3O37A

Crystal structure of trim24 phd-bromo complexed with h3(1-10)k4 peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
182
structure length
175
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/protein binding
molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 175
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o37A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o37A01
5ETDA 5H9MA 4QSSA 1FP0A 2JMJA 5HRWA 5CTLA 5ENCA 5FE1A 4NR6A 2R0SA 5DYXA 5LKZA 5TBNA 5TDRA 4HXMA 5D7XA 1K2FA 4N4FA 4UIWA 3S92A 4Q6FA 5FFVA 4WA6A 3N9NA 2LGKA 5E3GA 4LR6A 1WEQA 3GL6A 5A7CA 4UYDA 3MULA 5EWHA 5F5ZA 2VPBA 4CUTA 1BORA 4MR5A 2YUCA 2RO1A 5C85A 4YAXA 5D26A 5FB1A 5A85A 5IGMA 1WILA 3DPLR 5C87A 3C5KA 1JM7A 3JVLA 5EQ1A 4E96A 2K16A 5FDZA 2YREA 3DWYA 4QSXA 4LDFA 1CHCA 3ZVYA 4J0RA 5JI8A 5IG6A 4WHWA 1FBVA 5CUEA 2CKLA 5BT3A 3FKMX 4CUPA 2LGLA 4I7CA 2QICA 4Q0NA 4BW1A 2CT2A 5II1A 1WEOA 2H60A 2LSPB 2ECJA 3K2JA 5DW1A 2C2LA 5IIDA 5E9YA 4BBQA 4Z6IA 5BT5A 1WE9A 2EODA 3HTKC 5D0CA 5CGPA 4ZQLA 2OXQC 4A9FA 5DFCA 1WGMA 4QUTA 2E3KA 4N4HA 5DW2A 2UZGA 2L84A 3P1EA 4NQMA 5FH6A 5FE2A 2YW8A 3DQVR 5KH9A 4O7FA 3PUQA 5D3SA 4YYDA 3TLPA 4ZUXU 5LJ2A 4A9NA 2ECGA 3UV5A 2VNFA 2KYUA 4F52B 4AKNA 2KTBB 4MEPA 5F2PA 4NR9A 4N3WA 4TTEA 4HXSA 4AUQB 4PS5A 4TYLA 5A5RA 2YQLA 3U5PA 5B77A 4LYSA 2G45A 5G05B 5FE4A 2I50A 2ZETC 3LQHA 4A9JA 4KV4A 5F3AA 4WIVA 4UP0A 5BT4A 5D1MB 4NYVA 4QSTA 3GG3A 4Z1QA 4UP5A 2G43A 5G4SA 5CQ6A 4IR3A 1JSPB 2YQMA 2DVQA 4QC1A 5EPBA 5E3DA 5LKTA 1VD4A 2K1JA 5DKCA 5CPEA 5HQ5A 2XEUA 5C13A 2YHOA 4YATA 4X3GA 3UW9A 1F68A 4PCEA 2YDWA 4XYAA 2LQ6A 4A9IA 4FK5A 3HCSA 4MEQA 5L96A 5FE7A 4QEUA 5HELA 1XWHA 3MB4A 5HQ7A 5D3NA 4XUBA 3P1DA 4UIXA 5C89A 5L98A 4UIYA 2VPDA 4R2YA 5ENEA 5KTUA 5AITA 5DINA 3SOUA 4CA1A 4NQNA 2MNYA 2MT5A 2WP2A 5TCMA 2IDAA 2YYNA 5F61A 3KV6A 4HXLA 4NRCA 2LRIC 4IC2A 4UYEA 2EGPA 1F62A 5CQ5A 4BW2A 1U6GB 4KCXA 4NYWA 4CURA 5IGNA 5CQ4A 5EI4A 5CZGA 4TT6A 4PCIA 2OUOA 5EU1A 3U5NA 1MM2A 5HQ6A 4LADB 4XY9A 4O64A 3RCWA 2RSDA 3PHDA 4PPEA 3VK6A 3G0LA 2RFJA 2HDPA 2PUYA 3V43A 5E74A 2KREA 2MD7B 2VPEA 2ECWA 3SVFA 4O75A 3N9MA 2ECIA 3NG2A 3ZPVE 5F1HA 5A5NA 5B8DA 5E0RA 2MIQA 5EWWA 5I7XA 2RS9B 2YT5A 2OSSA 4YK0A 4NYXA 5CP5A 5J0DA 5D1KB 5E7DA 4QSVA 4QSQA 3U5JA 5I88A 4GB0A 5DKAA 3KQIA 4YADA 2D82A 4MR6A 1WFKA 5D3JA 5CUDA 5A5SA 1LDKC 2QJ0A 2DATA 2KWOA 5D25A 5COIA 3O33A 4TU6A 5TABA 1T1HA 5E9LA 5ENGA 4YC9A 2KE1A 5DLZA 2VJFB 2VJEB 3P5OA 4LRGA 4MEOA 5DYCA 2D8SA 5G04B 4HBYA 4UYFB 2I7KA 5CUGA 4ZW1A 4CCGX 3RTRB 2DVRA 2YURA 5F60A 4BW4A 4LYIA 2M1RA 4N4IA 4HXKA 4A9HA 4MR3A 2DWWA 2RNXA 4A9EA 5EP7A 4O7EA 4Z93A 5E9VA 5FH8A 3M63A 4S3OB 2PNXA 2LXHC 2MD8C 2N9GA 4O7BA 3LXJA 4HBXA 5FERA 5LJ0A 3UVWA 2YU4A 5B78A 3LQIA 4QC3A 5I80A 4UYHA 4CUUA 4UITA 1G25A 4QYDA 3JVKA 5G4RA 3AQAA 4O70A 4YYGA 3JVMA 5D3PA 4QSWA 4YYKA 4OGIA 3SVGA 2L75A 2E6RA 2MNZA 3ZYQA 4Z6HA 2YW5A 3U5LA 5CRZA 5I7YA 5KTXA 3T7LA 4LZ2A 2H0DB 4J0SA 4L58A 3MHSA 3ZTGA 4LYWA 3I2DA 3O36A 4LZSA 4ZC9A 4DONA 5L99A 4J1PA 2R0YA 5HJCA 3O70A 4AYCA 4QEWA 4TKPB 2KGIA 4UI9B 4HXNA 5FBXA 4C67A 5EWVA 2L43A 3IHPA 3M99A 4O7AA 3LJWA 4RVRA 1E6IA 4I7BA 4A9MA 1WUMA 3UVDA 3ZVZB 2YSMA 5H1UA 4O71A 2BAYA 2M6MA 4ALHA 5I89A 5AMFA 2KWKA 4IC3A 5C11A 3EB5A 4TS8A 2WP1A 4IOOA 4YH4A 5A5OA 4CL9A 4IR6A 4QSRA 2M85A 3ZNIA 5DY7A 2I8NA 