA 1V87A 4BW1A 4QZSA 5FFVA 2CKLA 5D24A 4PCIA 4Z6IA 2JMJA 3SUBA 4YY6A 5B75A 5F25A 4TT6A 3N9QA 1JOCA 4FJCA 4H9DA 3NG2A 4B7YC 2NXBA 2YELA 4A9IA 4I7DA 4UYFB 3O35A 2G6QA 4TU4A 5E9LA 2M13A 4WZ2A 2QICA 3PLWA 4QUTA 5TB6A 3UVXA 2KR4A 5LJ2A 3C6WA 4X2IA 5LVQA 5A5NA 3SHBA 3P1DA 4YC9A 5AMEA 3KNVA 4QNSA 5HEMA 3UW9A 1WUGA 3HCSA 2DX8A 2XEUA 3ZPVE 2GRCA 4NR9A 4CUPA 4Z0OA 4YK0A 4TS8A 3GL6A 5E9VA 4XI1A 2F6NA 5FH8A 5DFCA 5A5PA 3UV2A 4DONA 4A4BA 4YYIA 5IG6A 2E6SA 4TT2A 1X0JA 5F2PA 5EISA 2YQMA 4YAXA 3QZVA 2KKYA 2XB1A 2YSMA 4WA6A 4TZ8A 5TCMA 4XUBA 2Y1MA 5FE5A 2L5UA 1N72A 3I2DA 4NN2A 4A9EA 2L85A 5CUGA 4QC1A 5FE8A 4BW3A 2EA6A 2VPEA 2HYED 5KH9A 5II1A 4UIVA 5ENIA 4CUUA 5E9MA 2KIZA 4AYCB 3LDYA 5CP5A 2JMIA 4YBMA 5F60A 2MKEA 4LYWA 4YYHA 2CKLB 4LZRA 4O76A 5FFWA 2XOZA 5L96A 5C89A 2D82A 3MB3A 4NRAA 5I88A 4V3KC 3T7LA 4A9MA 2L84A 5I40A 4QSUA 5KTWA 1DCQA 2I8NA 2PUYA 3SOUA 4QSQA 2DSMA 2C2VS 5HFRA 1WEWA 4IR4A 5I89A 2MJVB 5CU8A 3DWDA 3ZPV1 5CY9A 5D7XA 1IYMA 2YURA 3VK6A 2R0SA 5FG6A 2K4DA 4CUTA 4Q0OA 5E74A 5ACYA 4LYSA 5CQTA 3QZTA 5CZGA 1E6IA 4A9NA 4CLBA 5A82A 2EGPA 2YVRA 2LRIC 3Q1DA 5F1LA 4QSTA 4AKIA 2YUCA 3JUEA 4FIPA 5A83A 4MEQA 2L7PA 3LJWA 5LJ0A 4LRGA 3EB6A 4S3OB 4QSWA 2K16A 1MBMA 2H60A 4IOQA 4O7FA 5IIDA 3O37A 3O47A 4IR3A 1PUOA 1FP0A 2ECNA 5DINA 4F3IA 5C13A 2KE1A 1JM4B 5ENGA 2F6JA 1X4JA 1RMDA 3FAOA 3NXBA 4MEOA 4MEPA 3AQAA 3O7AA 5II2A 3GG3A 5EK9A 5CTLA 2MA6A 5FE9A 4TKPB 3N9NA 4HBYA 4QUUA 4CUSA 2LGVA 5ENCA 4O7BA 4HBVA 4NQMA 3JVKA 4CL9A 4ZDTA 4J3IA 1X4IA 4YBSA 3IU6A 5C8GA 5FDZA 5FB1A 5G04B 4NUDA 5DLZA 4J0SA 3LQIA 4E96A 1FBVA 4MSXA 5DFBA 5BT3A 4F52B 4CCGX 2I7KA 4L7XA 4GNEA 4AVXA 4QEWA 3LQHA 3L1ZB 5B78A 5H1UA 4MR3A 4CFKA 5TDRA 2OWAA 5F63A 5KTXA 4C66A 4R8PK 5FE4A 4CUQA 2MUMA 2KREA 2LXHC 5DKDA 3VKHA 5A5RA 2ECVA 4HXLA 4WHWA 1EQFA 5LKXA 3MB4A 4A0CD 4XY8A 2YHNA 5HRWA 1WESA 5I83A 3P1CA 3P5OA 5ENEA 5FFYA 2ECWA 4LR6A 2R0YA 3MHHA 1BORA 4HXKA 5D3LA 5A5QA 5D0CA 5CGPA 5EWWA 5EU1A 5E7DA 5EWHA 4Z6HA 4QC3A 5CUAA 5EI4A 5C85A 5DW2A 2RNXA 2ECJA 2LSPB 1DVPA 4O7CA 2H0DA 1WEUA 3DQVR 2G4AA 1LDKC 1ZKRA 3PURA 2FUUA 4GNDA 5HQ5A 5K3QA 5I80A 4RVRA 2KYUA 5HCLA 2KTBB 1VD4A 2E61A 2L80A 1WEQA 5L8UA 5SVIA 2WP2A 3UVWA 2ECTA 3LVRE 5EPRA 4A4CA 4LZ2A 2M85A 3P1FA 1WEOA 2DWWA 2R0VA 4KCXA 4W4UA 4QR5A 4HXRA 4NR7A 2MNZA 2VPDA 5LCWB 5TDWA 4O75A 3ZVZB 3GV4A 2E3KA 4MR5A 5A85A 4TQNA 5L99A 2YREA 4UYEA 5CQ8A 3UVYA 2ECGA 4QBMA 2KWKA 3O36A 3D1DA 3U5KA 5DYXA 3M63A 3Q2EA 5DW1A 3K2JA 2ECIA 4QYLA 4Q0NA 2E7OA 2CSYA 3V43A 3N9OA 5CQAA 4NUCA 1WEEA 2B0OE 3N9MA 3ZVYA 4AUQB 3JVLA 4ALGA 5D3PA 3U5NA 3M99A 2QIZA 4ZUXU 3MUKA 2LGLA 5C11A 1WGMA 3HMEA 2JMDA 2M1RA 4WZ3B 3E2DA 2MA5A 2BAYA 4HXPA 5J0DA 5DBMA 2MD7B 4TTEA 2LGKA 2D9EA 4AKGA 3O33A 4GB0A 1WEPA 4PKLA 4OGEA 5DYUA 2H0DB 4BBQA 5CQ5A 4PS5A 2KWOA 2K17A 5ENFA 3FEHA 4A9FA 5CFWA 5FE3A 3DPLR 4PPEA 2CSVA 5SVIB 4BJXA 4OUFA 2L75A 2LGGA 4YYJA 3JVMA 5AD3A 5CQ3A 2YQDA 2P57A 2DVVA 3U5OA 4O62A 3ZNIA 2L5EA 1E4UA 4C9ZA 2R10A 3LQJA 4NUEA 4KV1A 2F42A 4UI9B 3HMHA 4HXMA 4O64A 3ZTGA 2YSJA 2YYNA 4LYIA 5EWVA 4Z93A 5JWMA 5KH3A 2RS9B 4UIWA 1WILA 2CRWA 1WEVA 5DY7A 2DVSA 4FLPA 2QJ0A 4X3GA 2IQJA 2RR4A 4LDFA 3RPGC 5ENHA 4HXOA 5EYAF 4IC3A 5F5ZA 1T1HA 5FEYA 4J0RA 2DJAA 5BT4A 2MD8C 5FE6A 3FANA 1VFYA 5E73A 5CUEA 5EQ1A 3FJUB 5B76A 3RCWA 5BT5A 4QEUA 5G4RA 5IGMA 4TZ2A 3EB5A 2YDWA 4PY6A 3TLPA 2CRRA 5CQ4A 4Z1QA 2LQ6A 2VJEA 5H9MA 4BW2A 2RSDA 4UYDA 4UIYA 5KH7A 5CUDA 4O70A 4O72A 4YBTA 3SVHA 4GNFA 3T9KA 5D3HA 4NRCA 5HRVA 1CHCA 2FFWA 3G0LA 3ERRA 2VPBA 1HYJA 2EJNA 5AITA 3QZSA 3SVFA 2PNXA 4LK9A 4QEVA 4YH3A 2Y1NA 3MHSA 3RPGB 5C7NA 3IU5A 5EM3A 3C5KA 1JSPB 4GPJA 4MENA 5DYCA 1ZBDB 1ZS5A 2C2LA 4A49A 5DKCA 2OUOA 4A9HA 5AMFA 5F62A 5F61A 5I7YA 5KU3A 1F68A 1WUMA 3S91A 3UV5A 4AKHA 4LC2A 4O74A 5EWCA 5L98A 1MM3A 2IDAA 4R2YA 5G0FA 2DATA 1HYIA 5EICA 2DVRA 4IR6A 5F1HA 4A9JA 4KV4A 2G45A 4N4HA 5KTUA 2KFTA 3U5LA 4AP4A 3U5PA 5FB0A 2FSAA 3O34A 2YQLA 3KDEC 4UYFA 5LUUA 2E7NA 5LVRA 4NYWA 4NXJA 5I3LA 5LKTA 5G4SA 3FM8C 3S92A 5IGLA 4PTBA 3LVQE 3LXJA 4WIVA 4XUAA 1N87A 2KU3A 2LN0A 2N9GA 2D8UA 2E6RA 2RI7A 4NS5A 4Z1SA 3G0JA 5CQ7A 5FE0A 3HCUA 3M62A 3T6RA 4YADA 2M3HA 2VJFA 5HQ7A 4UIUA 4YABA 4FK5A 3U5JA 2KGIA 3MQMA 2XOCA 3KV6A 5B77A 4I7CA 2RO1A 5CS8A 2VJEB 4OGIA 4PCEA 4YATA 5D3TA 5HJCA 1LDJB 2KWJA 3L1XA 1U6GB 3SOXA 2RFJA 1VYXA 4Z0RA 1XWHA 5L97A 2ZETC 5FH7A 1JM7A 3IHPA 4TU6A 2YW5A 4B86C 5F36A 5D3JA 3HCTA
chains in the Genus database with same CATH topology
