3O37A

Crystal structure of trim24 phd-bromo complexed with h3(1-10)k4 peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
182
structure length
175
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 51
structure length 175
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o37A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o37A01
4O71A 4BW1A 2YU4A 5FFVA 5F62A 5FG6A 1BORA 1RMDA 4IR3A 5DW2A 5I7XA 5LKZA 4A9MA 2M6MA 3D7CA 3I3JA 5ENJA 2DATA 2I8NA 4XY9A 1LDKC 3ZYQA 3QZVA 1N72A 2F6NA 1WEEA 5C8GA 4A4BA 5CZGA 5H1VA 1VD4A 2DVRA 5ENFA 2M3HA 4QZSA 5E3GA 5ENGA 4CUTA 5E9VA 5A83A 3RTRB 2RNWA 1WE9A 2OO1A 4GNFA 4LYSA 2UZGA 5TBNA 5KH7A 4R2YA 5D1MB 5EQ1A 5I83A 2K17A 2D82A 4A9EA 5EM3A 3DAIA 5A5OA 4QYDA 1MM3A 3Q2FA 2KWJA 2YUCA 3LQHA 5TB6A 4UIXA 3O33A 4IOOA 2E3KA 2ECIA 5FE4A 4F3IA 3M63A 2L5UA 5ENHA 2H60A 4QSRA 5A5SA 5HQ5A 4O7EA 4A49A 4X3GA 4LRGA 1K2FA 5FE8A 4A9JA 5AD2A 1WILA 4IC3A 2YYNA 4N4HA 3MHSA 4GNDA 4HXLA 4YY4A 4LC2A 3UVYA 2L75A 3L1XA 5DINA 5I3LA 4Z1SA 4MR3A 5DYCA 5FERA 5F3AA 4QC3A 2MD7B 5EWWA 2NXBA 4UIWA 4Y03A 5E73A 4A4CA 5F2PA 1WEOA 2R0YA 4XUAA 4YADA 3M99A 2VP7A 2RFJA 4N4FA 3PURA 2YQDA 2L43A 2YSJA 4NR9A 2KU3A 4YYDA 4RVRA 5CS8A 5CRMA 3DQVR 2L5EA 2R10A 4HXPA 5CQTA 5D3RA 5BT3A 5HRVA 5KO4A 4TZ8A 2PUYA 4ALGA 4KV4A 4A9IA 4NRCA 2M85A 4BW4A 1FP0A 2LXPC 4X2IA 5IBNA 2CKLB 5HM0A 4I7BA 5I29A 3UW9A 2G45A 4A9NA 4LZSA 5FFYA 4CUPA 5IGNA 5KHMA 1WEWA 2RNXA 3UVWA 5F5ZA 3V43A 3U5MA 4KCXA 2IDAA 5FG4A 4FK5A 3L1ZB 4WA6A 5FBXA 5F63A 5LJ1A 2YHNA 4UIZA 1WEMA 4CLBA 4N3WA 4NUEA 1EQFA 5F61A 3EB5A 3JVKA 5EP7A 5EWCA 4HXMA 2FUIA 4W4UA 2KWOA 1Z2QA 4AVXA 2YREA 5EWDA 4A9LA 2YQLA 2G4AA 5HENA 4N4IA 5FFWA 2DVQA 4DONA 4QSWA 2K16A 4L58A 5CQ4A 4J1PA 3KNVA 5E9LA 5D3JA 4I7DA 4YC9A 3KV5A 2F42A 5HFRA 4OUFA 4LK9A 5HFQA 1HYJA 4IR6A 2MA5A 5DYUA 4UP0A 4YBMA 4O7BA 1XWHA 4BW2A 5LCWB 2MD8C 2RSDA 4FLPA 2KTBB 4J3IA 4N4GA 3U5LA 3S92A 4TTEA 5LVRA 4YYHA 3ZTGA 4NR8A 2VJEB 4LKAA 4I7CA 4TKPB 3P1FA 5CUGA 3PUQA 3HMEA 2YEMA 5DKAA 5B77A 5H1TA 2KE1A 2K4DA 5B78A 5D24A 5FE2A 4TT4A 2DWWA 2YW5A 2E7NA 5F36A 3MXFA 5FE6A 4WZ0A 4QEUA 5H85A 5ENBA 5IIDA 3ZPVE 5DKCA 2OSSA 3ZVYA 3P1DA 2CKLA 1WIMA 4LLBA 1WEUA 4QSXA 2GRCA 3LQJA 5AMFA 5G0FA 5IGMA 2LGVA 5FE7A 4UYEA 2L80A 2LN0A 5L99A 5D26A 5D3HA 2ECNA 2OUOA 5CPEA 4LYIA 5TDWA 4A9KA 5EI4A 4YYNA 2D8SA 4YH4A 5C13A 4BHWA 1T1HA 4HBXA 3HCUA 3KV6A 5DLXA 4LZRA 5FB1A 5HQ6A 1WEPA 4YBSA 4ZC9A 3ZVZB 3U5PA 3PHDA 5G4RA 2ZETC 3UV2A 5A5NA 2NAAA 4Z6IA 5F60A 5D0CA 2VNFA 4QEVA 5II2A 2L84A 3U5NA 1WEQA 4O64A 4NRAA 5EWHA 3T7LA 5CRZA 5I89A 3L11A 4NXJA 4QF2A 2WP1A 4J0RA 1CHCA 4TS8A 2KWKA 3VK6A 3HTKC 3NG2A 1HYIA 3HCTA 2Y1NA 4NRBA 5A85A 5E9MA 2MA6A 3O35A 2E6SA 5B76A 5D3NA 3QZSA 3AQAA 4HXSA 2JMIA 2LDRA 5ACYA 2VPDA 5H9MA 4UYDA 4AKNA 5C7NA 5EK9A 5D25A 3AADA 5DLZA 5LKXA 5CY9A 4HXRA 2KIZA 2VJEA 4YY6A 2XB1A 4LR6A 4QUTA 3MHHA 2BAYA 2RNYA 3GG3A 3LXJA 3M62A 5CQAA 2G43A 5HCLA 5D3SA 4QSTA 5DFBA 2JRJA 3MULA 2EA6A 3U5KA 5HQ7A 1ZBDB 4QYLA 4NR6A 4YABA 2HYED 2LQ6A 5TABA 2C2LA 2DVVA 4Q0OA 3JVJA 3MUKA 4TT6A 4YYMA 4Z93A 4PKLA 4YH3A 5CTLA 5A81A 4QUUA 4Z1QA 5DW1A 5C87A 3I2DA 3IHPA 5FE9A 2YDWA 4TT2A 4AYCB 4S3OB 1X0JA 4Q0NA 3UV4A 4QSQA 4KV1A 2ECWA 2LGGA 5L8TA 5D3LA 3MB3A 2EODA 5EV9A 3DPLR 5FH7A 4HXKA 5K29A 3LRQA 2Y1MA 5TCMA 2DX8A 5II1A 2PNXA 4A9OA 2VPBA 3DWYA 4FO9A 4O74A 5CUEA 1VYXA 4Z6HA 3NXBA 4LJNA 5AIUA 1G25A 3O34A 2VPGA 5E74A 5CU8A 3LJWA 4PTBA 2KREA 5CQ7A 4BJXA 2KR4A 2MNYA 4LDFA 1WUGA 5FE3A 4YYKA 4F52B 4A9HA 5ENCA 2YT5A 4QR5A 3IU5A 2VPEA 3RPGB 4HXNA 5FH6A 2M1RA 4QEWA 5E9YA 5FE5A 4O7FA 2ECGA 1JM4B 2ECVA 5DX4A 4MEOA 2I7KA 5F1LA 1X4IA 2JMJA 4IR5A 3HMFA 5EGUA 4CCGX 4O76A 4ZQLA 3Q2EA 5JWMA 4ZUXU 5D3PA 4MEPA 5JG6A 4B7YC 3S91A 1X4UA 2RS9B 5EPRA 4QSVA 4O72A 4YBTA 4J0SA 4CL9A 5F25A 3JVMA 5KH9A 5L97A 4BBQA 5HEMA 4O7AA 5EWVA 3SVFA 4XI1A 5EICA 4Q6FA 2XEUA 4GNGA 2LSPB 5LJ0A 3G0LA 3SHBA 3O36A 2FUUA 2DVSA 4YAXA 4TQNA 5FG5A 5AMEA 3UVXA 1WENA 2L85A 5C89A 2JMDA 4LYWA 3N9PA 4WZ3B 4NUDA 5EU1A 5CQ3A 4CFKA 1DVPA 5E3DA 4AYCA 3K2JA 4QR4A 4UYGA 2K1JA 3LQIA 5A7CA 1WEVA 2CSYA 3TLPA 1MM2A 5CQ8A 5I7YA 4QSSA 5I86A 5DFCA 3P5OA 4NYVA 3FKMX 4OGIA 2EGPA 3MB4A 4NR4A 4FIPA 4HBVA 2WP2A 1WGMA 5C85A 1LDJB 2I50A 2YSMA 5EPSA 4CUSA 4XY8A 5EA1A 4C9ZA 3ONIA 2YYRA 3SOWA 4OGJA 5F1HA 2H0DB 4WHWA 5J0DA 4WHUA 2VJFA 3UVDA 4NR5A 1U6GB 4GB0A 2N9GA 4TU4A 3HMHA 3P1CA 5CFWA 5DBMA 2RI7A 5FDZA 3ASLA 5I1QA 5A5PA 5FE0A 2AN6A 5CGPA 3KQIA 4YYJA 5BT4A 5L8UA 2HDPA 2YQMA 1VFYA 2LRIC 4XYAA 2Y43A 4UYFB 4QR3A 3O7AA 4QNSA 5J3XA 4E96A 4PS5A 4WIVA 5CUAA 5KTXA 3ZPV1 2RO1A 5I40A 4O77A 5EISA 5A5RA 5BT5A 1JSPB 2QJ0A 4NUCA 1X4JA 4QC1A 2MIQA 2CSZA 3RCWA 4CUQA 4PCEA 5IGLA 1F62A 4MENA 4UYHA 5ETBA 2MUMA 4CFLA 4LZ2A 5HELA 4C66A 4NN2A 4AP4A 4UIUA 5B75A 4IOQA 4ZW1A 5IG6A 1N87A 1WUMA 1JM7B 4NYWA 4IORA 5G05B 5ETDA 5KU3A 3SVGA 5HRXA 2DKWA 5LVQA 1IYMA 3ZYUA 5LKTA 4BW3A 4HBYA 4WZ2A 4UP5A 4UITA 3O70A 5COIA 2LGKA 3MQMA 4GPJA 5LJ2A 4B86C 2CT2A 5E7DA 2OXQC 5DY7A 2ECJA 4C67A 3GV4A 5FE1A 3N9NA 1ZS5A 4MSXA 5HLSA 4AUQB 2G6QA 2MJVB 5L96A 3SVHA 4R8PK 5C11A 4YATA 3U5JA 5E9KA 3SOXA 1FBVA 4NR7A 2ECTA 3QZTA 5TRBA 5CQ6A 4S3OC 5D1LB 5TDRA 2R0SA 3O37A 4MR6A 5A82A 4R7EA 2YHOA 2H0DA 5CP5A 4O78A 5KTWA 4IC2A 4XUBA 2C2VS 4CUUA 4HXOA 2QICA 5EPBA 4O75A 5CUCA 5E0RA 4UIYA 2VJFB 2YURA 4A9FA 5ENIA 2R0VA 4NYXA 4ALHA 4UYFA 5DFDA 2KGGA 2KWNA 1E6IA 5KTUA 4PPEA 3ZNIA 4O70A 4QSPA 5EYAF 4PY6A 3N9QA 4QBMA 4A0CD 1WFKA 5LUUA 5FB0A 3UV5A 4MEQA 5H1UA 4NQNA 3C5KA 4YYGA 1WESA 5I88A 4UI9B 5G04B 2L0BA 4LADB 2F6JA 3GL6A 5CUDA 5LKUA 3RPGC 4HBWA 5KH3A 4MR5A 5HJCA 5DYAA 4P5OB 1JM7A 5AD3A 2D9EA 1F68A 5L98A 4YYIA 3JVLA 1Z60A 4ZDTA 3SOUA 5B79A 2LGLA 4TYLA 5B8DA 5D7XA 2KFTA 2LV9A 5HRWA 3C6WA 5G4SA 2YEKA 5D3TA 5FEYA 1E4UA 3G0JA 5DKDA 2E6RA 4V3KC 5D1KB 4CURA 5DYXA 2YELA 5FH8A 3EB6A 1Z6UA 5C4QA 4MR4A 2FSAA 3U5OA 2LXHC 5EVAA 2E7OA 4GNEA 2MT5A 4O7CA 5ENEA 5CQ5A 5DKHA 4MVTA 4V3LC 3N9LA 4YK0A 4CA1A 5CUBA 5AITA 4QSUA 4NQMA 2QIZA 4PCIA 4QF3A 4NS5A 3FL2A 3N9MA 1V87A 4FJCA 5IGKA 4QY4A 5E9IA 3IU6A 2MNZA 2KYUA 3N9OA 3P1EA 4TZ2A 4TU6A 5A5QA 5I80A 2YW8A 4UIVA 4IR4A 5JI8A 4QB3A 2KGIA 3T6RA 1JOCA 3HCSA 4L7XA