2RNWA 5A5QA 3QZVA 4CUQA 4NR4A 4WZ3B 2Y43A 5LVQA 4XY8A 1WESA 4YH3A 5A83A 3SOXA 4BHWA 2R0VA 5DFBA 3L11A 5A5PA 4FIPA 2KGGA 5B79A 1WENA 2CKLB 4BW3A 1X4JA 5K29A 2RNYA 2DX8A 5EA1A 3MHHA 4YYHA 1WEVA 2LV9A 4J3IA 5H1VA 5A81A 3HMEA 5EWCA 1X4UA 4YBTA 1WUGA 5C8GA 5J3XA 4QBMA 1WEUA 3MB3A 2F6JA 3KV5A 4YY6A 2E6SA 4C66A 3MUKA 4GNFA 1JM4B 4PTBA 2NXBA 5TDWA 5DYUA 2KR4A 4UYFA 3HMFA 2L5UA 5AIUA 2HYED 4OGJA 4OUFA 3Q2EA 3I3JA 1WIMA 2KFTA 3SVHA 5EK9A 5HCLA 2CSZA 2KWJA 1WEWA 5FEYA 1WEMA 4YABA 3RPGB 4LZRA 4NR5A 5I83A 4CUSA 1LDJB 5EWDA 2JRJA 4GNGA 4TT2A 4BJXA 5CS8A 3UVYA 5E9MA 5IGLA 5LUUA 3NXBA 2VP7A 4NXJA 1E4UA 1DVPA 4NR7A 4ZDTA 3JVJA 4TZ8A 1VFYA 5B76A 5EM3A 4QF3A 1V87A 4QB3A 5FG5A 3N9LA 2FUIA 5EICA 5AD3A 4NS5A 3AADA 4A0CD 2MA5A 5G0FA 5FE6A 4QUUA 5ENJA 2F42A 5HEMA 5H85A 3N9OA 5KU3A 5FE8A 2H0DA 2ECVA 3LRQA 4QSUA 5FE3A 4MVTA 1MM3A 4KV1A 4MSXA 4R8PK 5I1QA 2DKWA 2NAAA 5FE0A 5KTWA 4F3IA 5F62A 2FUUA 5ETBA 5JWMA 4WZ0A 4QZSA 5DBMA 4XI1A 4I7DA 3N9QA 4S3OC 5FE9A 5B75A 3DAIA 2L80A 2LDRA 5F25A 4A4CA 4O77A 2LGGA 1HYIA 5EISA 3LQJA 5HM0A 2XB1A 4UIUA 5L8UA 4TT4A 3UV4A 5D24A 5HRVA 4QNSA 5F36A 2G6QA 2YHNA 2MA6A 2E7NA 4UIVA 5CY9A 5FFWA 2KU3A 2FSAA 4QYLA 5FG4A 3HCTA 3O35A 4YBSA 4LK9A 4AVXA 5FE5A 4IORA 3HCUA 1Z2QA 4UYGA 3P1CA 2GRCA 5CQ3A 5H1TA 5F63A 2L85A 4UIZA 5D1LB 3G0JA 4C9ZA 3UVXA 3L1ZB 4HXRA 5CQTA 3P1FA 5AD2A 5ENFA 4TU4A 2R10A 5D3LA 4PKLA 1N87A 4NUDA 5DYAA 5FB0A 2YQDA 4CLBA 2AN6A 2JMIA 5CQ7A 5CRMA 5CQAA 5EPRA 3ZYUA 4TQNA 4Y03A 4YYIA 2LGVA 2M3HA 4LKAA 5D3RA 2LN0A 4YYNA 2K4DA 3GV4A 5E9KA 3HMHA 4NRBA 4Q0OA 4QEVA 5ENIA 5TRBA 5ENBA 4HXPA 2Y1NA 5A82A 1RMDA 4FJCA 4W4UA 2YYRA 5KH7A 5HRXA 4ALGA 4R7EA 5ENHA 2JMDA 4V3KC 2DVSA 5DKHA 4QSPA 5CUAA 4HBWA 4HBVA 4O78A 4YBMA 5C7NA 5F1LA 5ACYA 4XUAA 5KO4A 4WZ2A 4V3LC 4O7CA 3M62A 5I40A 4NUCA 4NUEA 3D7CA 2KWNA 4GNEA 1JM7B 3O37A 3UV2A 5CUCA 5D3HA 5FH7A 5L8TA 5JG6A 3O7AA 4YYMA 4B86C 5EPSA 2L5EA 2YEMA 4LLBA 4QR4A 2RI7A 5DFDA 1N72A 2ECTA 1X4IA 4MENA 2F6NA 3EB6A 4O72A 3PURA 4AP4A 1ZS5A 3MQMA 5I29A 4PY6A 4LJNA 5KHMA 5D3TA 4A4BA 3O34A 1Z60A 3IU6A 4O74A 5DKDA 5EYAF 4QY4A 5LCWB 4NN2A 4CFLA 4YY4A 5FFYA 2VJFA 2VJEA 4GNDA 3SOWA 3S91A 4B7YC 2DVVA 5HFRA 2KIZA 4L7XA 2L0BA 5I3LA 4HXOA 3L1XA 5HLSA 3ASLA 5EVAA 2QIZA 3MXFA 2EA6A 1X0JA 5HFQA 2K17A 2YSJA 3T6RA 1ZBDB 4A49A 5L97A 4IR4A 5II2A 5CFWA 5LVRA 3RPGC 3QZTA 5CUBA 3QZSA 4LC2A 4WHUA 2MJVB 2ECNA 1IYMA 5CQ8A 5E73A 5CU8A 4AYCB 3N9PA 5AMEA 2YEKA 5EGUA 5LKXA 5C4QA 5IGKA 1EQFA 5LJ1A 2C2VS 2CSYA 5I86A 4IR5A 2LXPC 3KNVA 5TB6A 4QR5A 4GPJA 5LKUA 5IBNA 3FL2A 3ZPV1 2Y1MA 3SHBA 5DX4A 2E7OA 3Q2FA 5KH3A 4A9LA 4TZ2A 4YYJA 4MR4A 4N4GA 4Z1SA 2YELA 4O76A 3U5KA 4NR8A 4NRAA 3U5OA 3IU5A 3C6WA 4IOQA 3U5MA 4A9OA 2D9EA 4FO9A 2MUMA 4FLPA 5E9IA 4A9KA 4QF2A 1VYXA 5HENA 3ONIA 4X2IA 5FG6A 1WEPA 2VPGA 4QR3A 5DLXA 2OO1A 2G4AA 5EV9A 4CFKA 1Z6UA 4P5OB 1HYJA 1JOCA 1WEEA
chains in the Genus database with same CATH superfamily