5FH6A 3PHDA 3LRQA 3SOWA 4ALHA 5DX4A 5EV9A 4UYGA 5EA1A 5TBNA 5FE1A 4TYLA 2MIQA 2NAAA 3P1EA 2RNYA 5FE2A 2EODA 4O71A 2OSSA 3ONIA 4QSPA 4Y03A 5D25A 1Z6UA 4NYVA 4LLBA 4YYNA 5CUCA 3FKMX 4OGJA 4N4FA 4NYXA 3RTRB 5LKUA 2DVQA 2OO1A 4QB3A 5DKHA 5ETBA 3DAIA 5CRZA 4MR6A 5FG5A 5HLSA 2RNWA 4IOOA 5CQ6A 4N4IA 4XYAA 5TABA 5EP7A 5H1TA 5JG6A 5IBNA 2Y43A 4QR4A 4UIZA 5D3RA 5ENJA 4ZQLA 5I86A 5HENA 3O70A 5HQ6A 5LKZA 4WZ0A 4NR4A 5EVAA 5EWDA 1WEMA 4NQNA 2VJFB 2YU4A 5A5SA 3HTKC 3KV5A 5C87A 5AD2A 1Z2QA 4UP5A 4AKNA 5D1MB 4UIXA 2YT5A 4HXSA 2YEKA 3I3JA 5B8DA 2WP1A 4WHUA 2M6MA 4J1PA 4C67A 1JM7B 3D7CA 4MR4A 2VP7A 4NRBA 4MVTA 5AIUA 5FG4A 1WFKA 5DKAA 5HM0A 5H1VA 4QSSA 4IC2A 2AN6A 5TRBA 2K1JA 1Z60A 2L43A 4NR5A 3ZYQA 4O7EA 5EGUA 5E9YA 2FUIA 4YYGA 4N4GA 5DYAA 4BHWA 1WE9A 5DLXA 4P5OB 4HBWA 4S3OC 2CSZA 4CFLA 3KQIA 2DKWA 4YYKA 4IORA 5E3GA 5B79A 4LJNA 5KO4A 4NR6A 2YYRA 4QF2A 5J3XA 4R7EA 4V3LC 4TT4A 2UZGA 4QY4A 3UVDA 5D3SA 3FL2A 4IR5A 4YH4A 4QSRA 4ZC9A 5E0RA 5HELA 3JVJA 3N9LA 2KWNA 3AADA 3L11A 3DWYA 3U5MA 5KHMA 4A9OA 5JI8A 4Q6FA 5H85A 2I50A 3MULA 5HFQA 4YY4A 5K29A 3SVGA 5ENBA 4O77A 4QYDA 5L8TA 5A7CA 2KGGA 2VPGA 4GNGA 5IGKA 3MXFA 2YHOA 2LXPC 5DFDA 4I7BA 4QSVA 5G05B 5A81A 1K2FA 3PUQA 4QSXA 5I29A 2G43A 2VNFA 3HMFA 2YEMA 4CA1A 4L58A 4LKAA 3Q2FA 5I1QA 4O7AA 4XY9A 5E9IA 5EPSA 3UV4A 2MT5A 5I7XA 5E9KA 5D3NA 3ZYUA 2D8SA 4ZW1A 4UP0A 4UITA 5HRXA 5D1KB 1WENA 5IGNA 5COIA 4HXNA 2CT2A 2HDPA 4FO9A 2JRJA 4NR8A 5ETDA 2MNYA 4N3WA 4QR3A 2YW8A 5FE7A 4BW4A 5D26A 4QF3A 5LJ1A 5CUBA 4O78A 5E3DA 4LZSA 4A9LA 4CURA 4UYHA 5CPEA 5A5OA 2OXQC 1G25A 1WIMA 3ASLA 5FBXA 2L0BA 4HBXA 2LDRA 5CRMA 5FERA 5EPBA 4A9KA 1X4UA 1F62A 5D1LB 5F3AA 4AYCA 4LADB 4YYDA 1MM2A 2LV9A 3N9PA 4YYMA 5C4QA 1V87A 4BW1A 4QZSA 5FFVA 2CKLA 5D24A 4PCIA 4Z6IA 2JMJA 4YY6A 5B75A 5F25A 4TT6A 3N9QA 1JOCA 4FJCA 3NG2A 4B7YC 2NXBA 2YELA 4A9IA 4I7DA 4UYFB 3O35A 2G6QA 4TU4A 5E9LA 4WZ2A 2QICA 4QUTA 5TB6A 3UVXA 2KR4A 5LJ2A 3C6WA 4X2IA 5LVQA 5A5NA 3SHBA 3P1DA 4YC9A 5AMEA 3KNVA 4QNSA 5HEMA 3UW9A 1WUGA 3HCSA 2DX8A 2XEUA 3ZPVE 2GRCA 4NR9A 4CUPA 4YK0A 4TS8A 3GL6A 5E9VA 4XI1A 2F6NA 5FH8A 5DFCA 5A5PA 3UV2A 4DONA 4A4BA 4YYIA 5IG6A 2E6SA 4TT2A 1X0JA 5F2PA 5EISA 2YQMA 4YAXA 3QZVA 2XB1A 2YSMA 4WA6A 4TZ8A 5TCMA 4XUBA 2Y1MA 5FE5A 2L5UA 1N72A 3I2DA 4NN2A 4A9EA 2L85A 5CUGA 4QC1A 5FE8A 4BW3A 2EA6A 2VPEA 2HYED 5KH9A 5II1A 4UIVA 5ENIA 4CUUA 5E9MA 2KIZA 4AYCB 5CP5A 2JMIA 4YBMA 5F60A 4LYWA 4YYHA 2CKLB 4LZRA 4O76A 5FFWA 5L96A 5C89A 2D82A 3MB3A 4NRAA 5I88A 4V3KC 3T7LA 4A9MA 2L84A 5I40A 4QSUA 5KTWA 2I8NA 2PUYA 3SOUA 4QSQA 2C2VS 5HFRA 1WEWA 4IR4A 5I89A 2MJVB 5CU8A 3ZPV1 1IYMA 5CY9A 5D7XA 2YURA 3VK6A 2R0SA 5FG6A 2K4DA 4CUTA 4Q0OA 5E74A 5ACYA 4LYSA 5CQTA 3QZTA 5CZGA 1E6IA 4A9NA 4CLBA 5A82A 2EGPA 2LRIC 5F1LA 4QSTA 2YUCA 4FIPA 5A83A 4MEQA 3LJWA 5LJ0A 4LRGA 3EB6A 4S3OB 4QSWA 2K16A 2H60A 4IOQA 4O7FA 5IIDA 3O37A 4IR3A 2ECNA 1FP0A 5DINA 4F3IA 5C13A 2KE1A 1JM4B 5ENGA 2F6JA 1X4JA 1RMDA 3NXBA 4MEOA 4MEPA 3AQAA 3O7AA 5II2A 3GG3A 5EK9A 5CTLA 2MA6A 5FE9A 4TKPB 3N9NA 4HBYA 4QUUA 4CUSA 2LGVA 5ENCA 4O7BA 4HBVA 4NQMA 3JVKA 4CL9A 4ZDTA 4J3IA 1X4IA 4YBSA 3IU6A 5C8GA 5FDZA 5FB1A 5G04B 4NUDA 5DLZA 4J0SA 3LQIA 4E96A 1FBVA 4MSXA 5DFBA 5BT3A 4F52B 4CCGX 2I7KA 4L7XA 4GNEA 4AVXA 4QEWA 3LQHA 3L1ZB 5B78A 5H1UA 4MR3A 4CFKA 5TDRA 5F63A 5KTXA 4C66A 4R8PK 5FE4A 4CUQA 2MUMA 2KREA 2LXHC 5DKDA 5A5RA 2ECVA 4HXLA 4WHWA 1EQFA 5LKXA 3MB4A 4A0CD 4XY8A 2YHNA 5HRWA 1WESA 5I83A 3P1CA 3P5OA 5ENEA 5FFYA 2ECWA 4LR6A 2R0YA 3MHHA 1BORA 4HXKA 5D3LA 5A5QA 5D0CA 5CGPA 5EWWA 5EU1A 5E7DA 5EWHA 4Z6HA 4QC3A 5CUAA 5EI4A 5C85A 5DW2A 2RNXA 2ECJA 2LSPB 1DVPA 4O7CA 2H0DA 1WEUA 3DQVR 2G4AA 1LDKC 3PURA 2FUUA 4GNDA 5HQ5A 5I80A 4RVRA 2KYUA 5HCLA 2KTBB 1VD4A 2L80A 1WEQA 5L8UA 2WP2A 3UVWA 2ECTA 5EPRA 4A4CA 4LZ2A 2M85A 3P1FA 1WEOA 2DWWA 2R0VA 4KCXA 4W4UA 4QR5A 4HXRA 4NR7A 2MNZA 2VPDA 5LCWB 5TDWA 4O75A 3ZVZB 3GV4A 2E3KA 4MR5A 5A85A 4TQNA 5L99A 2YREA 4UYEA 5CQ8A 3UVYA 2ECGA 4QBMA 2KWKA 3O36A 3U5KA 5DYXA 3M63A 3Q2EA 5DW1A 3K2JA 2ECIA 4QYLA 4Q0NA 2E7OA 2CSYA 3V43A 3N9OA 5CQAA 4NUCA 1WEEA 3N9MA 3ZVYA 4AUQB 3JVLA 4ALGA 5D3PA 3U5NA 3M99A 2QIZA 4ZUXU 3MUKA 2LGLA 5C11A 1WGMA 3HMEA 2JMDA 2M1RA 4WZ3B 2MA5A 2BAYA 4HXPA 5J0DA 5DBMA 2MD7B 4TTEA 2LGKA 2D9EA 4GB0A 3O33A 1WEPA 4PKLA 5DYUA 2H0DB 4BBQA 5CQ5A 4PS5A 2KWOA 2K17A 5ENFA 4A9FA 5CFWA 5FE3A 3DPLR 4PPEA 4BJXA 4OUFA 2L75A 2LGGA 4YYJA 3JVMA 5AD3A 5CQ3A 2YQDA 2DVVA 3U5OA 3ZNIA 1E4UA 2L5EA 4C9ZA 2R10A 3LQJA 4NUEA 4KV1A 2F42A 4UI9B 3HMHA 4HXMA 4O64A 3ZTGA 2YSJA 2YYNA 4LYIA 5EWVA 4Z93A 5JWMA 5KH3A 2RS9B 4UIWA 1WILA 1WEVA 5DY7A 2DVSA 4FLPA 2QJ0A 4X3GA 4LDFA 3RPGC 5ENHA 4HXOA 5EYAF 4IC3A 5F5ZA 1T1HA 5FEYA 4J0RA 5BT4A 2MD8C 5FE6A 1VFYA 5E73A 5CUEA 5EQ1A 5B76A 3RCWA 5BT5A 4QEUA 5G4RA 5IGMA 4TZ2A 3EB5A 2YDWA 4PY6A 3TLPA 5CQ4A 4Z1QA 2LQ6A 2VJEA 5H9MA 4BW2A 