chains in the Genus database with same CATH superfamily
4O71A 4BW1A 2YU4A 5FFVA 5F62A 5FG6A 1BORA 1RMDA 4IR3A 5DW2A 5I7XA 5LKZA 4A9MA 2M6MA 3D7CA 3I3JA 5ENJA 2DATA 2I8NA 4XY9A 1LDKC 3ZYQA 3D1BA 3QZVA 1N72A 2F6NA 1WEEA 5C8GA 4A4BA 5CZGA 5H1VA 1VD4A 2DVRA 5ENFA 2M3HA 4QZSA 5E3GA 5ENGA 4CUTA 5E9VA 5A83A 2OWAA 3RTRB 2P57A 2RNWA 1WE9A 2OO1A 4GNFA 4LYSA 3FAOA 2UZGA 5TBNA 5KH7A 4R2YA 5D1MB 5EQ1A 5I83A 2K17A 2D82A 4A9EA 5EM3A 3DAIA 5A5OA 4QYDA 1MM3A 3Q2FA 2KWJA 2YUCA 3LQHA 5TB6A 4UIXA 3O33A 5K3QA 4IOOA 2E3KA 2EJNA 2ECIA 5FE4A 4F3IA 3M63A 2L5UA 5ENHA 2H60A 4QSRA 5A5SA 5HQ5A 4O7EA 4A49A 4X3GA 4LRGA 1K2FA 5FE8A 2CSVA 4A9JA 5AD2A 1WILA 4IC3A 2YYNA 4N4HA 3MHSA 4GNDA 4HXLA 4YY4A 4LC2A 3UVYA 2L75A 3L1XA 5DINA 5I3LA 4Z1SA 4MR3A 5DYCA 2EXUA 5FERA 5F3AA 3O47A 4QC3A 2MD7B 5EWWA 2M13A 2NXBA 4UIWA 4Y03A 5E73A 4A4CA 5F2PA 3LJUX 1WEOA 2R0YA 4XUAA 4YADA 3M99A 2VP7A 2RFJA 4N4FA 3PURA 2YQDA 2L43A 2YSJA 4NR9A 2KU3A 4YYDA 4RVRA 5CS8A 5CRMA 3DQVR 2L5EA 2R10A 4HXPA 5CQTA 5D3RA 5BT3A 5HRVA 5KO4A 4TZ8A 2PUYA 4ALGA 4KV4A 4A9IA 4NRCA 2M85A 4BW4A 1FP0A 2LXPC 4X2IA 2IQJA 5IBNA 2CKLB 5HM0A 2RR4A 4I7BA 2XOYA 5I29A 3UW9A 4OGCA 2G45A 4A9NA 4LZSA 5FFYA 4CUPA 5IGNA 5KHMA 1WEWA 2RNXA 3UVWA 5F5ZA 3V43A 3U5MA 4KCXA 2IDAA 5FG4A 2CRRA 4FK5A 2FFWA 3L1ZB 4WA6A 5FBXA 5F63A 5LJ1A 2JM3A 2YHNA 4UIZA 4AI6A 1WEMA 4CLBA 4N3WA 4NUEA 1EQFA 5F61A 3EB5A 3JVKA 5EP7A 5EWCA 4HXMA 2FUIA 4W4UA 2FD4A 1Z2QA 2KWOA 4AVXA 2YREA 2L7PA 5EWDA 4A9LA 2YQLA 2G4AA 5HENA 2LAUA 3KDEC 4N4IA 5FFWA 2DVQA 4DONA 4QSWA 2K16A 4L58A 5CQ4A 4J1PA 3KNVA 3LVQE 5E9LA 5D3JA 4I7DA 4YC9A 3KV5A 2F42A 5HFRA 4OUFA 4LK9A 5HFQA 1HYJA 4IR6A 2MA5A 5DYUA 4UP0A 3ERRA 3M7KA 4YBMA 4O7BA 1XWHA 2CONA 4BW2A 3MDBC 5LCWB 2MD8C 2RSDA 4FLPA 2KTBB 4J3IA 4N4GA 3U5LA 3S92A 4TTEA 5LVRA 4YYHA 3ZTGA 4NR8A 2VJEB 4LKAA 4I7CA 4TKPB 3P1FA 5CUGA 3PUQA 3HMEA 3Q1DA 2YEMA 5DKAA 5B77A 5H1TA 2KE1A 2K4DA 5B78A 5D24A 5FE2A 4TT4A 2E7NA 2YW5A 2DWWA 5F36A 2KKXA 3MXFA 5FE6A 3E2DA 4WZ0A 4QEUA 5H85A 5ENBA 5IIDA 3ZPVE 2B0OE 5DKCA 2OSSA 3ZVYA 3P1DA 2CKLA 1WIMA 3PLWA 1WEUA 4LLBA 4QSXA 2GRCA 3LQJA 5AMFA 4AKIA 5G0FA 5IGMA 2LGVA 5FE7A 1MBMA 4UYEA 2L80A 2LN0A 5L99A 5D26A 5D3HA 2ECNA 2JUNA 2OUOA 5CPEA 4LYIA 5TDWA 4A9KA 5EI4A 4YYNA 2D8SA 4YH4A 5C13A 4BHWA 1T1HA 4HBXA 3HCUA 4AKGA 5DLXA 3KV6A 4LZRA 5FB1A 5HQ6A 1WEPA 4YBSA 4ZC9A 3ZVZB 3U5PA 3PHDA 5G4RA 2ZETC 3UV2A 5A5NA 2NAAA 4Z6IA 5F60A 5D0CA 2VNFA 4QEVA 5II2A 2L84A 3U5NA 1WEQA 3DWDA 4NRAA 5EWHA 4O64A 5SVYA 3T7LA 3D1DA 2DSMA 5CRZA 5I89A 3L11A 4NXJA 4QF2A 2WP1A 4J0RA 1CHCA 4TS8A 2KWKA 3VK6A 3HTKC 3NG2A 1HYIA 3HCTA 2Y1NA 4NRBA 5A85A 3LVRE 5E9MA 2MA6A 3O35A 2E6SA 5B76A 2EGMA 5D3NA 3QZSA 3AQAA 4HXSA 2JMIA 2LDRA 5ACYA 2VPDA 5H9MA 4UYDA 4AKNA 5C7NA 2D8UA 5EK9A 5D25A 3AADA 5DLZA 5LKXA 5CY9A 4HXRA 2KIZA 2VJEA 4YY6A 2XB1A 4LR6A 4QUTA 3MHHA 2BAYA 2RNYA 3GG3A 3LXJA 3M62A 5CQAA 2G43A 5HCLA 5D3SA 4QSTA 5DFBA 2JRJA 3MULA 2EA6A 3U5KA 5HQ7A 1ZBDB 2E61A 4QYLA 4NR6A 4YABA 2HYED 2LQ6A 5TABA 2C2LA 3FANA 2DVVA 4Q0OA 3JVJA 3MUKA 4TT6A 4YYMA 4PKLA 4YH3A 4Z93A 5CTLA 5A81A 4QUUA 4Z1QA 5DW1A 5C87A 3I2DA 3IHPA 5FE9A 2YDWA 4TT2A 4AYCB 4S3OB 2KKYA 1X0JA 4Q0NA 3UV4A 4QSQA 4KV1A 2ECWA 2LGGA 5L8TA 5D3LA 3MB3A 2EODA 5EV9A 3DPLR 5FH7A 4HXKA 5K29A 3LRQA 2Y1MA 5TCMA 2DX8A 5II1A 2PNXA 4A9OA 3FM8C 2VPBA 3DWYA 4FO9A 4O74A 5CUEA 1VYXA 4Z6HA 3NXBA 3DDTA 4LJNA 5AIUA 1G25A 3O34A 2VPGA 5E74A 5CU8A 3LJWA 4PTBA 2KREA 5CQ7A 4BJXA 2KR4A 2MNYA 4LDFA 1WUGA 5FE3A 4YYKA 4F52B 4A9HA 5ENCA 2YT5A 4QR5A 3IU5A 2VPEA 3RPGB 4HXNA 5FH6A 2M1RA 4QEWA 5E9YA 5FE5A 4O7FA 2ECGA 1JM4B 2ECVA 2XOCA 5DX4A 4MEOA 2I7KA 5F1LA 1X4IA 2JMJA 4IR5A 3HMFA 5EGUA 2YVRA 4CCGX 4O76A 4ZQLA 3Q2EA 5JWMA 4ZUXU 5D3PA 4MEPA 5JG6A 4B7YC 3S91A 1X4UA 2RS9B 5EPRA 4OGEA 4QSVA 4O72A 4YBTA 4J0SA 4CL9A 5F25A 3JVMA 5KH9A 5L97A 4BBQA 5HEMA 4O7AA 5EWVA 3SVFA 4XI1A 5EICA 4Q6FA 2XEUA 4GNGA 2LSPB 5LJ0A 3G0LA 3SHBA 3O36A 5SVIA 3H7HA 3SUBA 2FUUA 2DVSA 4YAXA 4TQNA 5FG5A 5AMEA 3UVXA 1DCQA 1WENA 2L85A 5C89A 2JMDA 4LYWA 3N9PA 4WZ3B 4NUDA 5EU1A 5CQ3A 4CFKA 1DVPA 5E3DA 2MKEA 4AYCA 3K2JA 4QR4A 4UYGA 2K1JA 3LQIA 5A7CA 1WEVA 2CSYA 3TLPA 1MM2A 5CQ8A 5I7YA 4QSSA 5I86A 5DFCA 3P5OA 3T9KA 4NYVA 3FKMX 4OGIA 2EGPA 3MB4A 4NR4A 3LDYA 4FIPA 4HBVA 2WP2A 1WGMA 5C85A 1LDJB 2I50A 2YSMA 5EPSA 4CUSA 4XY8A 5EA1A 4C9ZA 3ONIA 2YYRA 3SOWA 4OGJA 5F1HA 2H0DB 4WHWA 5J0DA 4WHUA 2VJFA 3UVDA 1ZKRA 4NR5A 1U6GB 4GB0A 2XP0A 2N9GA 4TU4A 3HMHA 3P1CA 5CFWA 2CRWA 5DBMA 2RI7A 5FDZA 3ASLA 5I1QA 5A5PA 5FE0A 2AN6A 5CGPA 3KQIA 4YYJA 5BT4A 5L8UA 2HDPA 2YQMA 1VFYA 2LRIC 4XYAA 2Y43A 4H9DA 4UYFB 4QR3A 3O7AA 4QNSA 5J3XA 4E96A 4PS5A 4WIVA 5CUAA 3VKHA 5KTXA 3ZPV1 2RO1A 5I40A 4O77A 5EISA 5A5RA 5BT5A 1JSPB 4AKHA 2QJ0A 4NUCA 1X4JA 4QC1A 2MIQA 2CSZA 3RCWA 4CUQA 4PCEA 5IGLA 1F62A 4MENA 4UYHA 5ETBA 2MUMA 4CFLA 4LZ2A 5HELA 4C66A 4NN2A 4AP4A 4UIUA 5B75A 4IOQA 4ZW1A 5IG6A 1N87A 1WUMA 1JM7B 4NYWA 4IORA 5G05B 5ETDA 5KU3A 3SVGA 5HRXA 2DKWA 5LVQA 1IYMA 3ZYUA 5LKTA 4BW3A 4HBYA 4WZ2A 4UP5A 4UITA 3O70A 5COIA 2LGKA 3MQMA 4GPJA 5LJ2A 5SVIB 4B86C 2CT2A 5E7DA 2OXQC 5DY7A 2ECJA 4C67A 3GV4A 5FE1A 3N9NA 1ZS5A 3FEHA 5HLSA 4MSXA 2G6QA 4AUQB 2MJVB 5L96A 3SVHA 4R8PK 