5ETDA 5H9MA 4QSSA 1FP0A 2JMJA 5HRWA 5CTLA 5ENCA 5FE1A 4NR6A 2R0SA 5DYXA 5LKZA 5TBNA 5TDRA 4HXMA 5D7XA 1K2FA 4N4FA 4UIWA 3S92A 4Q6FA 5FFVA 4WA6A 3N9NA 2LGKA 5E3GA 4LR6A 1WEQA 2JUNA 5A7CA 4UYDA 2MKEA 3GL6A 3MULA 5EWHA 4H9DA 5F5ZA 2VPBA 4CUTA 1BORA 4MR5A 2YUCA 2RO1A 5C85A 4YAXA 5D26A 5FB1A 5A85A 5IGMA 1WILA 3DPLR 5SVIA 3ERRA 5C87A 3C5KA 1JM7A 3JVLA 5EQ1A 4E96A 2K16A 5FDZA 2YREA 3DWYA 4QSXA 4LDFA 1CHCA 3ZVYA 4J0RA 5JI8A 5IG6A 4WHWA 1FBVA 5CUEA 2CKLA 5BT3A 3FKMX 4CUPA 2LGLA 4I7CA 2QICA 4Q0NA 4BW1A 2CT2A 5II1A 1WEOA 4OGEA 2H60A 2LSPB 2ECJA 3K2JA 5DW1A 2C2LA 5IIDA 5E9YA 4BBQA 4Z6IA 5BT5A 1WE9A 2EODA 3FM8C 3HTKC 5D0CA 5CGPA 4ZQLA 2D8UA 2OXQC 4A9FA 5DFCA 1WGMA 4QUTA 2E3KA 4N4HA 5DW2A 2UZGA 2L84A 3P1EA 4NQMA 5FH6A 5FE2A 2YW8A 3DQVR 5KH9A 4O7FA 3PUQA 5D3SA 4YYDA 3TLPA 4ZUXU 2B0OE 5LJ2A 4A9NA 2DJAA 2ECGA 3UV5A 2VNFA 2KYUA 4F52B 4AKNA 3LVRE 2KTBB 4MEPA 5F2PA 4NR9A 4N3WA 4TTEA 4HXSA 4AUQB 4PS5A 4TYLA 5A5RA 4AKHA 3U5PA 2YQLA 4LYSA 2G45A 5B77A 5G05B 5FE4A 2I50A 2ZETC 3LQHA 4A9JA 4KV4A 5F3AA 4WIVA 4UP0A 5BT4A 5D1MB 4NYVA 4QSTA 3GG3A 4Z1QA 4UP5A 2G43A 5G4SA 5CQ6A 4IR3A 1JSPB 2YQMA 2DVQA 4QC1A 5EPBA 5E3DA 5LKTA 1VD4A 2K1JA 5DKCA 5CPEA 5HQ5A 2XEUA 5C13A 2YHOA 2KKXA 4YATA 4X3GA 3UW9A 1F68A 5K3QA 4PCEA 2YDWA 4XYAA 2LQ6A 4A9IA 4FK5A 3HCSA 4MEQA 5L96A 5FE7A 4QEUA 2CRWA 5HELA 1XWHA 4F1PA 3MB4A 5HQ7A 5D3NA 4XUBA 3P1DA 2XOZA 4AI6A 4UIXA 5C89A 3T9KA 5L98A 4UIYA 2VPDA 4R2YA 5ENEA 5KTUA 5AITA 5DINA 3SOUA 3M7KA 4CA1A 4NQNA 2MNYA 2MT5A 2WP2A 5TCMA 2IDAA 2YYNA 3O47A 5F61A 3KV6A 4HXLA 4NRCA 2LRIC 4IC2A 4UYEA 2EGPA 1F62A 5CQ5A 4BW2A 1U6GB 4KCXA 4NYWA 4CURA 5IGNA 5CQ4A 5EI4A 5CZGA 4TT6A 4PCIA 2OUOA 5EU1A 3U5NA 1MM2A 5HQ6A 4LADB 4XY9A 4O64A 3RCWA 2RSDA 3PHDA 4PPEA 3VK6A 3G0LA 2RFJA 2HDPA 2PUYA 3V43A 5E74A 2KREA 2MD7B 2VPEA 2ECWA 3SVFA 4O75A 3N9MA 2ECIA 3D1BA 3NG2A 5F1HA 5A5NA 3ZPVE 5B8DA 5E0RA 2MIQA 5EWWA 5I7XA 2RS9B 2YT5A 2OSSA 4YK0A 4NYXA 5CP5A 5J0DA 3JUEA 5D1KB 5E7DA 4QSVA 4QSQA 3U5JA 5I88A 4GB0A 5DKAA 3KQIA 4YADA 2D82A 4MR6A 1WFKA 5D3JA 5CUDA 5A5SA 1LDKC 2QJ0A 2DATA 2KWOA 5D25A 5COIA 3O33A 4TU6A 5TABA 1T1HA 5E9LA 5ENGA 4YC9A 2KE1A 5DLZA 2VJFB 2VJEB 3DWDA 2L7PA 3P5OA 4LRGA 4MEOA 5DYCA 2D8SA 5G04B 4HBYA 3LJUX 4UYFB 2I7KA 5CUGA 4ZW1A 2FFWA 4CCGX 3RTRB 2DVRA 2YURA 5F60A 4BW4A 4LYIA 2M1RA 4Z0OA 4N4IA 4HXKA 4A9HA 4MR3A 2DWWA 2RNXA 4A9EA 5EP7A 4O7EA 4Z93A 5E9VA 5FH8A 3M63A 4S3OB 2PNXA 2LXHC 2MD8C 2N9GA 4O7BA 3LXJA 4HBXA 5FERA 5LJ0A 3UVWA 2YU4A 5B78A 3LQIA 4QC3A 5I80A 4UYHA 4CUUA 4UITA 1G25A 4QYDA 3JVKA 5G4RA 2RR4A 3AQAA 4O70A 4YYGA 3JVMA 5D3PA 4QSWA 4YYKA 4OGIA 3SVGA 2L75A 2E6RA 2CRRA 2MNZA 3ZYQA 3KDEC 4Z6HA 2YW5A 3U5LA 2CSVA 5CRZA 5I7YA 5KTXA 2YVRA 3T7LA 4LZ2A 2H0DB 2XOCA 4J0SA 4L58A 3MHSA 3ZTGA 4LYWA 3I2DA 3O36A 4LZSA 4ZC9A 4DONA 5L99A 4J1PA 2R0YA 5HJCA 3O70A 3Q1DA 4QEWA 4AYCA 4TKPB 2KGIA 4UI9B 4HXNA 5FBXA 4C67A 5EWVA 2L43A 3IHPA 3M99A 3VKGA 4O7AA 3LJWA 4RVRA 2M13A 3MDBC 1E6IA 4I7BA 4A9MA 1WUMA 3UVDA 3ZVZB 2YSMA 5H1UA 4O71A 2BAYA 2M6MA 4ALHA 5I89A 5AMFA 2KWKA 4IC3A 5C11A 2DSMA 3EB5A 4TS8A 2WP1A 4AKGA 4IOOA 4YH4A 5A5OA 4CL9A 4IR6A 5SVIB 4QSRA 2M85A 3ZNIA 5DY7A 2I8NA 2RNWA 5A5QA 3QZVA 4CUQA 4NR4A 4WZ3B 2Y43A 5LVQA 4Z0RA 4XY8A 1WESA 4YH3A 5A83A 3SOXA 4BHWA 2R0VA 5DFBA 4AKIA 5A5PA 3L11A 4FIPA 2KGGA 5B79A 1WENA 2CKLB 4BW3A 1X4JA 5K29A 2EXUA 2RNYA 2DX8A 5EA1A 3MHHA 4YYHA 1WEVA 2LV9A 4J3IA 5H1VA 5A81A 3HMEA 5EWCA 1X4UA 4YBTA 1WUGA 5C8GA 5J3XA 4QBMA 1WEUA 3MB3A 2IQJA 2F6JA 3KV5A 3LVQE 4YY6A 2XP0A 2E61A 2E6SA 4C66A 3MUKA 4GNFA 1JM4B 4PTBA 2NXBA 5TDWA 5DYUA 2KR4A 4UYFA 3HMFA 2L5UA 5AIUA 2HYED 4OGJA 4OUFA 3Q2EA 3I3JA 1WIMA 2KFTA 3SVHA 5EK9A 5HCLA 2CSZA 2KWJA 1WEWA 5FEYA 1WEMA 4YABA 2CONA 3RPGB 