2RSDA 4UYDA 4UIYA 5KH7A 5CUDA 4O70A 4O72A 4YBTA 3SVHA 4GNFA 5D3HA 4NRCA 5HRVA 1CHCA 1HYJA 3G0LA 2VPBA 5AITA 3QZSA 3SVFA 2PNXA 4LK9A 4QEVA 4YH3A 2Y1NA 3MHSA 3RPGB 5C7NA 3IU5A 5EM3A 3C5KA 1JSPB 4GPJA 4MENA 5DYCA 1ZBDB 1ZS5A 2C2LA 4A49A 5DKCA 2OUOA 4A9HA 5AMFA 5F62A 5F61A 5I7YA 5KU3A 1F68A 1WUMA 3S91A 3UV5A 4LC2A 4O74A 5EWCA 5L98A 1MM3A 2IDAA 4R2YA 5G0FA 2DATA 1HYIA 5EICA 2DVRA 4IR6A 5F1HA 4A9JA 4KV4A 2G45A 4N4HA 5KTUA 2KFTA 3U5LA 4AP4A 3U5PA 5FB0A 2FSAA 3O34A 2YQLA 4UYFA 5LUUA 2E7NA 5LVRA 4NYWA 4NXJA 5I3LA 5LKTA 5G4SA 3S92A 5IGLA 4PTBA 3LXJA 4WIVA 4XUAA 1N87A 2KU3A 2LN0A 2N9GA 2E6RA 2RI7A 4NS5A 4Z1SA 3G0JA 5CQ7A 5FE0A 3HCUA 3M62A 3T6RA 4YADA 2M3HA 2VJFA 5HQ7A 4UIUA 4YABA 4FK5A 3U5JA 2KGIA 3MQMA 3KV6A 5B77A 4I7CA 2RO1A 5CS8A 2VJEB 4OGIA 4PCEA 4YATA 5D3TA 5HJCA 1LDJB 2KWJA 3L1XA 1U6GB 3SOXA 2RFJA 1VYXA 1XWHA 5L97A 2ZETC 5FH7A 1JM7A 3IHPA 4TU6A 2YW5A 4B86C 5F36A 5D3JA 3HCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FH6 A;  3PHD A;  3LRQ A;  3SOW A;  4ALH A;  5DX4 A;  5EV9 A;  4UYG A;  5EA1 A;  5TBN A;  5FE1 A;  4TYL A;  2MIQ A;  2NAA A;  3P1E A;  2RNY A;  5FE2 A;  2EOD A;  4O71 A;  2OSS A;  3ONI A;  4QSP A;  4Y03 A;  5D25 A;  1Z6U A;  4NYV A;  4LLB A;  4YYN A;  5CUC A;  3FKM X;  4OGJ A;  4N4F A;  4NYX A;  3RTR B;  5LKU A;  2DVQ A;  2OO1 A;  4QB3 A;  5DKH A;  5ETB A;  3DAI A;  5CRZ A;  4MR6 A;  5FG5 A;  5HLS A;  2RNW A;  4IOO A;  5CQ6 A;  4N4I A;  4XYA A;  5TAB A;  5EP7 A;  5H1T A;  5JG6 A;  5IBN A;  2Y43 A;  4QR4 A;  4UIZ A;  5D3R A;  5ENJ A;  4ZQL A;  5I86 A;  5HEN A;  3O70 A;  5HQ6 A;  5LKZ A;  4WZ0 A;  4NR4 A;  5EVA A;  5EWD A;  1WEM A;  4NQN A;  2VJF B;  2YU4 A;  5A5S A;  3HTK C;  3KV5 A;  5C87 A;  5AD2 A;  1Z2Q A;  4UP5 A;  4AKN A;  5D1M B;  4UIX A;  2YT5 A;  4HXS A;  2YEK A;  3I3J A;  5B8D A;  2WP1 A;  4WHU A;  2M6M A;  4J1P A;  4C67 A;  1JM7 B;  3D7C A;  4MR4 A;  2VP7 A;  4NRB A;  4MVT A;  5AIU A;  5FG4 A;  1WFK A;  5DKA A;  5HM0 A;  5H1V A;  4QSS A;  4IC2 A;  2AN6 A;  5TRB A;  2K1J A;  1Z60 A;  2L43 A;  4NR5 A;  3ZYQ A;  4O7E A;  5EGU A;  5E9Y A;  2FUI A;  4YYG A;  4N4G A;  5DYA A;  4BHW A;  1WE9 A;  5DLX A;  4P5O B;  4HBW A;  4S3O C;  2CSZ A;  4CFL A;  3KQI A;  2DKW A;  4YYK A;  4IOR A;  5E3G A;  5B79 A;  4LJN A;  5KO4 A;  4NR6 A;  2YYR A;  4QF2 A;  5J3X A;  4R7E A;  4V3L C;  4TT4 A;  2UZG A;  4QY4 A;  3UVD A;  5D3S A;  3FL2 A;  4IR5 A;  4YH4 A;  4QSR A;  4ZC9 A;  5E0R A;  5HEL A;  3JVJ A;  3N9L A;  2KWN A;  3AAD A;  3L11 A;  3DWY A;  3U5M A;  5KHM A;  4A9O A;  5JI8 A;  4Q6F A;  5H85 A;  2I50 A;  3MUL A;  5HFQ A;  4YY4 A;  5K29 A;  3SVG A;  5ENB A;  4O77 A;  4QYD A;  5L8T A;  5A7C A;  2KGG A;  2VPG A;  4GNG A;  5IGK A;  3MXF A;  2YHO A;  2LXP C;  5DFD A;  4I7B A;  4QSV A;  5G05 B;  5A81 A;  1K2F A;  3PUQ A;  4QSX A;  5I29 A;  2G43 A;  2VNF A;  3HMF A;  2YEM A;  4CA1 A;  4L58 A;  4LKA A;  3Q2F A;  5I1Q A;  4O7A A;  4XY9 A;  5E9I A;  5EPS A;  3UV4 A;  2MT5 A;  5I7X A;  5E9K A;  5D3N A;  3ZYU A;  2D8S A;  4ZW1 A;  4UP0 A;  4UIT A;  5HRX A;  5D1K B;  1WEN A;  5IGN A;  5COI A;  4HXN A;  2CT2 A;  2HDP A;  4FO9 A;  2JRJ A;  4NR8 A;  5ETD A;  2MNY A;  4N3W A;  4QR3 A;  2YW8 A;  5FE7 A;  4BW4 A;  5D26 A;  4QF3 A;  5LJ1 A;  5CUB A;  4O78 A;  5E3D A;  4LZS A;  4A9L A;  4CUR A;  4UYH A;  5CPE A;  5A5O A;  2OXQ C;  1G25 A;  1WIM A;  3ASL A;  5FBX A;  2L0B A;  4HBX A;  2LDR A;  5CRM A;  5FER A;  5EPB A;  4A9K A;  1X4U A;  1F62 A;  5D1L B;  5F3A A;  4AYC A;  4LAD B;  4YYD A;  1MM2 A;  2LV9 A;  3N9P A;  4YYM A;  5C4Q A;  1V87 A;  4BW1 A;  4QZS A;  5FFV A;  2CKL A;  5D24 A;  4PCI A;  4Z6I A;  2JMJ A;  4YY6 A;  5B75 A;  5F25 A;  4TT6 A;  3N9Q A;  1JOC A;  4FJC A;  3NG2 A;  4B7Y C;  2NXB A;  2YEL A;  4A9I A;  4I7D A;  4UYF B;  3O35 A;  2G6Q A;  4TU4 A;  5E9L A;  4WZ2 A;  2QIC A;  4QUT A;  5TB6 A;  3UVX A;  2KR4 A;  5LJ2 A;  3C6W A;  4X2I A;  5LVQ A;  5A5N A;  3SHB A;  3P1D A;  4YC9 A;  5AME A;  3KNV A;  4QNS A;  5HEM A;  3UW9 A;  1WUG A;  3HCS A;  2DX8 A;  2XEU A;  3ZPV E;  2GRC A;  4NR9 A;  4CUP A;  4YK0 A;  4TS8 A;  3GL6 A;  5E9V A;  4XI1 A;  2F6N A;  5FH8 A;  5DFC A;  5A5P A;  3UV2 A;  4DON A;  4A4B A;  4YYI A;  5IG6 A;  2E6S A;  4TT2 A;  1X0J A;  5F2P A;  5EIS A;  2YQM A;  4YAX A;  3QZV A;  2XB1 A;  2YSM A;  4WA6 A;  4TZ8 A;  5TCM A;  4XUB A;  2Y1M A;  5FE5 A;  2L5U A;  1N72 A;  3I2D A;  4NN2 A;  4A9E A;  2L85 A;  5CUG A;  4QC1 A;  5FE8 A;  4BW3 A;  2EA6 A;  2VPE A;  2HYE D;  5KH9 A;  5II1 A;  4UIV A;  5ENI A;  4CUU A;  5E9M A;  2KIZ A;  4AYC B;  5CP5 A;  2JMI A;  4YBM A;  5F60 A;  4LYW A;  4YYH A;  2CKL