5C11A 4YATA 3U5JA 5E9KA 3SOXA 1FBVA 4NR7A 2ECTA 5SVXA 3QZTA 5TRBA 5CQ6A 4S3OC 5D1LB 5TDRA 2R0SA 3O37A 4MR6A 5A82A 4R7EA 2YHOA 2H0DA 5CP5A 4O78A 5KTWA 4IC2A 4XUBA 2C2VS 4CUUA 4HXOA 2QICA 5EPBA 4O75A 5CUCA 5E0RA 4UIYA 2VJFB 2YURA 4A9FA 5ENIA 2R0VA 4NYXA 4ALHA 4UYFA 5DFDA 2KGGA 2KWNA 1E6IA 5KTUA 3VKGA 4PPEA 3ZNIA 4O70A 4QSPA 5EYAF 4PY6A 3N9QA 4QBMA 4A0CD 1WFKA 5LUUA 4F1PA 5FB0A 3UV5A 4MEQA 5H1UA 4NQNA 3C5KA 4YYGA 1WESA 5I88A 4UI9B 5G04B 2L0BA 4LADB 2F6JA 3GL6A 5CUDA 5LKUA 3RPGC 4HBWA 5KH3A 4MR5A 5HJCA 5DYAA 4P5OB 1JM7A 5AD3A 2D9EA 1F68A 5L98A 4YYIA 3JVLA 1Z60A 4ZDTA 3SOUA 5B79A 2LGLA 4TYLA 5B8DA 3FJUB 5D7XA 2KFTA 2LV9A 5HRWA 3C6WA 5G4SA 2YEKA 5D3TA 5FEYA 1E4UA 3G0JA 5DKDA 2E6RA 4V3KC 5D1KB 4CURA 5DYXA 2YELA 5FH8A 3EB6A 2DJAA 1Z6UA 5C4QA 4Z0RA 4MR4A 4Z0OA 2FSAA 3U5OA 2LXHC 5EVAA 2E7OA 4GNEA 2MT5A 4O7CA 5ENEA 5CQ5A 5DKHA 4MVTA 4V3LC 3N9LA 4YK0A 4CA1A 5CUBA 5AITA 4QSUA 4NQMA 2QIZA 4O62A 4PCIA 4QF3A 4NS5A 3FL2A 3N9MA 1V87A 3JUEA 4FJCA 5IGKA 4QY4A 5E9IA 3IU6A 2MNZA 2KYUA 3N9OA 3P1EA 4TZ2A 4TU6A 2XOZA 5A5QA 1PUOA 5I80A 4UIVA 2YW8A 4QQ4A 4IR4A 5JI8A 4QB3A 2KGIA 3T6RA 1JOCA 3HCSA 4L7XA
chains in the Genus database with same CATH topology
4O71A 4BW1A 2YU4A 5FFVA 5F62A 5FG6A 1BORA 1RMDA 4IR3A 5DW2A 5I7XA 5LKZA 4A9MA 2M6MA 3D7CA 3I3JA 5ENJA 2DATA 2I8NA 4XY9A 1LDKC 3ZYQA 3QZVA 1N72A 2F6NA 1WEEA 5C8GA 4A4BA 5CZGA 5H1VA 1VD4A 2DVRA 5ENFA 2M3HA 4QZSA 5E3GA 5ENGA 4CUTA 5E9VA 5A83A 3RTRB 2RNWA 1WE9A 2OO1A 4GNFA 4LYSA 2UZGA 5TBNA 5KH7A 4R2YA 5D1MB 5EQ1A 5I83A 2K17A 2D82A 4A9EA 5EM3A 3DAIA 5A5OA 4QYDA 1MM3A 3Q2FA 2KWJA 2YUCA 3LQHA 5TB6A 4UIXA 3O33A 4IOOA 2E3KA 2ECIA 5FE4A 4F3IA 3M63A 2L5UA 5ENHA 2H60A 4QSRA 5A5SA 5HQ5A 4O7EA 4A49A 4X3GA 4LRGA 1K2FA 5FE8A 4A9JA 5AD2A 1WILA 4IC3A 2YYNA 4N4HA 3MHSA 4GNDA 4HXLA 4YY4A 4LC2A 3UVYA 2L75A 3L1XA 5DINA 5I3LA 4Z1SA 4MR3A 5DYCA 5FERA 5F3AA 4QC3A 2MD7B 5EWWA 2NXBA 4UIWA 4Y03A 5E73A 4A4CA 5F2PA 1WEOA 2R0YA 4XUAA 4YADA 3M99A 2VP7A 2RFJA 4N4FA 3PURA 2YQDA 2L43A 2YSJA 4NR9A 2KU3A 4YYDA 4RVRA 5CS8A 5CRMA 3DQVR 2L5EA 2R10A 4HXPA 5CQTA 5D3RA 5BT3A 5HRVA 5KO4A 4TZ8A 2PUYA 4ALGA 4KV4A 4A9IA 4NRCA 2M85A 4BW4A 1FP0A 2LXPC 4X2IA 5IBNA 2CKLB 5HM0A 4I7BA 5I29A 3UW9A 2G45A 4A9NA 4LZSA 5FFYA 4CUPA 5IGNA 5KHMA 1WEWA 2RNXA 3UVWA 5F5ZA 3V43A 3U5MA 4KCXA 2IDAA 5FG4A 4FK5A 3L1ZB 4WA6A 5FBXA 5F63A 5LJ1A 2YHNA 4UIZA 1WEMA 4CLBA 4N3WA 4NUEA 1EQFA 5F61A 3EB5A 3JVKA 5EP7A 5EWCA 4HXMA 2FUIA 4W4UA 2KWOA 1Z2QA 4AVXA 2YREA 5EWDA 4A9LA 2YQLA 2G4AA 5HENA 4N4IA 5FFWA 2DVQA 4DONA 4QSWA 2K16A 4L58A 5CQ4A 4J1PA 3KNVA 5E9LA 5D3JA 4I7DA 4YC9A 3KV5A 2F42A 5HFRA 4OUFA 4LK9A 5HFQA 1HYJA 4IR6A 2MA5A 5DYUA 4UP0A 4YBMA 4O7BA 1XWHA 4BW2A 5LCWB 2MD8C 2RSDA 4FLPA 2KTBB 4J3IA 4N4GA 3U5LA 3S92A 4TTEA 5LVRA 4YYHA 3ZTGA 4NR8A 2VJEB 4LKAA 4I7CA 4TKPB 3P1FA 5CUGA 3PUQA 3HMEA 2YEMA 5DKAA 5B77A 5H1TA 2KE1A 2K4DA 5B78A 5D24A 5FE2A 4TT4A 2DWWA 2YW5A 2E7NA 5F36A 3MXFA 5FE6A 4WZ0A 4QEUA 5H85A 5ENBA 5IIDA 3ZPVE 5DKCA 2OSSA 3ZVYA 3P1DA 2CKLA 1WIMA 4LLBA 1WEUA 4QSXA 2GRCA 3LQJA 5AMFA 5G0FA 5IGMA 2LGVA 5FE7A 4UYEA 2L80A 2LN0A 5L99A 5D26A 5D3HA 2ECNA 2OUOA 5CPEA 4LYIA 5TDWA 4A9KA 5EI4A 4YYNA 2D8SA 4YH4A 5C13A 4BHWA 1T1HA 4HBXA 3HCUA 3KV6A 5DLXA 4LZRA 5FB1A 5HQ6A 1WEPA 4YBSA 4ZC9A 3ZVZB 3U5PA 3PHDA 5G4RA 2ZETC 3UV2A 5A5NA 2NAAA 4Z6IA 5F60A 5D0CA 2VNFA 4QEVA 5II2A 2L84A 3U5NA 1WEQA 4O64A 4NRAA 5EWHA 3T7LA 5CRZA 5I89A 3L11A 4NXJA 4QF2A 2WP1A 4J0RA 1CHCA 4TS8A 2KWKA 3VK6A 3HTKC 3NG2A 1HYIA 3HCTA 2Y1NA 4NRBA 5A85A 5E9MA 2MA6A 3O35A 2E6SA 5B76A 5D3NA 3QZSA 3AQAA 4HXSA 2JMIA 2LDRA 5ACYA 2VPDA 5H9MA 4UYDA 4AKNA 5C7NA 5EK9A 5D25A 3AADA 5DLZA 5LKXA 5CY9A 4HXRA 2KIZA 2VJEA 4YY6A 2XB1A 4LR6A 4QUTA 3MHHA 2BAYA 2RNYA 3GG3A 3LXJA 3M62A 5CQAA 2G43A 5HCLA 5D3SA 4QSTA 5DFBA 2JRJA 3MULA 2EA6A 3U5KA 5HQ7A 1ZBDB 4QYLA 4NR6A 4YABA 2HYED 2LQ6A 5TABA 2C2LA 2DVVA 4Q0OA 3JVJA 3MUKA 4TT6A 4YYMA 4Z93A 4PKLA 4YH3A 5CTLA 5A81A 4QUUA 4Z1QA 5DW1A 5C87A 3I2DA 3IHPA 5FE9A 2YDWA 4TT2A 4AYCB 4S3OB 1X0JA 4Q0NA 3UV4A 4QSQA 4KV1A 2ECWA 2LGGA 5L8TA 5D3LA 3MB3A 2EODA 5EV9A 3DPLR 5FH7A 4HXKA 5K29A 3LRQA 2Y1MA 5TCMA 2DX8A 5II1A 2PNXA 4A9OA 2VPBA 3DWYA 4FO9A 4O74A 5CUEA 1VYXA 4Z6HA 3NXBA 4LJNA 5AIUA 1G25A 3O34A 2VPGA 5E74A 5CU8A 3LJWA 4PTBA 2KREA 5CQ7A 4BJXA 2KR4A 2MNYA 4LDFA 1WUGA 5FE3A 4YYKA 4F52B 4A9HA 5ENCA 2YT5A 4QR5A 3IU5A 2VPEA 3RPGB 4HXNA 5FH6A 2M1RA 4QEWA 5E9YA 5FE5A 4O7FA 2ECGA 1JM4B 2ECVA 5DX4A 4MEOA 2I7KA 5F1LA 1X4IA 2JMJA 4IR5A 3HMFA 5EGUA 4CCGX 4O76A 4ZQLA 3Q2EA 5JWMA 4ZUXU 5D3PA 4MEPA 5JG6A 4B7YC 3S91A 1X4UA 2RS9B 5EPRA 4QSVA 4O72A 4YBTA 4J0SA 4CL9A 5F25A 3JVMA 5KH9A 5L97A 4BBQA 5HEMA 4O7AA 5EWVA 3SVFA 4XI1A 5EICA 4Q6FA 2XEUA 4GNGA 2LSPB 5LJ0A 3G0LA 3SHBA 3O36A 2FUUA 2DVSA 4YAXA 4TQNA 5FG5A 5AMEA 3UVXA 1WENA 2L85A 5C89A 2JMDA 4LYWA 3N9PA 4WZ3B 4NUDA 5EU1A 5CQ3A 4CFKA 1DVPA 5E3DA 4AYCA 3K2JA 4QR4A 4UYGA 2K1JA 3LQIA 5A7CA 1WEVA 2CSYA 3TLPA 1MM2A 5CQ8A 5I7YA 4QSSA 5I86A 5DFCA 3P5OA 4NYVA 3FKMX 4OGIA 2EGPA 3MB4A 4NR4A 4FIPA 4HBVA 2WP2A 1WGMA 5C85A 1LDJB 2I50A 2YSMA 5EPSA 4CUSA 4XY8A 5EA1A 4C9ZA 3ONIA 2YYRA 3SOWA 4OGJA 5F1HA 2H0DB 4WHWA 5J0DA 4WHUA 2VJFA 3UVDA 4NR5A 1U6GB 4GB0A 2N9GA 4TU4A 3HMHA 3P1CA 5CFWA 5DBMA 2RI7A 5FDZA 3ASLA 5I1QA 5A5PA 5FE0A 2AN6A 5CGPA 3KQIA 4YYJA 5BT4A 5L8UA 2HDPA 2YQMA 1VFYA 2LRIC 4XYAA 2Y43A 4UYFB 4QR3A 3O7AA 4QNSA 5J3XA 4E96A 4PS5A 4WIVA 5CUAA 5KTXA 3ZPV1 2RO1A 5I40A 4O77A 5EISA 5A5RA 5BT5A 1JSPB 2QJ0A 4NUCA 1X4JA 4QC1A 2MIQA 2CSZA 3RCWA 4CUQA 4PCEA 5IGLA 1F62A 4MENA 4UYHA 5ETBA 2MUMA 4CFLA 4LZ2A 5HELA 4C66A 4NN2A 4AP4A 4UIUA 5B75A 4IOQA 4ZW1A 5IG6A 1N87A 1WUMA 1JM7B 4NYWA 4IORA 5G05B 