4LZRA 4NR5A 5I83A 4CUSA 1LDJB 5EWDA 2JRJA 4GNGA 4TT2A 4BJXA 1ZKRA 5CS8A 3UVYA 5E9MA 5IGLA 5LUUA 3FEHA 3NXBA 2VP7A 4NXJA 1E4UA 1DVPA 4NR7A 4ZDTA 3JVJA 4TZ8A 1VFYA 5B76A 2EJNA 5EM3A 4QF3A 1V87A 4QB3A 5FG5A 3N9LA 2FUIA 5EICA 5AD3A 4NS5A 3AADA 4A0CD 2MA5A 5G0FA 5FE6A 4OGCA 4QUUA 5ENJA 2F42A 5HEMA 5H85A 3N9OA 5KU3A 5FE8A 2H0DA 2ECVA 3LRQA 4QSUA 5FE3A 4MVTA 1MM3A 4KV1A 4MSXA 4R8PK 5I1QA 2DKWA 2NAAA 5FE0A 5KTWA 4F3IA 5F62A 2FUUA 5ETBA 5JWMA 4WZ0A 4QZSA 5DBMA 4XI1A 4I7DA 3N9QA 4S3OC 5FE9A 5B75A 3DAIA 2L80A 2LDRA 5F25A 4A4CA 4O77A 2LGGA 1HYIA 5EISA 3LQJA 5HM0A 2XB1A 2OWAA 4UIUA 3H7HA 5L8UA 4TT4A 3UV4A 5D24A 5HRVA 4QNSA 5F36A 2G6QA 2YHNA 2MA6A 2E7NA 4UIVA 5CY9A 5FFWA 2KU3A 2FSAA 4QYLA 5FG4A 3HCTA 3O35A 4YBSA 4LK9A 4AVXA 5FE5A 4IORA 3PLWA 3HCUA 1Z2QA 4UYGA 3P1CA 2GRCA 5CQ3A 5H1TA 5F63A 2L85A 4UIZA 5D1LB 3G0JA 4C9ZA 3UVXA 2LAUA 3L1ZB 4HXRA 5CQTA 3P1FA 2FD4A 5AD2A 5ENFA 4TU4A 2R10A 5D3LA 3FAOA 4PKLA 1N87A 4NUDA 5DYAA 5FB0A 2YQDA 4CLBA 2AN6A 2JMIA 5CQ7A 3FJUB 5CRMA 5CQAA 5EPRA 3ZYUA 4TQNA 4Y03A 4YYIA 2LGVA 2M3HA 4LKAA 5D3RA 2LN0A 4YYNA 2K4DA 3GV4A 5E9KA 3HMHA 4NRBA 4Q0OA 4QEVA 5ENIA 5TRBA 5ENBA 4HXPA 2Y1NA 5A82A 1RMDA 4FJCA 4W4UA 2YYRA 5KH7A 5HRXA 4ALGA 4R7EA 5ENHA 2JMDA 4V3KC 2DVSA 5DKHA 4QSPA 5CUAA 4HBWA 4HBVA 4O78A 4YBMA 5C7NA 5F1LA 5ACYA 2P57A 4XUAA 5KO4A 4WZ2A 4V3LC 4O7CA 3M62A 5I40A 4NUCA 4NUEA 3D7CA 2KWNA 4GNEA 1JM7B 3O37A 3DDTA 3UV2A 5CUCA 5D3HA 1PUOA 5FH7A 5L8TA 5JG6A 3O7AA 4YYMA 4B86C 5EPSA 2L5EA 2YEMA 4LLBA 4QR4A 2RI7A 5DFDA 1N72A 2ECTA 1X4IA 4MENA 2F6NA 3EB6A 4O72A 3PURA 3E2DA 1ZS5A 3MQMA 5I29A 4PY6A 4LJNA 4AP4A 5KHMA 5D3TA 4A4BA 3O34A 1Z60A 3IU6A 1DCQA 2EGMA 4O74A 5DKDA 5EYAF 4QY4A 5LCWB 4NN2A 4CFLA 4YY4A 3LDYA 5FFYA 2VJFA 2VJEA 4GNDA 3SOWA 3S91A 4B7YC 2DVVA 5HFRA 2KIZA 4L7XA 2L0BA 5I3LA 4HXOA 2XOYA 3L1XA 5HLSA 3ASLA 5EVAA 2QIZA 4QQ4A 3MXFA 2EA6A 1X0JA 5HFQA 2K17A 2YSJA 3T6RA 1ZBDB 4A49A 5L97A 4IR4A 5II2A 5CFWA 5LVRA 3RPGC 3QZTA 5CUBA 3QZSA 4LC2A 4WHUA 2MJVB 2ECNA 1IYMA 5CQ8A 5E73A 3D1DA 5CU8A 3N9PA 5AMEA 4AYCB 2YEKA 1MBMA 5EGUA 5LKXA 5C4QA 5IGKA 1EQFA 5LJ1A 3VKHA 2C2VS 5I86A 4IR5A 2CSYA 2KKYA 2LXPC 5TB6A 3KNVA 4QR5A 4GPJA 5LKUA 5IBNA 3FL2A 5SVYA 3ZPV1 2Y1MA 3SHBA 5DX4A 3SUBA 2E7OA 3Q2FA 5KH3A 4A9LA 4TZ2A 4YYJA 4MR4A 4N4GA 4Z1SA 2YELA 4O76A 3U5KA 4NR8A 4NRAA 3U5OA 3IU5A 3C6WA 4IOQA 4O62A 3U5MA 4A9OA 2D9EA 4FO9A 2MUMA 4FLPA 5E9IA 4A9KA 4QF2A 1VYXA 2JM3A 5HENA 3ONIA 4X2IA 5FG6A 1WEPA 2VPGA 4QR3A 5DLXA 3FANA 2OO1A 2G4AA 5EV9A 4CFKA 1Z6UA 4P5OB 5SVXA 1HYJA 1JOCA 1WEEA
chains in the Genus database with same CATH topology
5ETDA 5H9MA 4QSSA 1FP0A 2JMJA 5HRWA 5CTLA 5ENCA 5FE1A 4NR6A 2R0SA 5DYXA 5LKZA 5TBNA 5TDRA 4HXMA 5D7XA 1K2FA 4N4FA 4UIWA 3S92A 4Q6FA 5FFVA 4WA6A 3N9NA 2LGKA 5E3GA 4LR6A 1WEQA 3GL6A 5A7CA 4UYDA 3MULA 5EWHA 5F5ZA 2VPBA 4CUTA 1BORA 4MR5A 2YUCA 2RO1A 5C85A 4YAXA 5D26A 5FB1A 5A85A 5IGMA 1WILA 3DPLR 5C87A 3C5KA 1JM7A 3JVLA 5EQ1A 4E96A 2K16A 5FDZA 2YREA 3DWYA 4QSXA 4LDFA 1CHCA 3ZVYA 4J0RA 5JI8A 5IG6A 4WHWA 1FBVA 5CUEA 2CKLA 5BT3A 3FKMX 4CUPA 2LGLA 4I7CA 2QICA 4Q0NA 4BW1A 2CT2A 5II1A 1WEOA 2H60A 2LSPB 2ECJA 3K2JA 5DW1A 2C2LA 5IIDA 5E9YA 4BBQA 4Z6IA 5BT5A 1WE9A 2EODA 3HTKC 5D0CA 5CGPA 4ZQLA 2OXQC 4A9FA 5DFCA 1WGMA 4QUTA 2E3KA 4N4HA 5DW2A 2UZGA 2L84A 3P1EA 4NQMA 5FH6A 5FE2A 2YW8A 