B;  4LZR A;  4O76 A;  5FFW A;  5L96 A;  5C89 A;  2D82 A;  3MB3 A;  4NRA A;  5I88 A;  4V3K C;  3T7L A;  4A9M A;  2L84 A;  5I40 A;  4QSU A;  5KTW A;  2I8N A;  2PUY A;  3SOU A;  4QSQ A;  2C2V S;  5HFR A;  1WEW A;  4IR4 A;  5I89 A;  2MJV B;  5CU8 A;  3ZPV 1;  1IYM A;  5CY9 A;  5D7X A;  2YUR A;  3VK6 A;  2R0S A;  5FG6 A;  2K4D A;  4CUT A;  4Q0O A;  5E74 A;  5ACY A;  4LYS A;  5CQT A;  3QZT A;  5CZG A;  1E6I A;  4A9N A;  4CLB A;  5A82 A;  2EGP A;  2LRI C;  5F1L A;  4QST A;  2YUC A;  4FIP A;  5A83 A;  4MEQ A;  3LJW A;  5LJ0 A;  4LRG A;  3EB6 A;  4S3O B;  4QSW A;  2K16 A;  2H60 A;  4IOQ A;  4O7F A;  5IID A;  3O37 A;  4IR3 A;  2ECN A;  1FP0 A;  5DIN A;  4F3I A;  5C13 A;  2KE1 A;  1JM4 B;  5ENG A;  2F6J A;  1X4J A;  1RMD A;  3NXB A;  4MEO A;  4MEP A;  3AQA A;  3O7A A;  5II2 A;  3GG3 A;  5EK9 A;  5CTL A;  2MA6 A;  5FE9 A;  4TKP B;  3N9N A;  4HBY A;  4QUU A;  4CUS A;  2LGV A;  5ENC A;  4O7B A;  4HBV A;  4NQM A;  3JVK A;  4CL9 A;  4ZDT A;  4J3I A;  1X4I A;  4YBS A;  3IU6 A;  5C8G A;  5FDZ A;  5FB1 A;  5G04 B;  4NUD A;  5DLZ A;  4J0S A;  3LQI A;  4E96 A;  1FBV A;  4MSX A;  5DFB A;  5BT3 A;  4F52 B;  4CCG X;  2I7K A;  4L7X A;  4GNE A;  4AVX A;  4QEW A;  3LQH A;  3L1Z B;  5B78 A;  5H1U A;  4MR3 A;  4CFK A;  5TDR A;  5F63 A;  5KTX A;  4C66 A;  4R8P K;  5FE4 A;  4CUQ A;  2MUM A;  2KRE A;  2LXH C;  5DKD A;  5A5R A;  2ECV A;  4HXL A;  4WHW A;  1EQF A;  5LKX A;  3MB4 A;  4A0C D;  4XY8 A;  2YHN A;  5HRW A;  1WES A;  5I83 A;  3P1C A;  3P5O A;  5ENE A;  5FFY A;  2ECW A;  4LR6 A;  2R0Y A;  3MHH A;  1BOR A;  4HXK A;  5D3L A;  5A5Q A;  5D0C A;  5CGP A;  5EWW A;  5EU1 A;  5E7D A;  5EWH A;  4Z6H A;  4QC3 A;  5CUA A;  5EI4 A;  5C85 A;  5DW2 A;  2RNX A;  2ECJ A;  2LSP B;  1DVP A;  4O7C A;  2H0D A;  1WEU A;  3DQV R;  2G4A A;  1LDK C;  3PUR A;  2FUU A;  4GND A;  5HQ5 A;  5I80 A;  4RVR A;  2KYU A;  5HCL A;  2KTB B;  1VD4 A;  2L80 A;  1WEQ A;  5L8U A;  2WP2 A;  3UVW A;  2ECT A;  5EPR A;  4A4C A;  4LZ2 A;  2M85 A;  3P1F A;  1WEO A;  2DWW A;  2R0V A;  4KCX A;  4W4U A;  4QR5 A;  4HXR A;  4NR7 A;  2MNZ A;  2VPD A;  5LCW B;  5TDW A;  4O75 A;  3ZVZ B;  3GV4 A;  2E3K A;  4MR5 A;  5A85 A;  4TQN A;  5L99 A;  2YRE A;  4UYE A;  5CQ8 A;  3UVY A;  2ECG A;  4QBM A;  2KWK A;  3O36 A;  3U5K A;  5DYX A;  3M63 A;  3Q2E A;  5DW1 A;  3K2J A;  2ECI A;  4QYL A;  4Q0N A;  2E7O A;  2CSY A;  3V43 A;  3N9O A;  5CQA A;  4NUC A;  1WEE A;  3N9M A;  3ZVY A;  4AUQ B;  3JVL A;  4ALG A;  5D3P A;  3U5N A;  3M99 A;  2QIZ A;  4ZUX U;  3MUK A;  2LGL A;  5C11 A;  1WGM A;  3HME A;  2JMD A;  2M1R A;  4WZ3 B;  2MA5 A;  2BAY A;  4HXP A;  5J0D A;  5DBM A;  2MD7 B;  4TTE A;  2LGK A;  2D9E A;  4GB0 A;  3O33 A;  1WEP A;  4PKL A;  5DYU A;  2H0D B;  4BBQ A;  5CQ5 A;  4PS5 A;  2KWO A;  2K17 A;  5ENF A;  4A9F A;  5CFW A;  5FE3 A;  3DPL R;  4PPE A;  4BJX A;  4OUF A;  2L75 A;  2LGG A;  4YYJ A;  3JVM A;  5AD3 A;  5CQ3 A;  2YQD A;  2DVV A;  3U5O A;  3ZNI A;  1E4U A;  2L5E A;  4C9Z A;  2R10 A;  3LQJ A;  4NUE A;  4KV1 A;  2F42 A;  4UI9 B;  3HMH A;  4HXM A;  4O64 A;  3ZTG A;  2YSJ A;  2YYN A;  4LYI A;  5EWV A;  4Z93 A;  5JWM A;  5KH3 A;  2RS9 B;  4UIW A;  1WIL A;  1WEV A;  5DY7 A;  2DVS A;  4FLP A;  2QJ0 A;  4X3G A;  4LDF A;  3RPG C;  5ENH A;  4HXO A;  5EYA F;  4IC3 A;  5F5Z A;  1T1H A;  5FEY A;  4J0R A;  5BT4 A;  2MD8 C;  5FE6 A;  1VFY A;  5E73 A;  5CUE A;  5EQ1 A;  5B76 A;  3RCW A;  5BT5 A;  4QEU A;  5G4R A;  5IGM A;  4TZ2 A;  3EB5 A;  2YDW A;  4PY6 A;  3TLP A;  5CQ4 A;  4Z1Q A;  2LQ6 A;  2VJE A;  5H9M A;  4BW2 A;  2RSD A;  4UYD A;  4UIY A;  5KH7 A;  5CUD A;  4O70 A;  4O72 A;  4YBT A;  3SVH A;  4GNF A;  5D3H A;  4NRC A;  5HRV A;  1CHC A;  1HYJ A;  3G0L A;  2VPB A;  5AIT A;  3QZS A;  3SVF A;  2PNX A;  4LK9 A;  4QEV A;  4YH3 A;  2Y1N A;  3MHS A;  3RPG B;  5C7N A;  3IU5 A;  5EM3 A;  3C5K A;  1JSP B;  4GPJ A;  4MEN A;  5DYC A;  1ZBD B;  1ZS5 A;  2C2L A;  4A49 A;  5DKC A;  2OUO A;  4A9H A;  5AMF A;  5F62 A;  5F61 A;  5I7Y A;  5KU3 A;  1F68 A;  1WUM A;  3S91 A;  3UV5 A;  4LC2 A;  4O74 A;  5EWC A;  5L98 A;  1MM3 A;  2IDA A;  4R2Y A;  5G0F A;  2DAT A;  1HYI A;  5EIC A;  2DVR A;  4IR6 A;  5F1H A;  4A9J A;  4KV4 A;  2G45 A;  4N4H A;  5KTU A;  2KFT A;  3U5L A;  4AP4 A;  3U5P A;  5FB0 A;  2FSA A;  3O34 A;  2YQL A;  4UYF A;  5LUU A;  2E7N A;  5LVR A;  4NYW A;  4NXJ A;  5I3L A;  5LKT A;  5G4S A;  3S92 A;  5IGL A;  4PTB A;  3LXJ A;  4WIV A;  4XUA A;  1N87 A;  2KU3 A;  2LN0 A;  2N9G A;  2E6R A;  2RI7 A;  4NS5 A;  4Z1S A;  3G0J A;  5CQ7 A;  5FE0 A;  3HCU A;  3M62 A;  3T6R A;  4YAD A;  2M3H A;  2VJF A;  5HQ7 A;  4UIU A;  4YAB A;  4FK5 A;  3U5J A;  2KGI A;  3MQM A;  3KV6 A;  5B77 A;  4I7C A;  2RO1 A;  5CS8 A;  2VJE B;  4OGI A;  4PCE A;  4YAT A;  5D3T A;  5HJC A;  1LDJ B;  2KWJ A;  3L1X A;  1U6G B;  3SOX A;  2RFJ A;  1VYX A;  1XWH A;  5L97 A;  2ZET C;  5FH7 A;  1JM7 A;  3IHP A;  4TU6 A;  2YW5 A;  4B86 C;  5F36 A;  5D3J A;  3HCT A; 