5ETDA 5KU3A 3SVGA 5HRXA 2DKWA 5LVQA 1IYMA 3ZYUA 5LKTA 4BW3A 4HBYA 4WZ2A 4UP5A 4UITA 3O70A 5COIA 2LGKA 3MQMA 4GPJA 5LJ2A 4B86C 2CT2A 5E7DA 2OXQC 5DY7A 2ECJA 4C67A 3GV4A 5FE1A 3N9NA 1ZS5A 4MSXA 5HLSA 4AUQB 2G6QA 2MJVB 5L96A 3SVHA 4R8PK 5C11A 4YATA 3U5JA 5E9KA 3SOXA 1FBVA 4NR7A 2ECTA 3QZTA 5TRBA 5CQ6A 4S3OC 5D1LB 5TDRA 2R0SA 3O37A 4MR6A 5A82A 4R7EA 2YHOA 2H0DA 5CP5A 4O78A 5KTWA 4IC2A 4XUBA 2C2VS 4CUUA 4HXOA 2QICA 5EPBA 4O75A 5CUCA 5E0RA 4UIYA 2VJFB 2YURA 4A9FA 5ENIA 2R0VA 4NYXA 4ALHA 4UYFA 5DFDA 2KGGA 2KWNA 1E6IA 5KTUA 4PPEA 3ZNIA 4O70A 4QSPA 5EYAF 4PY6A 3N9QA 4QBMA 4A0CD 1WFKA 5LUUA 5FB0A 3UV5A 4MEQA 5H1UA 4NQNA 3C5KA 4YYGA 1WESA 5I88A 4UI9B 5G04B 2L0BA 4LADB 2F6JA 3GL6A 5CUDA 5LKUA 3RPGC 4HBWA 5KH3A 4MR5A 5HJCA 5DYAA 4P5OB 1JM7A 5AD3A 2D9EA 1F68A 5L98A 4YYIA 3JVLA 1Z60A 4ZDTA 3SOUA 5B79A 2LGLA 4TYLA 5B8DA 5D7XA 2KFTA 2LV9A 5HRWA 3C6WA 5G4SA 2YEKA 5D3TA 5FEYA 1E4UA 3G0JA 5DKDA 2E6RA 4V3KC 5D1KB 4CURA 5DYXA 2YELA 5FH8A 3EB6A 1Z6UA 5C4QA 4MR4A 2FSAA 3U5OA 2LXHC 5EVAA 2E7OA 4GNEA 2MT5A 4O7CA 5ENEA 5CQ5A 5DKHA 4MVTA 4V3LC 3N9LA 4YK0A 4CA1A 5CUBA 5AITA 4QSUA 4NQMA 2QIZA 4PCIA 4QF3A 4NS5A 3FL2A 3N9MA 1V87A 4FJCA 5IGKA 4QY4A 5E9IA 3IU6A 2MNZA 2KYUA 3N9OA 3P1EA 4TZ2A 4TU6A 5A5QA 5I80A 2YW8A 4UIVA 4IR4A 5JI8A 4QB3A 2KGIA 3T6RA 1JOCA 3HCSA 4L7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O71 A;  4BW1 A;  2YU4 A;  5FFV A;  5F62 A;  5FG6 A;  1BOR A;  1RMD A;  4IR3 A;  5DW2 A;  5I7X A;  5LKZ A;  4A9M A;  2M6M A;  3D7C A;  3I3J A;  5ENJ A;  2DAT A;  2I8N A;  4XY9 A;  1LDK C;  3ZYQ A;  3QZV A;  1N72 A;  2F6N A;  1WEE A;  5C8G A;  4A4B A;  5CZG A;  5H1V A;  1VD4 A;  2DVR A;  5ENF A;  2M3H A;  4QZS A;  5E3G A;  5ENG A;  4CUT A;  5E9V A;  5A83 A;  3RTR B;  2RNW A;  1WE9 A;  2OO1 A;  4GNF A;  4LYS A;  2UZG A;  5TBN A;  5KH7 A;  4R2Y A;  5D1M B;  5EQ1 A;  5I83 A;  2K17 A;  2D82 A;  4A9E A;  5EM3 A;  3DAI A;  5A5O A;  4QYD A;  1MM3 A;  3Q2F A;  2KWJ A;  2YUC A;  3LQH A;  5TB6 A;  4UIX A;  3O33 A;  4IOO A;  2E3K A;  2ECI A;  5FE4 A;  4F3I A;  3M63 A;  2L5U A;  5ENH A;  2H60 A;  4QSR A;  5A5S A;  5HQ5 A;  4O7E A;  4A49 A;  4X3G A;  4LRG A;  1K2F A;  5FE8 A;  4A9J A;  5AD2 A;  1WIL A;  4IC3 A;  2YYN A;  4N4H A;  3MHS A;  4GND A;  4HXL A;  4YY4 A;  4LC2 A;  3UVY A;  2L75 A;  3L1X A;  5DIN A;  5I3L A;  4Z1S A;  4MR3 A;  5DYC A;  5FER A;  5F3A A;  4QC3 A;  2MD7 B;  5EWW A;  2NXB A;  4UIW A;  4Y03 A;  5E73 A;  4A4C A;  5F2P A;  1WEO A;  2R0Y A;  4XUA A;  4YAD A;  3M99 A;  2VP7 A;  2RFJ A;  4N4F A;  3PUR A;  2YQD A;  2L43 A;  2YSJ A;  4NR9 A;  2KU3 A;  4YYD A;  4RVR A;  5CS8 A;  5CRM A;  3DQV R;  2L5E A;  2R10 A;  4HXP A;  5CQT A;  5D3R A;  5BT3 A;  5HRV A;  5KO4 A;  4TZ8 A;  2PUY A;  4ALG A;  4KV4 A;  4A9I A;  4NRC A;  2M85 A;  4BW4 A;  1FP0 A;  2LXP C;  4X2I A;  5IBN A;  2CKL B;  5HM0 A;  4I7B A;  5I29 A;  3UW9 A;  2G45 A;  4A9N A;  4LZS A;  5FFY A;  4CUP A;  5IGN A;  5KHM A;  1WEW A;  2RNX A;  3UVW A;  5F5Z A;  3V43 A;  3U5M A;  4KCX A;  2IDA A;  5FG4 A;  4FK5 A;  3L1Z B;  4WA6 A;  5FBX A;  5F63 A;  5LJ1 A;  2YHN A;  4UIZ A;  1WEM A;  4CLB A;  4N3W A;  4NUE A;  1EQF A;  5F61 A;  3EB5 A;  3JVK A;  5EP7 A;  5EWC A;  4HXM A;  2FUI A;  4W4U A;  2KWO A;  1Z2Q A;  4AVX A;  2YRE A;  5EWD A;  4A9L A;  2YQL A;  2G4A A;  5HEN A;  4N4I A;  5FFW A;  2DVQ A;  4DON A;  4QSW A;  2K16 A;  4L58 A;  5CQ4 A;  4J1P A;  3KNV A;  5E9L A;  5D3J A;  4I7D A;  4YC9 A;  3KV5 A;  2F42 A;  5HFR A;  4OUF A;  4LK9 A;  5HFQ A;  1HYJ A;  4IR6 A;  2MA5 A;  5DYU A;  4UP0 A;  4YBM A;  4O7B A;  1XWH A;  4BW2 A;  5LCW B;  2MD8 C;  2RSD A;  4FLP A;  2KTB B;  4J3I A;  4N4G A;  3U5L A;  3S92 A;  4TTE A;  5LVR A;  4YYH A;  3ZTG A;  4NR8 A;  2VJE B;  4LKA A;  4I7C A;  4TKP B;  3P1F A;  5CUG A;  3PUQ A;  3HME A;  2YEM A;  5DKA A;  5B77 A;  5H1T A;  2KE1 A;  2K4D A;  5B78 A;  5D24 A;  5FE2 A;  4TT4 A;  2DWW A;  2YW5 A;  2E7N A;  5F36 A;  3MXF A;  5FE6 A;  4WZ0 A;  4QEU A;  5H85 A;  5ENB A;  5IID A;  3ZPV E;  5DKC A;  2OSS A;  3ZVY A;  3P1D A;  2CKL A;  1WIM A;  4LLB A;  1WEU A;  4QSX A;  2GRC A;  3LQJ A;  5AMF A;  5G0F A;  5IGM A;  2LGV A;  5FE7 A;  4UYE A;  2L80 A;  2LN0 A;  5L99 A;  5D26 A;  5D3H A;  2ECN A;  2OUO A;  5CPE A;  4LYI A;  5TDW A;  4A9K A;  5EI4 A;  4YYN A;  2D8S A;  4YH4 A;  5C13 A;  4BHW A;  1T1H A;  4HBX A;  3HCU A;  3KV6 A;  5DLX A;  4LZR A;  5FB1 A;  5HQ6 A;  1WEP A;  4YBS A;  4ZC9 A;  3ZVZ B;  3U5P A;  3PHD A;  5G4R A;  2ZET C;  3UV2 A;  5A5N A;  2NAA A;  4Z6I A;  5F60 A;  5D0C A;  2VNF A;  4QEV A;  5II2 A;  2L84 A;  3U5N A;  1WEQ A;  4O64 A;  4NRA A;  5EWH A;  3T7L A;  5CRZ A;  5I89 A;  3L11 A;  4NXJ A;  4QF2 A;  2WP1 A;  4J0R A;  1CHC A;  4TS8 A;  2KWK A;  3VK6 A;  3HTK C;  3NG2 A;  1HYI A;  3HCT A;  2Y1N A;  4NRB A;  5A85 A;  5E9M A;  2MA6 A;  3O35 A;  2E6S A;  5B76 A;  5D3N A;  3QZS A;  3AQA A;  4HXS A;  2JMI A;  2LDR A;  5ACY A;  2VPD A;  5H9M A;  4UYD A;  4AKN A;  5C7N A;  5EK9 A;  5D25 A;  3AAD A;  5DLZ A;  5LKX A;  5CY9 A;  4HXR A;  2KIZ A;  2VJE A;  4YY6 A;  2XB1 A;  4LR6 A;  4QUT A;  3MHH A;  2BAY A;  2RNY A;  3GG3 A;  3LXJ A;  3M62 A;  5CQA A;  2G43 A;  5HCL A;  5D3S A;  4QST A;  5DFB A;  2JRJ A;  3MUL A;  2EA6 A;  3U5K A;  5HQ7 A;  1ZBD B;  4QYL A;  4NR6 A;  4YAB A;  2HYE D;  2LQ6 A;  5TAB A;  2C2L A;  2DVV A;  4Q0O A;  3JVJ A;  3MUK A;  4TT6 A;  4YYM A;  4Z93 A;  4PKL A;  4YH3 A;  5CTL A;  5A81 A;  4QUU A;  4Z1Q A;  5DW1 A;  5C87 A;  3I2D A;  3IHP A;  5FE9 A;  2YDW A;  4TT2 A;  4AYC B;  4S3O B;  1X0J A;  4Q0N A;  3UV4 A;  4QSQ A;  4KV1 A;  2ECW A;  2LGG A;  5L8T