3DQVR 5KH9A 4O7FA 3PUQA 5D3SA 4YYDA 3TLPA 4ZUXU 5LJ2A 4A9NA 2ECGA 3UV5A 2VNFA 2KYUA 4F52B 4AKNA 2KTBB 4MEPA 5F2PA 4NR9A 4N3WA 4TTEA 4HXSA 4AUQB 4PS5A 4TYLA 5A5RA 2YQLA 3U5PA 5B77A 4LYSA 2G45A 5G05B 5FE4A 2I50A 2ZETC 3LQHA 4A9JA 4KV4A 5F3AA 4WIVA 4UP0A 5BT4A 5D1MB 4NYVA 4QSTA 3GG3A 4Z1QA 4UP5A 2G43A 5G4SA 5CQ6A 4IR3A 1JSPB 2YQMA 2DVQA 4QC1A 5EPBA 5E3DA 5LKTA 1VD4A 2K1JA 5DKCA 5CPEA 5HQ5A 2XEUA 5C13A 2YHOA 4YATA 4X3GA 3UW9A 1F68A 4PCEA 2YDWA 4XYAA 2LQ6A 4A9IA 4FK5A 3HCSA 4MEQA 5L96A 5FE7A 4QEUA 5HELA 1XWHA 3MB4A 5HQ7A 5D3NA 4XUBA 3P1DA 4UIXA 5C89A 5L98A 4UIYA 2VPDA 4R2YA 5ENEA 5KTUA 5AITA 5DINA 3SOUA 4CA1A 4NQNA 2MNYA 2MT5A 2WP2A 5TCMA 2IDAA 2YYNA 5F61A 3KV6A 4HXLA 4NRCA 2LRIC 4IC2A 4UYEA 2EGPA 1F62A 5CQ5A 4BW2A 1U6GB 4KCXA 4NYWA 4CURA 5IGNA 5CQ4A 5EI4A 5CZGA 4TT6A 4PCIA 2OUOA 5EU1A 3U5NA 1MM2A 5HQ6A 4LADB 4XY9A 4O64A 3RCWA 2RSDA 3PHDA 4PPEA 3VK6A 3G0LA 2RFJA 2HDPA 2PUYA 3V43A 5E74A 2KREA 2MD7B 2VPEA 2ECWA 3SVFA 4O75A 3N9MA 2ECIA 3NG2A 3ZPVE 5F1HA 5A5NA 5B8DA 5E0RA 2MIQA 5EWWA 5I7XA 2RS9B 2YT5A 2OSSA 4YK0A 4NYXA 5CP5A 5J0DA 5D1KB 5E7DA 4QSVA 4QSQA 3U5JA 5I88A 4GB0A 5DKAA 3KQIA 4YADA 2D82A 4MR6A 1WFKA 5D3JA 5CUDA 5A5SA 1LDKC 2QJ0A 2DATA 2KWOA 5D25A 5COIA 3O33A 4TU6A 5TABA 1T1HA 5E9LA 5ENGA 4YC9A 2KE1A 5DLZA 2VJFB 2VJEB 3P5OA 4LRGA 4MEOA 5DYCA 2D8SA 5G04B 4HBYA 4UYFB 2I7KA 5CUGA 4ZW1A 4CCGX 3RTRB 2DVRA 2YURA 5F60A 4BW4A 4LYIA 2M1RA 4N4IA 4HXKA 4A9HA 4MR3A 2DWWA 2RNXA 4A9EA 5EP7A 4O7EA 4Z93A 5E9VA 5FH8A 3M63A 4S3OB 2PNXA 2LXHC 2MD8C 2N9GA 4O7BA 3LXJA 4HBXA 5FERA 5LJ0A 3UVWA 2YU4A 5B78A 3LQIA 4QC3A 5I80A 4UYHA 4CUUA 4UITA 1G25A 4QYDA 3JVKA 5G4RA 3AQAA 4O70A 4YYGA 3JVMA 5D3PA 4QSWA 4YYKA 4OGIA 3SVGA 2L75A 2E6RA 2MNZA 3ZYQA 4Z6HA 2YW5A 3U5LA 5CRZA 5I7YA 5KTXA 3T7LA 4LZ2A 2H0DB 4J0SA 4L58A 3MHSA 3ZTGA 4LYWA 3I2DA 3O36A 4LZSA 4ZC9A 4DONA 5L99A 4J1PA 2R0YA 5HJCA 3O70A 4AYCA 4QEWA 4TKPB 2KGIA 4UI9B 4HXNA 5FBXA 4C67A 5EWVA 2L43A 3IHPA 3M99A 4O7AA 3LJWA 4RVRA 1E6IA 4I7BA 4A9MA 1WUMA 3UVDA 3ZVZB 2YSMA 5H1UA 4O71A 2BAYA 2M6MA 4ALHA 5I89A 5AMFA 2KWKA 4IC3A 5C11A 3EB5A 4TS8A 2WP1A 4IOOA 4YH4A 5A5OA 4CL9A 4IR6A 4QSRA 2M85A 3ZNIA 5DY7A 2I8NA 2RNWA 5A5QA 3QZVA 4CUQA 4NR4A 4WZ3B 2Y43A 5LVQA 4XY8A 1WESA 4YH3A 5A83A 3SOXA 4BHWA 2R0VA 5DFBA 3L11A 5A5PA 4FIPA 2KGGA 5B79A 1WENA 2CKLB 4BW3A 1X4JA 5K29A 2RNYA 2DX8A 5EA1A 3MHHA 4YYHA 1WEVA 2LV9A 4J3IA 5H1VA 5A81A 3HMEA 5EWCA 1X4UA 4YBTA 1WUGA 5C8GA 5J3XA 4QBMA 1WEUA 3MB3A 2F6JA 3KV5A 4YY6A 2E6SA 4C66A 3MUKA 4GNFA 1JM4B 4PTBA 2NXBA 5TDWA 5DYUA 2KR4A 4UYFA 3HMFA 2L5UA 5AIUA 2HYED 4OGJA 4OUFA 3Q2EA 3I3JA 1WIMA 2KFTA 3SVHA 5EK9A 5HCLA 2CSZA 2KWJA 1WEWA 5FEYA 1WEMA 4YABA 3RPGB 4LZRA 4NR5A 5I83A 4CUSA 1LDJB 5EWDA 2JRJA 4GNGA 4TT2A 4BJXA 5CS8A 3UVYA 5E9MA 5IGLA 5LUUA 3NXBA 2VP7A 4NXJA 1E4UA 1DVPA 4NR7A 4ZDTA 3JVJA 4TZ8A 1VFYA 5B76A 5EM3A 4QF3A 1V87A 4QB3A 5FG5A 3N9LA 2FUIA 5EICA 5AD3A 4NS5A 3AADA 4A0CD 2MA5A 5G0FA 5FE6A 4QUUA 5ENJA 2F42A 5HEMA 5H85A 3N9OA 5KU3A 5FE8A 2H0DA 2ECVA 3LRQA 4QSUA 5FE3A 4MVTA 1MM3A 4KV1A 4MSXA 4R8PK 5I1QA 2DKWA 2NAAA 5FE0A 5KTWA 4F3IA 5F62A 2FUUA 5ETBA 5JWMA 4WZ0A 4QZSA 5DBMA 4XI1A 4I7DA 3N9QA 4S3OC 5FE9A 5B75A 3DAIA 2L80A 2LDRA 5F25A 4A4CA 4O77A 2LGGA 1HYIA 5EISA 3LQJA 5HM0A 2XB1A 4UIUA 5L8UA 4TT4A 3UV4A 5D24A 5HRVA 4QNSA 5F36A 2G6QA 2YHNA 