#chains in the Genus database with same CATH topology
 5FH6 A;  3PHD A;  3LRQ A;  3SOW A;  4ALH A;  5DX4 A;  5EV9 A;  4UYG A;  5EA1 A;  5TBN A;  5FE1 A;  4TYL A;  2MIQ A;  2NAA A;  3P1E A;  2RNY A;  5FE2 A;  2EOD A;  4O71 A;  2OSS A;  3ONI A;  4QSP A;  4Y03 A;  5D25 A;  1Z6U A;  2LAU A;  3MDB C;  4NYV A;  4LLB A;  4YYN A;  5CUC A;  3FKM X;  4QQ4 A;  4OGJ A;  4N4F A;  4NYX A;  3RTR B;  5LKU A;  2DVQ A;  2OO1 A;  4QB3 A;  5DKH A;  5ETB A;  3DAI A;  5CRZ A;  4MR6 A;  5FG5 A;  5HLS A;  2RNW A;  4IOO A;  5CQ6 A;  4N4I A;  4XYA A;  5TAB A;  5EP7 A;  5H1T A;  5JG6 A;  5IBN A;  2Y43 A;  4QR4 A;  4UIZ A;  5D3R A;  5ENJ A;  4ZQL A;  5I86 A;  5HEN A;  3O70 A;  5HQ6 A;  5LKZ A;  4WZ0 A;  4NR4 A;  5EVA A;  5EWD A;  1WEM A;  4NQN A;  2VJF B;  2YU4 A;  5A5S A;  3HTK C;  3KV5 A;  5C87 A;  5AD2 A;  1Z2Q A;  4UP5 A;  4AKN A;  5D1M B;  4UIX A;  2YT5 A;  4HXS A;  2YEK A;  3I3J A;  4F1P A;  5B8D A;  2WP1 A;  4WHU A;  2M6M A;  4J1P A;  4C67 A;  1JM7 B;  3D7C A;  4MR4 A;  2VP7 A;  5SVX A;  4NRB A;  4MVT A;  5AIU A;  5FG4 A;  1WFK A;  5DKA A;  5HM0 A;  3M7K A;  5H1V A;  4AI6 A;  4QSS A;  4IC2 A;  2AN6 A;  5TRB A;  2K1J A;  1Z60 A;  2L43 A;  4NR5 A;  3ZYQ A;  4O7E A;  5EGU A;  5E9Y A;  2FUI A;  4YYG A;  4N4G A;  5DYA A;  4BHW A;  1WE9 A;  5DLX A;  2XP0 A;  4P5O B;  4HBW A;  4S3O C;  2CSZ A;  2KKX A;  4CFL A;  3KQI A;  2FD4 A;  2DKW A;  3LJU X;  4YYK A;  4IOR A;  5E3G A;  5B79 A;  4LJN A;  5KO4 A;  4NR6 A;  2YYR A;  4QF2 A;  5J3X A;  4R7E A;  4V3L C;  4TT4 A;  2UZG A;  4QY4 A;  3UVD A;  5D3S A;  3FL2 A;  4IR5 A;  4YH4 A;  4QSR A;  4OGC A;  3VKG A;  4ZC9 A;  5E0R A;  5HEL A;  3JVJ A;  3N9L A;  2KWN A;  3DDT A;  3AAD A;  3L11 A;  3DWY A;  3U5M A;  5KHM A;  4A9O A;  5JI8 A;  4Q6F A;  5H85 A;  2I50 A;  3MUL A;  2CON A;  5HFQ A;  4YY4 A;  5K29 A;  3SVG A;  5ENB A;  4O77 A;  4QYD A;  5L8T A;  2JM3 A;  5A7C A;  2KGG A;  2EXU A;  2VPG A;  4GNG A;  5IGK A;  3MXF A;  2YHO A;  2LXP C;  5DFD A;  4I7B A;  4QSV A;  5G05 B;  5A81 A;  1K2F A;  3PUQ A;  4QSX A;  5I29 A;  2G43 A;  2VNF A;  3HMF A;  2YEM A;  4CA1 A;  4L58 A;  4LKA A;  3Q2F A;  5I1Q A;  4O7A A;  4XY9 A;  5E9I A;  5EPS A;  3UV4 A;  2MT5 A;  5I7X A;  5E9K A;  5D3N A;  3ZYU A;  2D8S A;  2JUN A;  4ZW1 A;  3H7H A;  4UIT A;  5HRX A;  4UP0 A;  5D1K B;  1WEN A;  5IGN A;  2XOY A;  2EGM A;  5COI A;  4HXN A;  2CT2 A;  2HDP A;  4FO9 A;  2JRJ A;  4NR8 A;  5ETD A;  2MNY A;  4N3W A;  4QR3 A;  2YW8 A;  5FE7 A;  4BW4 A;  5D26 A;  4QF3 A;  5SVY A;  5LJ1 A;  5CUB A;  4O78 A;  5E3D A;  4LZS A;  4A9L A;  4CUR A;  4UYH A;  5CPE A;  5A5O A;  2OXQ C;  1G25 A;  1WIM A;  3D1B A;  3ASL A;  5FBX A;  2L0B A;  4HBX A;  2LDR A;  5CRM A;  5FER A;  5EPB A;  4A9K A;  1X4U A;  1F62 A;  5D1L B;  5F3A A;  4AYC A;  4LAD B;  4YYD A;  1MM2 A;  2LV9 A;  3N9P A;  4YYM A;  5C4Q A;  1V87 A;  4BW1 A;  4QZS A;  5FFV A;  2CKL A;  5D24 A;  4PCI A;  4Z6I A;  2JMJ A;  3SUB A;  4YY6 A;  5B75 A;  5F25 A;  4TT6 A;  3N9Q A;  1JOC A;  4FJC A;  4H9D A;  3NG2 A;  4B7Y C;  2NXB A;  2YEL A;  4A9I A;  4I7D A;  4UYF B;  3O35 A;  2G6Q A;  4TU4 A;  5E9L A;  2M13 A;  4WZ2 A;  2QIC A;  3PLW A;  4QUT A;  5TB6 A;  3UVX A;  2KR4 A;  5LJ2 A;  3C6W A;  4X2I A;  5LVQ A;  5A5N A;  3SHB A;  3P1D A;  4YC9 A;  5AME A;  3KNV A;  4QNS A;  5HEM A;  3UW9 A;  1WUG A;  3HCS A;  2DX8 A;  2XEU A;  3ZPV E;  2GRC A;  4NR9 A;  4CUP A;  4Z0O A;  4YK0 A;  4TS8 A;  3GL6 A;  5E9V A;  4XI1 A;  2F6N A;  5FH8 A;  5DFC A;  5A5P A;  3UV2 A;  4DON A;  4A4B A;  4YYI A;  5IG6 A;  2E6S A;  4TT2 A;  1X0J A;  5F2P A;  5EIS A;  2YQM A;  4YAX A;  3QZV A;  2KKY A;  2XB1 A;  2YSM A;  4WA6 A;  4TZ8 A;  5TCM A;  4XUB A;  2Y1M A;  5FE5 A;  2L5U A;  1N72 A;  3I2D A;  4NN2 A;  4A9E A;  2L85 A;  5CUG A;  4QC1 A;  5FE8 A;  4BW3 A;  2EA6 A;  2VPE A;  2HYE D;  5KH9 A;  5II1 A;  4UIV A;  5ENI A;  4CUU A;  5E9M A;  2KIZ A;  4AYC B;  3LDY A;  5CP5 A;  2JMI A;  4YBM A;  5F60 A;  2MKE A;  4LYW A;  4YYH A;  2CKL B;  4LZR A;  4O76 A;  5FFW A;  2XOZ A;  5L96 A;  5C89 A;  2D82 A;  3MB3 A;  4NRA A;  5I88 A;  4V3K C;  3T7L A;  4A9M A;  2L84 A;  5I40 A;  4QSU A;  5KTW A;  1DCQ A;  2I8N A;  2PUY A;  3SOU A;  4QSQ A;  2DSM A;  2C2V S;  5HFR A;  1WEW A;  4IR4 A;  5I89 A;  2MJV B;  