A;  5D3L A;  3MB3 A;  2EOD A;  5EV9 A;  3DPL R;  5FH7 A;  4HXK A;  5K29 A;  3LRQ A;  2Y1M A;  5TCM A;  2DX8 A;  5II1 A;  2PNX A;  4A9O A;  2VPB A;  3DWY A;  4FO9 A;  4O74 A;  5CUE A;  1VYX A;  4Z6H A;  3NXB A;  4LJN A;  5AIU A;  1G25 A;  3O34 A;  2VPG A;  5E74 A;  5CU8 A;  3LJW A;  4PTB A;  2KRE A;  5CQ7 A;  4BJX A;  2KR4 A;  2MNY A;  4LDF A;  1WUG A;  5FE3 A;  4YYK A;  4F52 B;  4A9H A;  5ENC A;  2YT5 A;  4QR5 A;  3IU5 A;  2VPE A;  3RPG B;  4HXN A;  5FH6 A;  2M1R A;  4QEW A;  5E9Y A;  5FE5 A;  4O7F A;  2ECG A;  1JM4 B;  2ECV A;  5DX4 A;  4MEO A;  2I7K A;  5F1L A;  1X4I A;  2JMJ A;  4IR5 A;  3HMF A;  5EGU A;  4CCG X;  4O76 A;  4ZQL A;  3Q2E A;  5JWM A;  4ZUX U;  5D3P A;  4MEP A;  5JG6 A;  4B7Y C;  3S91 A;  1X4U A;  2RS9 B;  5EPR A;  4QSV A;  4O72 A;  4YBT A;  4J0S A;  4CL9 A;  5F25 A;  3JVM A;  5KH9 A;  5L97 A;  4BBQ A;  5HEM A;  4O7A A;  5EWV A;  3SVF A;  4XI1 A;  5EIC A;  4Q6F A;  2XEU A;  4GNG A;  2LSP B;  5LJ0 A;  3G0L A;  3SHB A;  3O36 A;  2FUU A;  2DVS A;  4YAX A;  4TQN A;  5FG5 A;  5AME A;  3UVX A;  1WEN A;  2L85 A;  5C89 A;  2JMD A;  4LYW A;  3N9P A;  4WZ3 B;  4NUD A;  5EU1 A;  5CQ3 A;  4CFK A;  1DVP A;  5E3D A;  4AYC A;  3K2J A;  4QR4 A;  4UYG A;  2K1J A;  3LQI A;  5A7C A;  1WEV A;  2CSY A;  3TLP A;  1MM2 A;  5CQ8 A;  5I7Y A;  4QSS A;  5I86 A;  5DFC A;  3P5O A;  4NYV A;  3FKM X;  4OGI A;  2EGP A;  3MB4 A;  4NR4 A;  4FIP A;  4HBV A;  2WP2 A;  1WGM A;  5C85 A;  1LDJ B;  2I50 A;  2YSM A;  5EPS A;  4CUS A;  4XY8 A;  5EA1 A;  4C9Z A;  3ONI A;  2YYR A;  3SOW A;  4OGJ A;  5F1H A;  2H0D B;  4WHW A;  5J0D A;  4WHU A;  2VJF A;  3UVD A;  4NR5 A;  1U6G B;  4GB0 A;  2N9G A;  4TU4 A;  3HMH A;  3P1C A;  5CFW A;  5DBM A;  2RI7 A;  5FDZ A;  3ASL A;  5I1Q A;  5A5P A;  5FE0 A;  2AN6 A;  5CGP A;  3KQI A;  4YYJ A;  5BT4 A;  5L8U A;  2HDP A;  2YQM A;  1VFY A;  2LRI C;  4XYA A;  2Y43 A;  4UYF B;  4QR3 A;  3O7A A;  4QNS A;  5J3X A;  4E96 A;  4PS5 A;  4WIV A;  5CUA A;  5KTX A;  3ZPV 1;  2RO1 A;  5I40 A;  4O77 A;  5EIS A;  5A5R A;  5BT5 A;  1JSP B;  2QJ0 A;  4NUC A;  1X4J A;  4QC1 A;  2MIQ A;  2CSZ A;  3RCW A;  4CUQ A;  4PCE A;  5IGL A;  1F62 A;  4MEN A;  4UYH A;  5ETB A;  2MUM A;  4CFL A;  4LZ2 A;  5HEL A;  4C66 A;  4NN2 A;  4AP4 A;  4UIU A;  5B75 A;  4IOQ A;  4ZW1 A;  5IG6 A;  1N87 A;  1WUM A;  1JM7 B;  4NYW A;  4IOR A;  5G05 B;  5ETD A;  5KU3 A;  3SVG A;  5HRX A;  2DKW A;  5LVQ A;  1IYM A;  3ZYU A;  5LKT A;  4BW3 A;  4HBY A;  4WZ2 A;  4UP5 A;  4UIT A;  3O70 A;  5COI A;  2LGK A;  3MQM A;  4GPJ A;  5LJ2 A;  4B86 C;  2CT2 A;  5E7D A;  2OXQ C;  5DY7 A;  2ECJ A;  4C67 A;  3GV4 A;  5FE1 A;  3N9N A;  1ZS5 A;  4MSX A;  5HLS A;  4AUQ B;  2G6Q A;  2MJV B;  5L96 A;  3SVH A;  4R8P K;  5C11 A;  4YAT A;  3U5J A;  5E9K A;  3SOX A;  1FBV A;  4NR7 A;  2ECT A;  3QZT A;  5TRB A;  5CQ6 A;  4S3O C;  5D1L B;  5TDR A;  2R0S A;  3O37 A;  4MR6 A;  5A82 A;  4R7E A;  2YHO A;  2H0D A;  5CP5 A;  4O78 A;  5KTW A;  4IC2 A;  4XUB A;  2C2V S;  4CUU A;  4HXO A;  2QIC A;  5EPB A;  4O75 A;  5CUC A;  5E0R A;  4UIY A;  2VJF B;  2YUR A;  4A9F A;  5ENI A;  2R0V A;  4NYX A;  4ALH A;  4UYF A;  5DFD A;  2KGG A;  2KWN A;  1E6I A;  5KTU A;  4PPE A;  3ZNI A;  4O70 A;  4QSP A;  5EYA F;  4PY6 A;  3N9Q A;  4QBM A;  4A0C D;  1WFK A;  5LUU A;  5FB0 A;  3UV5 A;  4MEQ A;  5H1U A;  4NQN A;  3C5K A;  4YYG A;  1WES A;  5I88 A;  4UI9 B;  5G04 B;  2L0B A;  4LAD B;  2F6J A;  3GL6 A;  5CUD A;  5LKU A;  3RPG C;  4HBW A;  5KH3 A;  4MR5 A;  5HJC A;  5DYA A;  4P5O B;  1JM7 A;  5AD3 A;  2D9E A;  1F68 A;  5L98 A;  4YYI A;  3JVL A;  1Z60 A;  4ZDT A;  3SOU A;  5B79 A;  2LGL A;  4TYL A;  5B8D A;  5D7X A;  2KFT A;  2LV9 A;  5HRW A;  3C6W A;  5G4S A;  2YEK A;  5D3T A;  5FEY A;  1E4U A;  3G0J A;  5DKD A;  2E6R A;  4V3K C;  5D1K B;  4CUR A;  5DYX A;  2YEL A;  5FH8 A;  3EB6 A;  1Z6U A;  5C4Q A;  4MR4 A;  2FSA A;  3U5O A;  2LXH C;  5EVA A;  2E7O A;  4GNE A;  2MT5 A;  4O7C A;  5ENE A;  5CQ5 A;  5DKH A;  4MVT A;  4V3L C;  3N9L A;  4YK0 A;  4CA1 A;  5CUB A;  5AIT A;  4QSU A;  4NQM A;  2QIZ A;  4PCI A;  4QF3 A;  4NS5 A;  3FL2 A;  3N9M A;  1V87 A;  4FJC A;  5IGK A;  4QY4 A;  5E9I A;  3IU6 A;  2MNZ A;  2KYU A;  3N9O A;  3P1E A;  4TZ2 A;  4TU6 A;  5A5Q A;  5I80 A;  2YW8 A;  4UIV A;  4IR4 A;  5JI8 A;  4QB3 A;  2KGI A;  3T6R A;  1JOC A;  3HCS A;  4L7X A; 
#chains in the Genus database with same CATH topology
 4O71 A;  4BW1 A;  2YU4 A;  5FFV A;  5F62 A;  5FG6 A;  1BOR A;  1RMD A;  4IR3 A;  5DW2 A;  5I7X A;  5LKZ A;  4A9M A;  2M6M A;  3D7C A;  3I3J A;  5ENJ A;  2DAT A;  2I8N A;  4XY9 A;  1LDK C;  3ZYQ A;  3D1B A;  3QZV A;  1N72 A;  2F6N A;  1WEE A;  5C8G A;  4A4B A;  5CZG A;  5H1V A;  1VD4 A;  2DVR A;  5ENF A;  2M3H A;  4QZS A;  5E3G A;  5ENG A;  4CUT A;  5E9V A;  5A83 A;  2OWA A;  3RTR B;  2P57 A;  2RNW A;  1WE9 A;  2OO1 A;  4GNF A;  4LYS A;  3FAO A;  2UZG A;  5TBN A;  5KH7 A;  4R2Y A;  5D1M B;  5EQ1 A;  5I83 A;  2K17 A;  2D82 A;  4A9E A;  5EM3 A;  3DAI A;  5A5O A;  4QYD A;  1MM3 A;  3Q2F A;  2KWJ A;  2YUC A;  3LQH A;  5TB6 A;  4UIX A;  3O33 A;  5K3Q A;  4IOO A;  2E3K A;  2EJN A;  2ECI A;  5FE4 A;  4F3I A;  3M63 A;  2L5U A;  5ENH A;  2H60 A;  4QSR A;  5A5S A;  5HQ5 A;  4O7E A;  4A49 A;  4X3G A;  4LRG A;  1K2F A;  5FE8 A;  2CSV A;  4A9J A;  5AD2 A;  1WIL A;  4IC3 A;  2YYN A;  4N4H A;  3MHS A;  4GND A;  4HXL A;  4YY4 A;  4LC2 A;  3UVY A;  2L75 A;  3L1X A;  5DIN A;  5I3L A;  4Z1S A;  4MR3 A;  5DYC A;  2EXU A;  5FER A;  5F3A A;  3O47 A;  4QC3 A;  2MD7 B;  5EWW A;  2M13 A;  2NXB A;  4UIW A;  4Y03 A;  5E73 A;  4A4C A;  5F2P A;  3LJU X;  