2MA6A 2E7NA 4UIVA 5CY9A 5FFWA 2KU3A 2FSAA 4QYLA 5FG4A 3HCTA 3O35A 4YBSA 4LK9A 4AVXA 5FE5A 4IORA 3HCUA 1Z2QA 4UYGA 3P1CA 2GRCA 5CQ3A 5H1TA 5F63A 2L85A 4UIZA 5D1LB 3G0JA 4C9ZA 3UVXA 3L1ZB 4HXRA 5CQTA 3P1FA 5AD2A 5ENFA 4TU4A 2R10A 5D3LA 4PKLA 1N87A 4NUDA 5DYAA 5FB0A 2YQDA 4CLBA 2AN6A 2JMIA 5CQ7A 5CRMA 5CQAA 5EPRA 3ZYUA 4TQNA 4Y03A 4YYIA 2LGVA 2M3HA 4LKAA 5D3RA 2LN0A 4YYNA 2K4DA 3GV4A 5E9KA 3HMHA 4NRBA 4Q0OA 4QEVA 5ENIA 5TRBA 5ENBA 4HXPA 2Y1NA 5A82A 1RMDA 4FJCA 4W4UA 2YYRA 5KH7A 5HRXA 4ALGA 4R7EA 5ENHA 2JMDA 4V3KC 2DVSA 5DKHA 4QSPA 5CUAA 4HBWA 4HBVA 4O78A 4YBMA 5C7NA 5F1LA 5ACYA 4XUAA 5KO4A 4WZ2A 4V3LC 4O7CA 3M62A 5I40A 4NUCA 4NUEA 3D7CA 2KWNA 4GNEA 1JM7B 3O37A 3UV2A 5CUCA 5D3HA 5FH7A 5L8TA 5JG6A 3O7AA 4YYMA 4B86C 5EPSA 2L5EA 2YEMA 4LLBA 4QR4A 2RI7A 5DFDA 1N72A 2ECTA 1X4IA 4MENA 2F6NA 3EB6A 4O72A 3PURA 4AP4A 1ZS5A 3MQMA 5I29A 4PY6A 4LJNA 5KHMA 5D3TA 4A4BA 3O34A 1Z60A 3IU6A 4O74A 5DKDA 5EYAF 4QY4A 5LCWB 4NN2A 4CFLA 4YY4A 5FFYA 2VJFA 2VJEA 4GNDA 3SOWA 3S91A 4B7YC 2DVVA 5HFRA 2KIZA 4L7XA 2L0BA 5I3LA 4HXOA 3L1XA 5HLSA 3ASLA 5EVAA 2QIZA 3MXFA 2EA6A 1X0JA 5HFQA 2K17A 2YSJA 3T6RA 1ZBDB 4A49A 5L97A 4IR4A 5II2A 5CFWA 5LVRA 3RPGC 3QZTA 5CUBA 3QZSA 4LC2A 4WHUA 2MJVB 2ECNA 1IYMA 5CQ8A 5E73A 5CU8A 4AYCB 3N9PA 5AMEA 2YEKA 5EGUA 5LKXA 5C4QA 5IGKA 1EQFA 5LJ1A 2C2VS 2CSYA 5I86A 4IR5A 2LXPC 3KNVA 5TB6A 4QR5A 4GPJA 5LKUA 5IBNA 3FL2A 3ZPV1 2Y1MA 3SHBA 5DX4A 2E7OA 3Q2FA 5KH3A 4A9LA 4TZ2A 4YYJA 4MR4A 4N4GA 4Z1SA 2YELA 4O76A 3U5KA 4NR8A 4NRAA 3U5OA 3IU5A 3C6WA 4IOQA 3U5MA 4A9OA 2D9EA 4FO9A 2MUMA 4FLPA 5E9IA 4A9KA 4QF2A 1VYXA 5HENA 3ONIA 4X2IA 5FG6A 1WEPA 2VPGA 4QR3A 5DLXA 2OO1A 2G4AA 5EV9A 4CFKA 1Z6UA 4P5OB 1HYJA 1JOCA 1WEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETD A;  5H9M A;  4QSS A;  1FP0 A;  2JMJ A;  5HRW A;  5CTL A;  5ENC A;  5FE1 A;  4NR6 A;  2R0S A;  5DYX A;  5LKZ A;  5TBN A;  5TDR A;  4HXM A;  5D7X A;  1K2F A;  4N4F A;  4UIW A;  3S92 A;  4Q6F A;  5FFV A;  4WA6 A;  3N9N A;  2LGK A;  5E3G A;  4LR6 A;  1WEQ A;  3GL6 A;  5A7C A;  4UYD A;  3MUL A;  5EWH A;  5F5Z A;  2VPB A;  4CUT A;  1BOR A;  4MR5 A;  2YUC A;  2RO1 A;  5C85 A;  4YAX A;  5D26 A;  5FB1 A;  5A85 A;  5IGM A;  1WIL A;  3DPL R;  5C87 A;  3C5K A;  1JM7 A;  3JVL A;  5EQ1 A;  4E96 A;  2K16 A;  5FDZ A;  2YRE A;  3DWY A;  4QSX A;  4LDF A;  1CHC A;  3ZVY A;  4J0R A;  5JI8 A;  5IG6 A;  4WHW A;  1FBV A;  5CUE A;  2CKL A;  5BT3 A;  3FKM X;  4CUP A;  2LGL A;  4I7C A;  2QIC A;  4Q0N A;  4BW1 A;  2CT2 A;  5II1 A;  1WEO A;  2H60 A;  2LSP B;  2ECJ A;  3K2J A;  5DW1 A;  2C2L A;  5IID A;  5E9Y A;  4BBQ A;  4Z6I A;  5BT5 A;  1WE9 A;  2EOD A;  3HTK C;  5D0C A;  5CGP A;  4ZQL A;  2OXQ C;  4A9F A;  5DFC A;  1WGM A;  4QUT A;  2E3K A;  4N4H A;  5DW2 A;  2UZG A;  2L84 A;  3P1E A;  4NQM A;  5FH6 A;  5FE2 A;  2YW8 A;  3DQV R;  5KH9 A;  4O7F A;  3PUQ A;  5D3S A;  4YYD A;  3TLP A;  4ZUX U;  5LJ2 A;  4A9N A;  2ECG A;  3UV5 A;  2VNF A;  2KYU A;  4F52 B;  4AKN A;  2KTB B;  4MEP A;  5F2P A;  4NR9 A;  4N3W A;  4TTE A;  4HXS A;  4AUQ B;  4PS5 A;  4TYL A;  5A5R A;  2YQL A;  3U5P A;  5B77 A;  4LYS A;  2G45 A;  5G05 B;  5FE4 A;  2I50 A;  2ZET C;  3LQH A;  4A9J A;  4KV4 A;  5F3A A;  4WIV A;  4UP0 A;  5BT4 A;  5D1M B;  4NYV A;  4QST A;  3GG3 A;  4Z1Q A;  4UP5 A;  2G43 