5CU8 A;  3DWD A;  3ZPV 1;  5CY9 A;  5D7X A;  1IYM A;  2YUR A;  3VK6 A;  2R0S A;  5FG6 A;  2K4D A;  4CUT A;  4Q0O A;  5E74 A;  5ACY A;  4LYS A;  5CQT A;  3QZT A;  5CZG A;  1E6I A;  4A9N A;  4CLB A;  5A82 A;  2EGP A;  2YVR A;  2LRI C;  3Q1D A;  5F1L A;  4QST A;  4AKI A;  2YUC A;  3JUE A;  4FIP A;  5A83 A;  4MEQ A;  2L7P A;  3LJW A;  5LJ0 A;  4LRG A;  3EB6 A;  4S3O B;  4QSW A;  2K16 A;  1MBM A;  2H60 A;  4IOQ A;  4O7F A;  5IID A;  3O37 A;  3O47 A;  4IR3 A;  1PUO A;  1FP0 A;  2ECN A;  5DIN A;  4F3I A;  5C13 A;  2KE1 A;  1JM4 B;  5ENG A;  2F6J A;  1X4J A;  1RMD A;  3FAO A;  3NXB A;  4MEO A;  4MEP A;  3AQA A;  3O7A A;  5II2 A;  3GG3 A;  5EK9 A;  5CTL A;  2MA6 A;  5FE9 A;  4TKP B;  3N9N A;  4HBY A;  4QUU A;  4CUS A;  2LGV A;  5ENC A;  4O7B A;  4HBV A;  4NQM A;  3JVK A;  4CL9 A;  4ZDT A;  4J3I A;  1X4I A;  4YBS A;  3IU6 A;  5C8G A;  5FDZ A;  5FB1 A;  5G04 B;  4NUD A;  5DLZ A;  4J0S A;  3LQI A;  4E96 A;  1FBV A;  4MSX A;  5DFB A;  5BT3 A;  4F52 B;  4CCG X;  2I7K A;  4L7X A;  4GNE A;  4AVX A;  4QEW A;  3LQH A;  3L1Z B;  5B78 A;  5H1U A;  4MR3 A;  4CFK A;  5TDR A;  2OWA A;  5F63 A;  5KTX A;  4C66 A;  4R8P K;  5FE4 A;  4CUQ A;  2MUM A;  2KRE A;  2LXH C;  5DKD A;  3VKH A;  5A5R A;  2ECV A;  4HXL A;  4WHW A;  1EQF A;  5LKX A;  3MB4 A;  4A0C D;  4XY8 A;  2YHN A;  5HRW A;  1WES A;  5I83 A;  3P1C A;  3P5O A;  5ENE A;  5FFY A;  2ECW A;  4LR6 A;  2R0Y A;  3MHH A;  1BOR A;  4HXK A;  5D3L A;  5A5Q A;  5D0C A;  5CGP A;  5EWW A;  5EU1 A;  5E7D A;  5EWH A;  4Z6H A;  4QC3 A;  5CUA A;  5EI4 A;  5C85 A;  5DW2 A;  2RNX A;  2ECJ A;  2LSP B;  1DVP A;  4O7C A;  2H0D A;  1WEU A;  3DQV R;  2G4A A;  1LDK C;  1ZKR A;  3PUR A;  2FUU A;  4GND A;  5HQ5 A;  5K3Q A;  5I80 A;  4RVR A;  2KYU A;  5HCL A;  2KTB B;  1VD4 A;  2E61 A;  2L80 A;  1WEQ A;  5L8U A;  5SVI A;  2WP2 A;  3UVW A;  2ECT A;  3LVR E;  5EPR A;  4A4C A;  4LZ2 A;  2M85 A;  3P1F A;  1WEO A;  2DWW A;  2R0V A;  4KCX A;  4W4U A;  4QR5 A;  4HXR A;  4NR7 A;  2MNZ A;  2VPD A;  5LCW B;  5TDW A;  4O75 A;  3ZVZ B;  3GV4 A;  2E3K A;  4MR5 A;  5A85 A;  4TQN A;  5L99 A;  2YRE A;  4UYE A;  5CQ8 A;  3UVY A;  2ECG A;  4QBM A;  2KWK A;  3O36 A;  3D1D A;  3U5K A;  5DYX A;  3M63 A;  3Q2E A;  5DW1 A;  3K2J A;  2ECI A;  4QYL A;  4Q0N A;  2E7O A;  2CSY A;  3V43 A;  3N9O A;  5CQA A;  4NUC A;  1WEE A;  2B0O E;  3N9M A;  3ZVY A;  4AUQ B;  3JVL A;  4ALG A;  5D3P A;  3U5N A;  3M99 A;  2QIZ A;  4ZUX U;  3MUK A;  2LGL A;  5C11 A;  1WGM A;  3HME A;  2JMD A;  2M1R A;  4WZ3 B;  3E2D A;  2MA5 A;  2BAY A;  4HXP A;  5J0D A;  5DBM A;  2MD7 B;  4TTE A;  2LGK A;  2D9E A;  4AKG A;  3O33 A;  4GB0 A;  1WEP A;  4PKL A;  4OGE A;  5DYU A;  2H0D B;  4BBQ A;  5CQ5 A;  4PS5 A;  2KWO A;  2K17 A;  5ENF A;  3FEH A;  4A9F A;  5CFW A;  5FE3 A;  3DPL R;  4PPE A;  2CSV A;  5SVI B;  4BJX A;  4OUF A;  2L75 A;  2LGG A;  4YYJ A;  3JVM A;  5AD3 A;  5CQ3 A;  2YQD A;  2P57 A;  2DVV A;  3U5O A;  4O62 A;  3ZNI A;  2L5E A;  1E4U A;  4C9Z A;  2R10 A;  3LQJ A;  4NUE A;  4KV1 A;  2F42 A;  4UI9 B;  3HMH A;  4HXM A;  4O64 A;  3ZTG A;  2YSJ A;  2YYN A;  4LYI A;  5EWV A;  4Z93 A;  5JWM A;  5KH3 A;  2RS9 B;  4UIW A;  1WIL A;  2CRW A;  1WEV A;  5DY7 A;  2DVS A;  4FLP A;  2QJ0 A;  4X3G A;  2IQJ A;  2RR4 A;  4LDF A;  3RPG C;  5ENH A;  4HXO A;  5EYA F;  4IC3 A;  5F5Z A;  1T1H A;  5FEY A;  4J0R A;  2DJA A;  5BT4 A;  2MD8 C;  5FE6 A;  3FAN A;  1VFY A;  5E73 A;  5CUE A;  5EQ1 A;  3FJU B;  5B76 A;  3RCW A;  5BT5 A;  4QEU A;  5G4R A;  5IGM A;  4TZ2 A;  3EB5 A;  2YDW A;  4PY6 A;  3TLP A;  2CRR A;  5CQ4 A;  4Z1Q A;  2LQ6 A;  2VJE A;  5H9M A;  4BW2 A;  2RSD A;  4UYD A;  4UIY A;  5KH7 A;  5CUD A;  4O70 A;  4O72 A;  4YBT A;  3SVH A;  4GNF A;  3T9K A;  5D3H A;  4NRC A;  5HRV A;  1CHC A;  2FFW A;  3G0L A;  3ERR A;  2VPB A;  1HYJ A;  2EJN A;  5AIT A;  3QZS A;  3SVF A;  2PNX A;  4LK9 A;  4QEV A;  4YH3 A;  2Y1N A;  3MHS A;  3RPG B;  5C7N A;  3IU5 A;  5EM3 A;  3C5K A;  1JSP B;  4GPJ A;  4MEN A;  5DYC A;  1ZBD B;  1ZS5 A;  2C2L A;  4A49 A;  5DKC A;  2OUO A;  4A9H A;  5AMF A;  5F62 A;  5F61 A;  5I7Y A;  5KU3 A;  1F68 A;  1WUM A;  3S91 A;  3UV5 A;  4AKH A;  4LC2 A;  4O74 A;  5EWC A;  5L98 A;  1MM3 A;  2IDA A;  4R2Y A;  5G0F A;  2DAT A;  1HYI A;  5EIC A;  2DVR A;  4IR6 A;  5F1H A;  4A9J A;  4KV4 A;  2G45 A;  4N4H A;  5KTU A;  2KFT A;  3U5L A;  4AP4 A;  3U5P A;  5FB0 A;  2FSA A;  3O34 A;  2YQL A;  3KDE C;  4UYF A;  5LUU A;  2E7N A;  5LVR A;  4NYW A;  4NXJ A;  5I3L A;  5LKT A;  5G4S A;  3FM8 C;  3S92 A;  5IGL A;  4PTB A;  3LVQ E;  3LXJ A;  4WIV A;  4XUA A;  1N87 A;  2KU3 A;  2LN0 A;  2N9G A;  2D8U A;  2E6R A;  2RI7 A;  4NS5 A;  4Z1S A;  3G0J A;  5CQ7 A;  5FE0 A;  3HCU A;  3M62 A;  3T6R A;  4YAD A;  2M3H A;  2VJF A;  5HQ7 A;  4UIU A;  4YAB A;  4FK5 A;  3U5J A;  2KGI A;  3MQM A;  2XOC A;  3KV6 A;  5B77 A;  4I7C A;  2RO1 A;  5CS8 A;  2VJE B;  4OGI A;  4PCE A;  4YAT A;  5D3T A;  5HJC A;  1LDJ B;  2KWJ A;  3L1X A;  1U6G B;  3SOX A;  2RFJ A;  1VYX A;  4Z0R A;  1XWH A;  5L97 A;  2ZET C;  5FH7 A;  1JM7 A;  3IHP A;  4TU6 A;  2YW5 A;  4B86 C;  5F36 A;  5D3J A;  3HCT A; 