1WEO A;  2R0Y A;  4XUA A;  4YAD A;  3M99 A;  2VP7 A;  2RFJ A;  4N4F A;  3PUR A;  2YQD A;  2L43 A;  2YSJ A;  4NR9 A;  2KU3 A;  4YYD A;  4RVR A;  5CS8 A;  5CRM A;  3DQV R;  2L5E A;  2R10 A;  4HXP A;  5CQT A;  5D3R A;  5BT3 A;  5HRV A;  5KO4 A;  4TZ8 A;  2PUY A;  4ALG A;  4KV4 A;  4A9I A;  4NRC A;  2M85 A;  4BW4 A;  1FP0 A;  2LXP C;  4X2I A;  2IQJ A;  5IBN A;  2CKL B;  5HM0 A;  2RR4 A;  4I7B A;  2XOY A;  5I29 A;  3UW9 A;  4OGC A;  2G45 A;  4A9N A;  4LZS A;  5FFY A;  4CUP A;  5IGN A;  5KHM A;  1WEW A;  2RNX A;  3UVW A;  5F5Z A;  3V43 A;  3U5M A;  4KCX A;  2IDA A;  5FG4 A;  2CRR A;  4FK5 A;  2FFW A;  3L1Z B;  4WA6 A;  5FBX A;  5F63 A;  5LJ1 A;  2JM3 A;  2YHN A;  4UIZ A;  4AI6 A;  1WEM A;  4CLB A;  4N3W A;  4NUE A;  1EQF A;  5F61 A;  3EB5 A;  3JVK A;  5EP7 A;  5EWC A;  4HXM A;  2FUI A;  4W4U A;  2FD4 A;  1Z2Q A;  2KWO A;  4AVX A;  2YRE A;  2L7P A;  5EWD A;  4A9L A;  2YQL A;  2G4A A;  5HEN A;  2LAU A;  3KDE C;  4N4I A;  5FFW A;  2DVQ A;  4DON A;  4QSW A;  2K16 A;  4L58 A;  5CQ4 A;  4J1P A;  3KNV A;  3LVQ E;  5E9L A;  5D3J A;  4I7D A;  4YC9 A;  3KV5 A;  2F42 A;  5HFR A;  4OUF A;  4LK9 A;  5HFQ A;  1HYJ A;  4IR6 A;  2MA5 A;  5DYU A;  4UP0 A;  3ERR A;  3M7K A;  4YBM A;  4O7B A;  1XWH A;  2CON A;  4BW2 A;  3MDB C;  5LCW B;  2MD8 C;  2RSD A;  4FLP A;  2KTB B;  4J3I A;  4N4G A;  3U5L A;  3S92 A;  4TTE A;  5LVR A;  4YYH A;  3ZTG A;  4NR8 A;  2VJE B;  4LKA A;  4I7C A;  4TKP B;  3P1F A;  5CUG A;  3PUQ A;  3HME A;  3Q1D A;  2YEM A;  5DKA A;  5B77 A;  5H1T A;  2KE1 A;  2K4D A;  5B78 A;  5D24 A;  5FE2 A;  4TT4 A;  2E7N A;  2YW5 A;  2DWW A;  5F36 A;  2KKX A;  3MXF A;  5FE6 A;  3E2D A;  4WZ0 A;  4QEU A;  5H85 A;  5ENB A;  5IID A;  3ZPV E;  2B0O E;  5DKC A;  2OSS A;  3ZVY A;  3P1D A;  2CKL A;  1WIM A;  3PLW A;  1WEU A;  4LLB A;  4QSX A;  2GRC A;  3LQJ A;  5AMF A;  4AKI A;  5G0F A;  5IGM A;  2LGV A;  5FE7 A;  1MBM A;  4UYE A;  2L80 A;  2LN0 A;  5L99 A;  5D26 A;  5D3H A;  2ECN A;  2JUN A;  2OUO A;  5CPE A;  4LYI A;  5TDW A;  4A9K A;  5EI4 A;  4YYN A;  2D8S A;  4YH4 A;  5C13 A;  4BHW A;  1T1H A;  4HBX A;  3HCU A;  4AKG A;  5DLX A;  3KV6 A;  4LZR A;  5FB1 A;  5HQ6 A;  1WEP A;  4YBS A;  4ZC9 A;  3ZVZ B;  3U5P A;  3PHD A;  5G4R A;  2ZET C;  3UV2 A;  5A5N A;  2NAA A;  4Z6I A;  5F60 A;  5D0C A;  2VNF A;  4QEV A;  5II2 A;  2L84 A;  3U5N A;  1WEQ A;  3DWD A;  4NRA A;  5EWH A;  4O64 A;  5SVY A;  3T7L A;  3D1D A;  2DSM A;  5CRZ A;  5I89 A;  3L11 A;  4NXJ A;  4QF2 A;  2WP1 A;  4J0R A;  1CHC A;  4TS8 A;  2KWK A;  3VK6 A;  3HTK C;  3NG2 A;  1HYI A;  3HCT A;  2Y1N A;  4NRB A;  5A85 A;  3LVR E;  5E9M A;  2MA6 A;  3O35 A;  2E6S A;  5B76 A;  2EGM A;  5D3N A;  3QZS A;  3AQA A;  4HXS A;  2JMI A;  2LDR A;  5ACY A;  2VPD A;  5H9M A;  4UYD A;  4AKN A;  5C7N A;  2D8U A;  5EK9 A;  5D25 A;  3AAD A;  5DLZ A;  5LKX A;  5CY9 A;  4HXR A;  2KIZ A;  2VJE A;  4YY6 A;  2XB1 A;  4LR6 A;  4QUT A;  3MHH A;  2BAY A;  2RNY A;  3GG3 A;  3LXJ A;  3M62 A;  5CQA A;  2G43 A;  5HCL A;  5D3S A;  4QST A;  5DFB A;  2JRJ A;  3MUL A;  2EA6 A;  3U5K A;  5HQ7 A;  1ZBD B;  2E61 A;  4QYL A;  4NR6 A;  4YAB A;  2HYE D;  2LQ6 A;  5TAB A;  2C2L A;  3FAN A;  2DVV A;  4Q0O A;  3JVJ A;  3MUK A;  4TT6 A;  4YYM A;  4PKL A;  4YH3 A;  4Z93 A;  5CTL A;  5A81 A;  4QUU A;  4Z1Q A;  5DW1 A;  5C87 A;  3I2D A;  3IHP A;  5FE9 A;  2YDW A;  4TT2 A;  4AYC B;  4S3O B;  2KKY A;  1X0J A;  4Q0N A;  3UV4 A;  4QSQ A;  4KV1 A;  2ECW A;  2LGG A;  5L8T A;  5D3L A;  3MB3 A;  2EOD A;  5EV9 A;  3DPL R;  5FH7 A;  4HXK A;  5K29 A;  3LRQ A;  2Y1M A;  5TCM A;  2DX8 A;  5II1 A;  2PNX A;  4A9O A;  3FM8 C;  2VPB A;  3DWY A;  4FO9 A;  4O74 A;  5CUE A;  1VYX A;  4Z6H A;  3NXB A;  3DDT A;  4LJN A;  5AIU A;  1G25 A;  3O34 A;  2VPG A;  5E74 A;  5CU8 A;  3LJW A;  4PTB A;  2KRE A;  5CQ7 A;  4BJX A;  2KR4 A;  2MNY A;  4LDF A;  1WUG A;  5FE3 A;  4YYK A;  4F52 B;  4A9H A;  5ENC A;  2YT5 A;  4QR5 A;  3IU5 A;  2VPE A;  3RPG B;  4HXN A;  5FH6 A;  2M1R A;  4QEW A;  5E9Y A;  5FE5 A;  4O7F A;  2ECG A;  1JM4 B;  2ECV A;  2XOC A;  5DX4 A;  4MEO A;  2I7K A;  5F1L A;  1X4I A;  2JMJ A;  4IR5 A;  3HMF A;  5EGU A;  2YVR A;  4CCG X;  4O76 A;  4ZQL A;  3Q2E A;  5JWM A;  4ZUX U;  5D3P A;  4MEP A;  5JG6 A;  4B7Y C;  3S91 A;  1X4U A;  2RS9 B;  5EPR A;  4OGE A;  4QSV A;  4O72 A;  4YBT A;  4J0S A;  4CL9 A;  5F25 A;  3JVM A;  5KH9 A;  5L97 A;  4BBQ A;  5HEM A;  4O7A A;  5EWV A;  3SVF A;  4XI1 A;  5EIC A;  4Q6F A;  2XEU A;  4GNG A;  2LSP B;  5LJ0 A;  3G0L A;  3SHB A;  3O36 A;  5SVI A;  3H7H A;  3SUB A;  2FUU A;  2DVS A;  4YAX A;  4TQN A;  5FG5 A;  5AME A;  3UVX A;  1DCQ A;  1WEN A;  2L85 A;  5C89 A;  2JMD A;  4LYW A;  3N9P A;  4WZ3 B;  4NUD A;  5EU1 A;  5CQ3 A;  4CFK A;  1DVP A;  5E3D A;  2MKE A;  4AYC A;  3K2J A;  4QR4 A;  4UYG A;  2K1J A;  3LQI A;  5A7C A;  1WEV A;  2CSY A;  3TLP A;  1MM2 A;  5CQ8 A;  5I7Y A;  4QSS A;  5I86 A;  5DFC A;  3P5O A;  3T9K A;  4NYV A;  3FKM X;  4OGI A;  2EGP A;  3MB4 A;  4NR4 A;  3LDY A;  4FIP A;  4HBV A;  2WP2 A;  1WGM A;  5C85 A;  1LDJ B;  2I50 A;  2YSM A;  5EPS A;  4CUS A;  4XY8 A;  5EA1 A;  4C9Z A;  3ONI A;  2YYR A;  3SOW A;  4OGJ A;  5F1H A;  2H0D B;  4WHW A;  5J0D A;  4WHU A;  2VJF A;  3UVD A;  1ZKR A;  4NR5 A;  1U6G B;  4GB0 A;  2XP0 A;  2N9G A;  4TU4 A;  3HMH A;  3P1C A;  5CFW A;  2CRW A;  5DBM A;  2RI7 A;  5FDZ A;  3ASL A;  5I1Q A;  5A5P A;  5FE0 A;  2AN6 A;  5CGP A;  3KQI A;  4YYJ A;  5BT4 A;  5L8U A;  2HDP A;  2YQM A;  1VFY A;  2LRI C;  4XYA A;  2Y43 A;  4H9D A;  4UYF B;  4QR3 A;  3O7A A;  4QNS A;  5J3X A;  4E96 A;  4PS5 A;  4WIV A;  5CUA