A;  5G4S A;  5CQ6 A;  4IR3 A;  1JSP B;  2YQM A;  2DVQ A;  4QC1 A;  5EPB A;  5E3D A;  5LKT A;  1VD4 A;  2K1J A;  5DKC A;  5CPE A;  5HQ5 A;  2XEU A;  5C13 A;  2YHO A;  4YAT A;  4X3G A;  3UW9 A;  1F68 A;  4PCE A;  2YDW A;  4XYA A;  2LQ6 A;  4A9I A;  4FK5 A;  3HCS A;  4MEQ A;  5L96 A;  5FE7 A;  4QEU A;  5HEL A;  1XWH A;  3MB4 A;  5HQ7 A;  5D3N A;  4XUB A;  3P1D A;  4UIX A;  5C89 A;  5L98 A;  4UIY A;  2VPD A;  4R2Y A;  5ENE A;  5KTU A;  5AIT A;  5DIN A;  3SOU A;  4CA1 A;  4NQN A;  2MNY A;  2MT5 A;  2WP2 A;  5TCM A;  2IDA A;  2YYN A;  5F61 A;  3KV6 A;  4HXL A;  4NRC A;  2LRI C;  4IC2 A;  4UYE A;  2EGP A;  1F62 A;  5CQ5 A;  4BW2 A;  1U6G B;  4KCX A;  4NYW A;  4CUR A;  5IGN A;  5CQ4 A;  5EI4 A;  5CZG A;  4TT6 A;  4PCI A;  2OUO A;  5EU1 A;  3U5N A;  1MM2 A;  5HQ6 A;  4LAD B;  4XY9 A;  4O64 A;  3RCW A;  2RSD A;  3PHD A;  4PPE A;  3VK6 A;  3G0L A;  2RFJ A;  2HDP A;  2PUY A;  3V43 A;  5E74 A;  2KRE A;  2MD7 B;  2VPE A;  2ECW A;  3SVF A;  4O75 A;  3N9M A;  2ECI A;  3NG2 A;  3ZPV E;  5F1H A;  5A5N A;  5B8D A;  5E0R A;  2MIQ A;  5EWW A;  5I7X A;  2RS9 B;  2YT5 A;  2OSS A;  4YK0 A;  4NYX A;  5CP5 A;  5J0D A;  5D1K B;  5E7D A;  4QSV A;  4QSQ A;  3U5J A;  5I88 A;  4GB0 A;  5DKA A;  3KQI A;  4YAD A;  2D82 A;  4MR6 A;  1WFK A;  5D3J A;  5CUD A;  5A5S A;  1LDK C;  2QJ0 A;  2DAT A;  2KWO A;  5D25 A;  5COI A;  3O33 A;  4TU6 A;  5TAB A;  1T1H A;  5E9L A;  5ENG A;  4YC9 A;  2KE1 A;  5DLZ A;  2VJF B;  2VJE B;  3P5O A;  4LRG A;  4MEO A;  5DYC A;  2D8S A;  5G04 B;  4HBY A;  4UYF B;  2I7K A;  5CUG A;  4ZW1 A;  4CCG X;  3RTR B;  2DVR A;  2YUR A;  5F60 A;  4BW4 A;  4LYI A;  2M1R A;  4N4I A;  4HXK A;  4A9H A;  4MR3 A;  2DWW A;  2RNX A;  4A9E A;  5EP7 A;  4O7E A;  4Z93 A;  5E9V A;  5FH8 A;  3M63 A;  4S3O B;  2PNX A;  2LXH C;  2MD8 C;  2N9G A;  4O7B A;  3LXJ A;  4HBX A;  5FER A;  5LJ0 A;  3UVW A;  2YU4 A;  5B78 A;  3LQI A;  4QC3 A;  5I80 A;  4UYH A;  4CUU A;  4UIT A;  1G25 A;  4QYD A;  3JVK A;  5G4R A;  3AQA A;  4O70 A;  4YYG A;  3JVM A;  5D3P A;  4QSW A;  4YYK A;  4OGI A;  3SVG A;  2L75 A;  2E6R A;  2MNZ A;  3ZYQ A;  4Z6H A;  2YW5 A;  3U5L A;  5CRZ A;  5I7Y A;  5KTX A;  3T7L A;  4LZ2 A;  2H0D B;  4J0S A;  4L58 A;  3MHS A;  3ZTG A;  4LYW A;  3I2D A;  3O36 A;  4LZS A;  4ZC9 A;  4DON A;  5L99 A;  4J1P A;  2R0Y A;  5HJC A;  3O70 A;  4AYC A;  4QEW A;  4TKP B;  2KGI A;  4UI9 B;  4HXN A;  5FBX A;  4C67 A;  5EWV A;  2L43 A;  3IHP A;  3M99 A;  4O7A A;  3LJW A;  4RVR A;  1E6I A;  4I7B A;  4A9M A;  1WUM A;  3UVD A;  3ZVZ B;  2YSM A;  5H1U A;  4O71 A;  2BAY A;  2M6M A;  4ALH A;  5I89 A;  5AMF A;  2KWK A;  4IC3 A;  5C11 A;  3EB5 A;  4TS8 A;  2WP1 A;  4IOO A;  4YH4 A;  5A5O A;  4CL9 A;  4IR6 A;  4QSR A;  2M85 A;  3ZNI A;  5DY7 A;  2I8N A;  2RNW A;  5A5Q A;  3QZV A;  4CUQ A;  4NR4 A;  4WZ3 B;  2Y43 A;  5LVQ A;  4XY8 A;  1WES A;  4YH3 A;  5A83 A;  3SOX A;  4BHW A;  2R0V A;  5DFB A;  3L11 A;  5A5P A;  4FIP A;  2KGG A;  5B79 A;  1WEN A;  2CKL B;  4BW3 A;  1X4J A;  5K29 A;  2RNY A;  2DX8 A;  5EA1 A;  3MHH A;  4YYH A;  1WEV A;  2LV9 A;  4J3I A;  5H1V A;  5A81 A;  3HME A;  5EWC A;  1X4U A;  4YBT A;  1WUG A;  5C8G A;  5J3X A;  4QBM A;  1WEU A;  3MB3 A;  2F6J A;  3KV5 A;  4YY6 A;  2E6S A;  4C66 A;  3MUK A;  4GNF A;  1JM4 B;  4PTB A;  