#chains in the Genus database with same CATH homology
 5FH6 A;  3PHD A;  3LRQ A;  3SOW A;  4ALH A;  5DX4 A;  5EV9 A;  4UYG A;  5EA1 A;  5TBN A;  5FE1 A;  4TYL A;  2MIQ A;  2NAA A;  3P1E A;  2RNY A;  5FE2 A;  2EOD A;  4O71 A;  2OSS A;  3ONI A;  4QSP A;  4Y03 A;  5D25 A;  1Z6U A;  4NYV A;  4LLB A;  4YYN A;  5CUC A;  3FKM X;  4OGJ A;  4N4F A;  4NYX A;  3RTR B;  5LKU A;  2DVQ A;  2OO1 A;  4QB3 A;  5DKH A;  5ETB A;  3DAI A;  5CRZ A;  4MR6 A;  5FG5 A;  5HLS A;  2RNW A;  4IOO A;  5CQ6 A;  4N4I A;  4XYA A;  5TAB A;  5EP7 A;  5H1T A;  5JG6 A;  5IBN A;  2Y43 A;  4QR4 A;  4UIZ A;  5D3R A;  5ENJ A;  4ZQL A;  5I86 A;  5HEN A;  3O70 A;  5HQ6 A;  5LKZ A;  4WZ0 A;  4NR4 A;  5EVA A;  5EWD A;  1WEM A;  4NQN A;  2VJF B;  2YU4 A;  5A5S A;  3HTK C;  3KV5 A;  5C87 A;  5AD2 A;  1Z2Q A;  4UP5 A;  4AKN A;  5D1M B;  4UIX A;  2YT5 A;  4HXS A;  2YEK A;  3I3J A;  5B8D A;  2WP1 A;  4WHU A;  2M6M A;  4J1P A;  4C67 A;  1JM7 B;  3D7C A;  4MR4 A;  2VP7 A;  4NRB A;  4MVT A;  5AIU A;  5FG4 A;  1WFK A;  5DKA A;  5HM0 A;  5H1V A;  4QSS A;  4IC2 A;  2AN6 A;  5TRB A;  2K1J A;  1Z60 A;  2L43 A;  4NR5 A;  3ZYQ A;  4O7E A;  5EGU A;  5E9Y A;  2FUI A;  4YYG A;  4N4G A;  5DYA A;  4BHW A;  1WE9 A;  5DLX A;  4P5O B;  4HBW A;  4S3O C;  2CSZ A;  4CFL A;  3KQI A;  2DKW A;  4YYK A;  4IOR A;  5E3G A;  5B79 A;  4LJN A;  5KO4 A;  4NR6 A;  2YYR A;  4QF2 A;  5J3X A;  4R7E A;  4V3L C;  4TT4 A;  2UZG A;  4QY4 A;  3UVD A;  5D3S A;  3FL2 A;  4IR5 A;  4YH4 A;  4QSR A;  4ZC9 A;  5E0R A;  5HEL A;  3JVJ A;  3N9L A;  2KWN A;  3AAD A;  3L11 A;  3DWY A;  3U5M A;  5KHM A;  4A9O A;  5JI8 A;  4Q6F A;  5H85 A;  2I50 A;  3MUL A;  5HFQ A;  4YY4 A;  5K29 A;  3SVG A;  5ENB A;  4O77 A;  4QYD A;  5L8T A;  5A7C A;  2KGG A;  2VPG A;  4GNG A;  5IGK A;  3MXF A;  2YHO A;  2LXP C;  5DFD A;  4I7B A;  4QSV A;  5G05 B;  5A81 A;  1K2F A;  3PUQ A;  4QSX A;  5I29 A;  2G43 A;  2VNF A;  3HMF A;  2YEM A;  4CA1 A;  4L58 A;  4LKA A;  3Q2F A;  5I1Q A;  4O7A A;  4XY9 A;  5E9I A;  5EPS A;  3UV4 A;  2MT5 A;  5I7X A;  5E9K A;  5D3N A;  3ZYU A;  2D8S A;  4ZW1 A;  4UP0 A;  4UIT A;  5HRX A;  5D1K B;  1WEN A;  5IGN A;  5COI A;  4HXN A;  2CT2 A;  2HDP A;  4FO9 A;  2JRJ A;  4NR8 A;  5ETD A;  2MNY A;  4N3W A;  4QR3 A;  2YW8 A;  5FE7 A;  4BW4 A;  5D26 A;  4QF3 A;  5LJ1 A;  5CUB A;  4O78 A;  5E3D A;  4LZS A;  4A9L A;  4CUR A;  4UYH A;  5CPE A;  5A5O A;  2OXQ C;  1G25 A;  1WIM A;  3ASL A;  5FBX A;  2L0B A;  4HBX A;  2LDR A;  5CRM A;  5FER A;  5EPB A;  4A9K A;  1X4U A;  1F62 A;  5D1L B;  5F3A A;  4AYC A;  4LAD B;  4YYD A;  1MM2 A;  2LV9 A;  3N9P A;  4YYM A;  5C4Q A;  1V87 A;  4BW1 A;  4QZS A;  5FFV A;  2CKL A;  5D24 A;  4PCI A;  4Z6I A;  2JMJ A;  4YY6 A;  5B75 A;  5F25 A;  4TT6 A;  3N9Q A;  1JOC A;  4FJC A;  3NG2 A;  4B7Y C;  2NXB A;  2YEL A;  4A9I A;  4I7D A;  4UYF B;  3O35 A;  2G6Q A;  4TU4 A;  5E9L A;  4WZ2 A;  2QIC A;  4QUT A;  5TB6 A;  3UVX A;  2KR4 A;  5LJ2 A;  3C6W A;  4X2I A;  5LVQ A;  5A5N A;  3SHB A;  3P1D A;  4YC9 A;  5AME A;  3KNV A;  4QNS A;  5HEM A;  3UW9 A;  1WUG A;  3HCS A;  2DX8 A;  2XEU A;  3ZPV E;  2GRC A;  4NR9 A;  4CUP A;  4YK0 A;  4TS8 A;  3GL6 A;  5E9V A;  4XI1 A;  2F6N A;  5FH8 A;  5DFC A;  5A5P A;  3UV2 A;  4DON A;  4A4B A;  4YYI A;  5IG6 A;  2E6S A;  4TT2 A;  1X0J A;  5F2P A;  5EIS A;  2YQM A;  4YAX A;  3QZV A;  2XB1 A;  2YSM A;  4WA6 A;  4TZ8 A;  5TCM A;  4XUB A;  2Y1M A;  5FE5 A;  2L5U A;  1N72 A;  3I2D A;  4NN2 A;  4A9E A;  2L85 A;  5CUG A;  4QC1 A;  5FE8 A;  4BW3 A;  2EA6 A;  2VPE A;  2HYE D;  5KH9 A;  5II1 A;  4UIV A;  5ENI A;  4CUU A;  5E9M A;  2KIZ A;  4AYC B;  5CP5 A;  2JMI A;  4YBM A;  5F60 A;  4LYW A;  4YYH A;  2CKL B;  4LZR A;  4O76 A;  5FFW A;  5L96 A;  5C89 A;  2D82 A;  3MB3 A;  4NRA A;  5I88 A;  4V3K C;  3T7L A;  4A9M A;  2L84 A;  5I40 A;  4QSU A;  5KTW A;  2I8N A;  2PUY A;  3SOU A;  4QSQ A;  2C2V S;  5HFR A;  1WEW A;  4IR4 A;  5I89 A;  2MJV B;  5CU8 A;  3ZPV 1;  1IYM A;  5CY9 A;  5D7X A;  2YUR A;  3VK6 A;  2R0S A;  5FG6 A;  2K4D A;  4CUT A;  4Q0O A;  5E74 A;  5ACY A;  4LYS A;  5CQT