A;  3VKH A;  5KTX A;  3ZPV 1;  2RO1 A;  5I40 A;  4O77 A;  5EIS A;  5A5R A;  5BT5 A;  1JSP B;  4AKH A;  2QJ0 A;  4NUC A;  1X4J A;  4QC1 A;  2MIQ A;  2CSZ A;  3RCW A;  4CUQ A;  4PCE A;  5IGL A;  1F62 A;  4MEN A;  4UYH A;  5ETB A;  2MUM A;  4CFL A;  4LZ2 A;  5HEL A;  4C66 A;  4NN2 A;  4AP4 A;  4UIU A;  5B75 A;  4IOQ A;  4ZW1 A;  5IG6 A;  1N87 A;  1WUM A;  1JM7 B;  4NYW A;  4IOR A;  5G05 B;  5ETD A;  5KU3 A;  3SVG A;  5HRX A;  2DKW A;  5LVQ A;  1IYM A;  3ZYU A;  5LKT A;  4BW3 A;  4HBY A;  4WZ2 A;  4UP5 A;  4UIT A;  3O70 A;  5COI A;  2LGK A;  3MQM A;  4GPJ A;  5LJ2 A;  5SVI B;  4B86 C;  2CT2 A;  5E7D A;  2OXQ C;  5DY7 A;  2ECJ A;  4C67 A;  3GV4 A;  5FE1 A;  3N9N A;  1ZS5 A;  3FEH A;  5HLS A;  4MSX A;  2G6Q A;  4AUQ B;  2MJV B;  5L96 A;  3SVH A;  4R8P K;  5C11 A;  4YAT A;  3U5J A;  5E9K A;  3SOX A;  1FBV A;  4NR7 A;  2ECT A;  5SVX A;  3QZT A;  5TRB A;  5CQ6 A;  4S3O C;  5D1L B;  5TDR A;  2R0S A;  3O37 A;  4MR6 A;  5A82 A;  4R7E A;  2YHO A;  2H0D A;  5CP5 A;  4O78 A;  5KTW A;  4IC2 A;  4XUB A;  2C2V S;  4CUU A;  4HXO A;  2QIC A;  5EPB A;  4O75 A;  5CUC A;  5E0R A;  4UIY A;  2VJF B;  2YUR A;  4A9F A;  5ENI A;  2R0V A;  4NYX A;  4ALH A;  4UYF A;  5DFD A;  2KGG A;  2KWN A;  1E6I A;  5KTU A;  3VKG A;  4PPE A;  3ZNI A;  4O70 A;  4QSP A;  5EYA F;  4PY6 A;  3N9Q A;  4QBM A;  4A0C D;  1WFK A;  5LUU A;  4F1P A;  5FB0 A;  3UV5 A;  4MEQ A;  5H1U A;  4NQN A;  3C5K A;  4YYG A;  1WES A;  5I88 A;  4UI9 B;  5G04 B;  2L0B A;  4LAD B;  2F6J A;  3GL6 A;  5CUD A;  5LKU A;  3RPG C;  4HBW A;  5KH3 A;  4MR5 A;  5HJC A;  5DYA A;  4P5O B;  1JM7 A;  5AD3 A;  2D9E A;  1F68 A;  5L98 A;  4YYI A;  3JVL A;  1Z60 A;  4ZDT A;  3SOU A;  5B79 A;  2LGL A;  4TYL A;  5B8D A;  3FJU B;  5D7X A;  2KFT A;  2LV9 A;  5HRW A;  3C6W A;  5G4S A;  2YEK A;  5D3T A;  5FEY A;  1E4U A;  3G0J A;  5DKD A;  2E6R A;  4V3K C;  5D1K B;  4CUR A;  5DYX A;  2YEL A;  5FH8 A;  3EB6 A;  2DJA A;  1Z6U A;  5C4Q A;  4Z0R A;  4MR4 A;  4Z0O A;  2FSA A;  3U5O A;  2LXH C;  5EVA A;  2E7O A;  4GNE A;  2MT5 A;  4O7C A;  5ENE A;  5CQ5 A;  5DKH A;  4MVT A;  4V3L C;  3N9L A;  4YK0 A;  4CA1 A;  5CUB A;  5AIT A;  4QSU A;  4NQM A;  2QIZ A;  4O62 A;  4PCI A;  4QF3 A;  4NS5 A;  3FL2 A;  3N9M A;  1V87 A;  3JUE A;  4FJC A;  5IGK A;  4QY4 A;  5E9I A;  3IU6 A;  2MNZ A;  2KYU A;  3N9O A;  3P1E A;  4TZ2 A;  4TU6 A;  2XOZ A;  5A5Q A;  1PUO A;  5I80 A;  4UIV A;  2YW8 A;  4QQ4 A;  4IR4 A;  5JI8 A;  4QB3 A;  2KGI A;  3T6R A;  1JOC A;  3HCS A;  4L7X A; 
#chains in the Genus database with same CATH homology
 4O71 A;  4BW1 A;  2YU4 A;  5FFV A;  5F62 A;  5FG6 A;  1BOR A;  1RMD A;  4IR3 A;  5DW2 A;  5I7X A;  5LKZ A;  4A9M A;  2M6M A;  3D7C A;  3I3J A;  5ENJ A;  2DAT A;  2I8N A;  4XY9 A;  1LDK C;  3ZYQ A;  3QZV A;  1N72 A;  2F6N A;  1WEE A;  5C8G A;  4A4B A;  5CZG A;  5H1V A;  1VD4 A;  2DVR A;  5ENF A;  2M3H A;  4QZS A;  5E3G A;  5ENG A;  4CUT A;  5E9V A;  5A83 A;  3RTR B;  2RNW A;  1WE9 A;  2OO1 A;  4GNF A;  4LYS A;  2UZG A;  5TBN A;  5KH7 A;  4R2Y A;  5D1M B;  5EQ1 A;  5I83 A;  2K17 A;  2D82 A;  4A9E A;  5EM3 A;  3DAI A;  5A5O A;  4QYD A;  1MM3 A;  3Q2F A;  2KWJ A;  2YUC A;  3LQH A;  5TB6 A;  4UIX A;  3O33 A;  4IOO A;  2E3K A;  2ECI A;  5FE4 A;  4F3I A;  3M63 A;  2L5U A;  5ENH A;  2H60 A;  4QSR A;  5A5S A;  5HQ5 A;  4O7E A;  4A49 A;  4X3G A;  4LRG A;  1K2F A;  5FE8 A;  4A9J A;  5AD2 A;  1WIL A;  4IC3 A;  2YYN A;  4N4H A;  3MHS A;  4GND A;  4HXL A;  4YY4 A;  4LC2 A;  3UVY A;  2L75 A;  3L1X A;  5DIN A;  5I3L A;  4Z1S A;  4MR3 A;  5DYC A;  5FER A;  5F3A A;  4QC3 A;  2MD7 B;  5EWW A;  2NXB A;  4UIW A;  4Y03 A;  5E73 A;  4A4C A;  5F2P A;  1WEO A;  2R0Y A;  4XUA A;  4YAD A;  3M99 A;  2VP7 A;  2RFJ A;  4N4F A;  3PUR A;  2YQD A;  2L43 A;  2YSJ A;  4NR9 A;  2KU3 A;  4YYD A;  4RVR A;  5CS8 A;  5CRM A;  3DQV R;  2L5E A;  2R10 A;  4HXP A;  5CQT A;  5D3R A;  5BT3 A;  5HRV A;  5KO4 A;  4TZ8 A;  2PUY A;  4ALG A;  4KV4 A;  4A9I A;  4NRC A;  2M85 A;  4BW4 A;  1FP0 A;  2LXP C;  4X2I A;  5IBN A;  2CKL B;  5HM0 A;  4I7B A;  5I29 A;  3UW9 A;  2G45 A;  4A9N A;  4LZS A;  5FFY A;  4CUP A;  5IGN A;  5KHM A;  1WEW A;  2RNX A;  3UVW A;  5F5Z A;  3V43 A;  3U5M A;  4KCX A;  2IDA A;  5FG4 A;  4FK5 A;  3L1Z B;  4WA6 A;  5FBX A;  5F63 A;  5LJ1 A;  2YHN A;  4UIZ A;  1WEM A;  4CLB A;  4N3W A;  4NUE A;  1EQF A;  5F61 A;  3EB5 A;  3JVK A;  5EP7 A;  5EWC A;  4HXM A;  2FUI A;  4W4U A;  2KWO A;  1Z2Q A;  4AVX A;  2YRE A;  5EWD A;  4A9L A;  2YQL A;  2G4A A;  5HEN A;  4N4I A;  5FFW A;  2DVQ A;  4DON A;  4QSW A;  2K16 A;  4L58 A;  5CQ4 A;  4J1P A;  3KNV A;  5E9L A;  5D3J A;  4I7D A;  4YC9 A;  3KV5 A;  2F42 A;  5HFR A;  4OUF A;  4LK9 A;  5HFQ A;  1HYJ A;  4IR6 A;  2MA5 A;  5DYU A;  4UP0 A;  4YBM A;  4O7B A;  1XWH A;  4BW2 A;  5LCW B;  2MD8 C;  2RSD A;  4FLP A;  2KTB B;  4J3I A;  4N4G A;  3U5L A;  3S92 A;  4TTE A;  5LVR A;  4YYH A;  3ZTG A;  4NR8 A;  2VJE B;  4LKA A;  4I7C A;  4TKP B;  3P1F A;  5CUG A;  3PUQ A;  3HME A;  2YEM A;  5DKA A;  5B77 A;  5H1T A;  2KE1 A;  2K4D A;  5B78 A;  5D24 A;  5FE2 A;  4TT4 A;  2DWW A;  2YW5 A;  2E7N A;  5F36 A;  3MXF A;  5FE6 A;  4WZ0 A;  4QEU A;  5H85 A;  5ENB A;  5IID A;  3ZPV E;  5DKC A;  2OSS A;  3ZVY A;  3P1D A;  2CKL A;  1WIM A;  4LLB A;  1WEU A;  4QSX A;  2GRC A;  3LQJ A;  5AMF A;  5G0F A;  5IGM A;  2LGV A;  5FE7 A;  4UYE A;  2L80 A;  2LN0 A;  5L99 A;  5D26 A;  5D3H A;  2ECN A;  2OUO A;  5CPE A;  4LYI A;  5TDW A;  4A9K A;  5EI4 A;  4YYN A;  2D8S A;  4YH4 A;  5C13 A;  4BHW A;  1T1H A;  4HBX A;  3HCU A;  3KV6 A;  5DLX A;  4LZR A;  5FB1 A;  