A;  3QZT A;  5CZG A;  1E6I A;  4A9N A;  4CLB A;  5A82 A;  2EGP A;  2LRI C;  5F1L A;  4QST A;  2YUC A;  4FIP A;  5A83 A;  4MEQ A;  3LJW A;  5LJ0 A;  4LRG A;  3EB6 A;  4S3O B;  4QSW A;  2K16 A;  2H60 A;  4IOQ A;  4O7F A;  5IID A;  3O37 A;  4IR3 A;  2ECN A;  1FP0 A;  5DIN A;  4F3I A;  5C13 A;  2KE1 A;  1JM4 B;  5ENG A;  2F6J A;  1X4J A;  1RMD A;  3NXB A;  4MEO A;  4MEP A;  3AQA A;  3O7A A;  5II2 A;  3GG3 A;  5EK9 A;  5CTL A;  2MA6 A;  5FE9 A;  4TKP B;  3N9N A;  4HBY A;  4QUU A;  4CUS A;  2LGV A;  5ENC A;  4O7B A;  4HBV A;  4NQM A;  3JVK A;  4CL9 A;  4ZDT A;  4J3I A;  1X4I A;  4YBS A;  3IU6 A;  5C8G A;  5FDZ A;  5FB1 A;  5G04 B;  4NUD A;  5DLZ A;  4J0S A;  3LQI A;  4E96 A;  1FBV A;  4MSX A;  5DFB A;  5BT3 A;  4F52 B;  4CCG X;  2I7K A;  4L7X A;  4GNE A;  4AVX A;  4QEW A;  3LQH A;  3L1Z B;  5B78 A;  5H1U A;  4MR3 A;  4CFK A;  5TDR A;  5F63 A;  5KTX A;  4C66 A;  4R8P K;  5FE4 A;  4CUQ A;  2MUM A;  2KRE A;  2LXH C;  5DKD A;  5A5R A;  2ECV A;  4HXL A;  4WHW A;  1EQF A;  5LKX A;  3MB4 A;  4A0C D;  4XY8 A;  2YHN A;  5HRW A;  1WES A;  5I83 A;  3P1C A;  3P5O A;  5ENE A;  5FFY A;  2ECW A;  4LR6 A;  2R0Y A;  3MHH A;  1BOR A;  4HXK A;  5D3L A;  5A5Q A;  5D0C A;  5CGP A;  5EWW A;  5EU1 A;  5E7D A;  5EWH A;  4Z6H A;  4QC3 A;  5CUA A;  5EI4 A;  5C85 A;  5DW2 A;  2RNX A;  2ECJ A;  2LSP B;  1DVP A;  4O7C A;  2H0D A;  1WEU A;  3DQV R;  2G4A A;  1LDK C;  3PUR A;  2FUU A;  4GND A;  5HQ5 A;  5I80 A;  4RVR A;  2KYU A;  5HCL A;  2KTB B;  1VD4 A;  2L80 A;  1WEQ A;  5L8U A;  2WP2 A;  3UVW A;  2ECT A;  5EPR A;  4A4C A;  4LZ2 A;  2M85 A;  3P1F A;  1WEO A;  2DWW A;  2R0V A;  4KCX A;  4W4U A;  4QR5 A;  4HXR A;  4NR7 A;  2MNZ A;  2VPD A;  5LCW B;  5TDW A;  4O75 A;  3ZVZ B;  3GV4 A;  2E3K A;  4MR5 A;  5A85 A;  4TQN A;  5L99 A;  2YRE A;  4UYE A;  5CQ8 A;  3UVY A;  2ECG A;  4QBM A;  2KWK A;  3O36 A;  3U5K A;  5DYX A;  3M63 A;  3Q2E A;  5DW1 A;  3K2J A;  2ECI A;  4QYL A;  4Q0N A;  2E7O A;  2CSY A;  3V43 A;  3N9O A;  5CQA A;  4NUC A;  1WEE A;  3N9M A;  3ZVY A;  4AUQ B;  3JVL A;  4ALG A;  5D3P A;  3U5N A;  3M99 A;  2QIZ A;  4ZUX U;  3MUK A;  2LGL A;  5C11 A;  1WGM A;  3HME A;  2JMD A;  2M1R A;  4WZ3 B;  2MA5 A;  2BAY A;  4HXP A;  5J0D A;  5DBM A;  2MD7 B;  4TTE A;  2LGK A;  2D9E A;  4GB0 A;  3O33 A;  1WEP A;  4PKL A;  5DYU A;  2H0D B;  4BBQ A;  5CQ5 A;  4PS5 A;  2KWO A;  2K17 A;  5ENF A;  4A9F A;  5CFW A;  5FE3 A;  3DPL R;  4PPE A;  4BJX A;  4OUF A;  2L75 A;  2LGG A;  4YYJ A;  3JVM A;  5AD3 A;  5CQ3 A;  2YQD A;  2DVV A;  3U5O A;  3ZNI A;  1E4U A;  2L5E A;  4C9Z A;  2R10 A;  3LQJ A;  4NUE A;  4KV1 A;  2F42 A;  4UI9 B;  3HMH A;  4HXM A;  4O64 A;  3ZTG A;  2YSJ A;  2YYN A;  4LYI A;  5EWV A;  4Z93 A;  5JWM A;  5KH3 A;  2RS9 B;  4UIW A;  1WIL A;  1WEV A;  5DY7 A;  2DVS A;  4FLP A;  2QJ0 A;  4X3G A;  4LDF A;  3RPG C;  5ENH A;  4HXO A;  5EYA F;  4IC3 A;  5F5Z A;  1T1H A;  5FEY A;  4J0R A;  5BT4 A;  2MD8 C;  5FE6 A;  1VFY A;  5E73 A;  5CUE A;  5EQ1 A;  5B76 A;  3RCW A;  5BT5 A;  4QEU A;  5G4R A;  5IGM A;  4TZ2 A;  3EB5 A;  2YDW A;  4PY6 A;  3TLP A;  5CQ4 A;  4Z1Q A;  2LQ6 A;  2VJE A;  5H9M A;  4BW2 A;  2RSD A;  4UYD A;  4UIY A;  5KH7 A;  5CUD A;  4O70 A;  4O72 A;  4YBT A;  3SVH A;  4GNF A;  5D3H A;  4NRC A;  5HRV A;  1CHC A;  1HYJ A;  3G0L A;  2VPB A;  5AIT A;  3QZS A;  3SVF A;  2PNX A;  4LK9 A;  4QEV A;  4YH3 A;  2Y1N A;  3MHS A;  3RPG B;  5C7N A;  3IU5 A;  5EM3 A;  3C5K A;  1JSP B;  4GPJ A;  4MEN A;  5DYC A;  1ZBD B;  1ZS5 A;  2C2L A;  4A49 A;  5DKC A;  2OUO A;  4A9H A;  5AMF A;  5F62 A;  5F61 A;  5I7Y A;  5KU3 A;  1F68 A;  1WUM A;  3S91 A;  3UV5 A;  4LC2 A;  4O74 A;  5EWC A;  5L98 A;  1MM3 A;  2IDA A;  4R2Y A;  5G0F A;  2DAT A;  1HYI A;  5EIC A;  2DVR A;  4IR6 A;  5F1H A;  4A9J A;  4KV4 A;  2G45 A;  4N4H A;  5KTU A;  2KFT A;  3U5L A;  4AP4 A;  3U5P A;  5FB0 A;  2FSA A;  3O34 A;  2YQL A;  4UYF A;  5LUU A;  2E7N A;  5LVR A;  4NYW A;  4NXJ A;  5I3L A;  5LKT A;  5G4S A;  3S92 A;  5IGL A;  4PTB A;  3LXJ A;  4WIV A;  4XUA A;  1N87 A;  2KU3 A;  2LN0 A;  2N9G A;  2E6R A;  2RI7 A;  4NS5 A;  4Z1S A;  3G0J A;  5CQ7 A;  5FE0 A;  3HCU A;  3M62 A;  3T6R A;  4YAD A;  2M3H A;  2VJF A;  5HQ7 A;  4UIU A;  4YAB A;  4FK5 A;  3U5J A;  2KGI A;  3MQM A;  3KV6 A;  5B77 A;  4I7C A;  2RO1 A;  5CS8 A;  2VJE B;  4OGI A;  4PCE A;  4YAT A;  5D3T A;  5HJC A;  1LDJ B;  2KWJ A;  3L1X A;  1U6G B;  3SOX A;  2RFJ A;  1VYX A;  1XWH A;  5L97 A;  2ZET C;  5FH7 A;  1JM7 A;  3IHP A;  4TU6 A;  2YW5 A;  4B86 C;  5F36 A;  5D3J A;  3HCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...