5HQ6 A;  1WEP A;  4YBS A;  4ZC9 A;  3ZVZ B;  3U5P A;  3PHD A;  5G4R A;  2ZET C;  3UV2 A;  5A5N A;  2NAA A;  4Z6I A;  5F60 A;  5D0C A;  2VNF A;  4QEV A;  5II2 A;  2L84 A;  3U5N A;  1WEQ A;  4O64 A;  4NRA A;  5EWH A;  3T7L A;  5CRZ A;  5I89 A;  3L11 A;  4NXJ A;  4QF2 A;  2WP1 A;  4J0R A;  1CHC A;  4TS8 A;  2KWK A;  3VK6 A;  3HTK C;  3NG2 A;  1HYI A;  3HCT A;  2Y1N A;  4NRB A;  5A85 A;  5E9M A;  2MA6 A;  3O35 A;  2E6S A;  5B76 A;  5D3N A;  3QZS A;  3AQA A;  4HXS A;  2JMI A;  2LDR A;  5ACY A;  2VPD A;  5H9M A;  4UYD A;  4AKN A;  5C7N A;  5EK9 A;  5D25 A;  3AAD A;  5DLZ A;  5LKX A;  5CY9 A;  4HXR A;  2KIZ A;  2VJE A;  4YY6 A;  2XB1 A;  4LR6 A;  4QUT A;  3MHH A;  2BAY A;  2RNY A;  3GG3 A;  3LXJ A;  3M62 A;  5CQA A;  2G43 A;  5HCL A;  5D3S A;  4QST A;  5DFB A;  2JRJ A;  3MUL A;  2EA6 A;  3U5K A;  5HQ7 A;  1ZBD B;  4QYL A;  4NR6 A;  4YAB A;  2HYE D;  2LQ6 A;  5TAB A;  2C2L A;  2DVV A;  4Q0O A;  3JVJ A;  3MUK A;  4TT6 A;  4YYM A;  4Z93 A;  4PKL A;  4YH3 A;  5CTL A;  5A81 A;  4QUU A;  4Z1Q A;  5DW1 A;  5C87 A;  3I2D A;  3IHP A;  5FE9 A;  2YDW A;  4TT2 A;  4AYC B;  4S3O B;  1X0J A;  4Q0N A;  3UV4 A;  4QSQ A;  4KV1 A;  2ECW A;  2LGG A;  5L8T A;  5D3L A;  3MB3 A;  2EOD A;  5EV9 A;  3DPL R;  5FH7 A;  4HXK A;  5K29 A;  3LRQ A;  2Y1M A;  5TCM A;  2DX8 A;  5II1 A;  2PNX A;  4A9O A;  2VPB A;  3DWY A;  4FO9 A;  4O74 A;  5CUE A;  1VYX A;  4Z6H A;  3NXB A;  4LJN A;  5AIU A;  1G25 A;  3O34 A;  2VPG A;  5E74 A;  5CU8 A;  3LJW A;  4PTB A;  2KRE A;  5CQ7 A;  4BJX A;  2KR4 A;  2MNY A;  4LDF A;  1WUG A;  5FE3 A;  4YYK A;  4F52 B;  4A9H A;  5ENC A;  2YT5 A;  4QR5 A;  3IU5 A;  2VPE A;  3RPG B;  4HXN A;  5FH6 A;  2M1R A;  4QEW A;  5E9Y A;  5FE5 A;  4O7F A;  2ECG A;  1JM4 B;  2ECV A;  5DX4 A;  4MEO A;  2I7K A;  5F1L A;  1X4I A;  2JMJ A;  4IR5 A;  3HMF A;  5EGU A;  4CCG X;  4O76 A;  4ZQL A;  3Q2E A;  5JWM A;  4ZUX U;  5D3P A;  4MEP A;  5JG6 A;  4B7Y C;  3S91 A;  1X4U A;  2RS9 B;  5EPR A;  4QSV A;  4O72 A;  4YBT A;  4J0S A;  4CL9 A;  5F25 A;  3JVM A;  5KH9 A;  5L97 A;  4BBQ A;  5HEM A;  4O7A A;  5EWV A;  3SVF A;  4XI1 A;  5EIC A;  4Q6F A;  2XEU A;  4GNG A;  2LSP B;  5LJ0 A;  3G0L A;  3SHB A;  3O36 A;  2FUU A;  2DVS A;  4YAX A;  4TQN A;  5FG5 A;  5AME A;  3UVX A;  1WEN A;  2L85 A;  5C89 A;  2JMD A;  4LYW A;  3N9P A;  4WZ3 B;  4NUD A;  5EU1 A;  5CQ3 A;  4CFK A;  1DVP A;  5E3D A;  4AYC A;  3K2J A;  4QR4 A;  4UYG A;  2K1J A;  3LQI A;  5A7C A;  1WEV A;  2CSY A;  3TLP A;  1MM2 A;  5CQ8 A;  5I7Y A;  4QSS A;  5I86 A;  5DFC A;  3P5O A;  4NYV A;  3FKM X;  4OGI A;  2EGP A;  3MB4 A;  4NR4 A;  4FIP A;  4HBV A;  2WP2 A;  1WGM A;  5C85 A;  1LDJ B;  2I50 A;  2YSM A;  5EPS A;  4CUS A;  4XY8 A;  5EA1 A;  4C9Z A;  3ONI A;  2YYR A;  3SOW A;  4OGJ A;  5F1H A;  2H0D B;  4WHW A;  5J0D A;  4WHU A;  2VJF A;  3UVD A;  4NR5 A;  1U6G B;  4GB0 A;  2N9G A;  4TU4 A;  3HMH A;  3P1C A;  5CFW A;  5DBM A;  2RI7 A;  5FDZ A;  3ASL A;  5I1Q A;  5A5P A;  5FE0 A;  2AN6 A;  5CGP A;  3KQI A;  4YYJ A;  5BT4 A;  5L8U A;  2HDP A;  2YQM A;  1VFY A;  2LRI C;  4XYA A;  2Y43 A;  4UYF B;  4QR3 A;  3O7A A;  4QNS A;  5J3X A;  4E96 A;  4PS5 A;  4WIV A;  5CUA A;  5KTX A;  3ZPV 1;  2RO1 A;  5I40 A;  4O77 A;  5EIS A;  5A5R A;  5BT5 A;  1JSP B;  2QJ0 A;  4NUC A;  1X4J A;  4QC1 A;  2MIQ A;  2CSZ A;  3RCW A;  4CUQ A;  4PCE A;  5IGL A;  1F62 A;  4MEN A;  4UYH A;  5ETB A;  2MUM A;  4CFL A;  4LZ2 A;  5HEL A;  4C66 A;  4NN2 A;  4AP4 A;  4UIU A;  5B75 A;  4IOQ A;  4ZW1 A;  5IG6 A;  1N87 A;  1WUM A;  1JM7 B;  4NYW A;  4IOR A;  5G05 B;  5ETD A;  5KU3 A;  3SVG A;  5HRX A;  2DKW A;  5LVQ A;  1IYM A;  3ZYU A;  5LKT A;  4BW3 A;  4HBY A;  4WZ2 A;  4UP5 A;  4UIT A;  3O70 A;  5COI A;  2LGK A;  3MQM A;  4GPJ A;  5LJ2 A;  4B86 C;  2CT2 A;  5E7D A;  2OXQ C;  5DY7 A;  2ECJ A;  4C67 A;  3GV4 A;  5FE1 A;  3N9N A;  1ZS5 A;  4MSX A;  5HLS A;  4AUQ B;  2G6Q A;  2MJV B;  5L96 A;  3SVH A;  4R8P K;  5C11 A;  4YAT A;  3U5J A;  5E9K A;  3SOX A;  1FBV A;  4NR7 A;  2ECT A;  3QZT A;  5TRB A;  5CQ6 A;  4S3O C;  5D1L B;  5TDR A;  2R0S A;  3O37 A;  4MR6 A;  5A82 A;  4R7E A;  2YHO A;  2H0D A;  5CP5 A;  4O78 A;  5KTW A;  4IC2 A;  4XUB A;  2C2V S;  4CUU A;  4HXO A;  2QIC A;  5EPB A;  4O75 A;  5CUC A;  5E0R A;  4UIY A;  2VJF B;  2YUR A;  4A9F A;  5ENI A;  2R0V A;  4NYX A;  4ALH A;  4UYF A;  5DFD A;  2KGG A;  2KWN A;  1E6I A;  5KTU A;  4PPE A;  3ZNI A;  4O70 A;  4QSP A;  5EYA F;  4PY6 A;  3N9Q A;  4QBM A;  4A0C D;  1WFK A;  5LUU A;  5FB0 A;  3UV5 A;  4MEQ A;  5H1U A;  4NQN A;  3C5K A;  4YYG A;  1WES A;  5I88 A;  4UI9 B;  5G04 B;  2L0B A;  4LAD B;  2F6J A;  3GL6 A;  5CUD A;  5LKU A;  3RPG C;  4HBW A;  5KH3 A;  4MR5 A;  5HJC A;  5DYA A;  4P5O B;  1JM7 A;  5AD3 A;  2D9E A;  1F68 A;  5L98 A;  4YYI A;  3JVL A;  1Z60 A;  4ZDT A;  3SOU A;  5B79 A;  2LGL A;  4TYL A;  5B8D A;  5D7X A;  2KFT A;  2LV9 A;  5HRW A;  3C6W A;  5G4S A;  2YEK A;  5D3T A;  5FEY A;  1E4U A;  3G0J A;  5DKD A;  2E6R A;  4V3K C;  5D1K B;  4CUR A;  5DYX A;  2YEL A;  5FH8 A;  3EB6 A;  1Z6U A;  5C4Q A;  4MR4 A;  2FSA A;  3U5O A;  2LXH C;  5EVA A;  2E7O A;  4GNE A;  2MT5 A;  4O7C A;  5ENE A;  5CQ5 A;  5DKH A;  4MVT A;  4V3L C;  3N9L A;  4YK0 A;  4CA1 A;  5CUB A;  5AIT A;  4QSU A;  4NQM A;  2QIZ A;  4PCI A;  4QF3 A;  4NS5 A;  3FL2 A;  3N9M A;  1V87 A;  4FJC A;  5IGK A;  4QY4 A;  5E9I A;  3IU6 A;  2MNZ A;  2KYU A;  3N9O A;  3P1E A;  4TZ2 A;  4TU6 A;  5A5Q A;  5I80 A;  2YW8 A;  4UIV A;  4IR4 A;  5JI8 A;  4QB3 A;  2KGI A;  3T6R A;  1JOC A;  3HCS A;  4L7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...