2NXB A;  5TDW A;  5DYU A;  2KR4 A;  4UYF A;  3HMF A;  2L5U A;  5AIU A;  2HYE D;  4OGJ A;  4OUF A;  3Q2E A;  3I3J A;  1WIM A;  2KFT A;  3SVH A;  5EK9 A;  5HCL A;  2CSZ A;  2KWJ A;  1WEW A;  5FEY A;  1WEM A;  4YAB A;  3RPG B;  4LZR A;  4NR5 A;  5I83 A;  4CUS A;  1LDJ B;  5EWD A;  2JRJ A;  4GNG A;  4TT2 A;  4BJX A;  5CS8 A;  3UVY A;  5E9M A;  5IGL A;  5LUU A;  3NXB A;  2VP7 A;  4NXJ A;  1E4U A;  1DVP A;  4NR7 A;  4ZDT A;  3JVJ A;  4TZ8 A;  1VFY A;  5B76 A;  5EM3 A;  4QF3 A;  1V87 A;  4QB3 A;  5FG5 A;  3N9L A;  2FUI A;  5EIC A;  5AD3 A;  4NS5 A;  3AAD A;  4A0C D;  2MA5 A;  5G0F A;  5FE6 A;  4QUU A;  5ENJ A;  2F42 A;  5HEM A;  5H85 A;  3N9O A;  5KU3 A;  5FE8 A;  2H0D A;  2ECV A;  3LRQ A;  4QSU A;  5FE3 A;  4MVT A;  1MM3 A;  4KV1 A;  4MSX A;  4R8P K;  5I1Q A;  2DKW A;  2NAA A;  5FE0 A;  5KTW A;  4F3I A;  5F62 A;  2FUU A;  5ETB A;  5JWM A;  4WZ0 A;  4QZS A;  5DBM A;  4XI1 A;  4I7D A;  3N9Q A;  4S3O C;  5FE9 A;  5B75 A;  3DAI A;  2L80 A;  2LDR A;  5F25 A;  4A4C A;  4O77 A;  2LGG A;  1HYI A;  5EIS A;  3LQJ A;  5HM0 A;  2XB1 A;  4UIU A;  5L8U A;  4TT4 A;  3UV4 A;  5D24 A;  5HRV A;  4QNS A;  5F36 A;  2G6Q A;  2YHN A;  2MA6 A;  2E7N A;  4UIV A;  5CY9 A;  5FFW A;  2KU3 A;  2FSA A;  4QYL A;  5FG4 A;  3HCT A;  3O35 A;  4YBS A;  4LK9 A;  4AVX A;  5FE5 A;  4IOR A;  3HCU A;  1Z2Q A;  4UYG A;  3P1C A;  2GRC A;  5CQ3 A;  5H1T A;  5F63 A;  2L85 A;  4UIZ A;  5D1L B;  3G0J A;  4C9Z A;  3UVX A;  3L1Z B;  4HXR A;  5CQT A;  3P1F A;  5AD2 A;  5ENF A;  4TU4 A;  2R10 A;  5D3L A;  4PKL A;  1N87 A;  4NUD A;  5DYA A;  5FB0 A;  2YQD A;  4CLB A;  2AN6 A;  2JMI A;  5CQ7 A;  5CRM A;  5CQA A;  5EPR A;  3ZYU A;  4TQN A;  4Y03 A;  4YYI A;  2LGV A;  2M3H A;  4LKA A;  5D3R A;  2LN0 A;  4YYN A;  2K4D A;  3GV4 A;  5E9K A;  3HMH A;  4NRB A;  4Q0O A;  4QEV A;  5ENI A;  5TRB A;  5ENB A;  4HXP A;  2Y1N A;  5A82 A;  1RMD A;  4FJC A;  4W4U A;  2YYR A;  5KH7 A;  5HRX A;  4ALG A;  4R7E A;  5ENH A;  2JMD A;  4V3K C;  2DVS A;  5DKH A;  4QSP A;  5CUA A;  4HBW A;  4HBV A;  4O78 A;  4YBM A;  5C7N A;  5F1L A;  5ACY A;  4XUA A;  5KO4 A;  4WZ2 A;  4V3L C;  4O7C A;  3M62 A;  5I40 A;  4NUC A;  4NUE A;  3D7C A;  2KWN A;  4GNE A;  1JM7 B;  3O37 A;  3UV2 A;  5CUC A;  5D3H A;  5FH7 A;  5L8T A;  5JG6 A;  3O7A A;  4YYM A;  4B86 C;  5EPS A;  2L5E A;  2YEM A;  4LLB A;  4QR4 A;  2RI7 A;  5DFD A;  1N72 A;  2ECT A;  1X4I A;  4MEN A;  2F6N A;  3EB6 A;  4O72 A;  3PUR A;  4AP4 A;  1ZS5 A;  3MQM A;  5I29 A;  4PY6 A;  4LJN A;  5KHM A;  5D3T A;  4A4B A;  3O34 A;  1Z60 A;  3IU6 A;  4O74 A;  5DKD A;  5EYA F;  4QY4 A;  5LCW B;  4NN2 A;  4CFL A;  4YY4 A;  5FFY A;  2VJF A;  2VJE A;  4GND A;  3SOW A;  3S91 A;  4B7Y C;  2DVV A;  5HFR A;  2KIZ A;  4L7X A;  2L0B A;  5I3L A;  4HXO A;  3L1X A;  5HLS A;  3ASL A;  5EVA A;  2QIZ A;  3MXF A;  2EA6 A;  1X0J A;  5HFQ A;  2K17 A;  2YSJ A;  3T6R A;  1ZBD B;  4A49 A;  5L97 A;  4IR4 A;  5II2 A;  5CFW A;  5LVR A;  3RPG C;  3QZT A;  5CUB A;  3QZS A;  4LC2 A;  4WHU A;  2MJV B;  2ECN A;  1IYM A;  5CQ8 A;  5E73 A;  5CU8 A;  4AYC B;  3N9P A;  5AME A;  2YEK A;  5EGU A;  5LKX A;  5C4Q A;  5IGK A;  1EQF A;  5LJ1 A;  2C2V S;  2CSY A;  5I86 A;  4IR5 A;  2LXP C;  3KNV A;  5TB6 A;  4QR5 A;  4GPJ A;  5LKU A;  5IBN A;  3FL2 A;  3ZPV 1;  2Y1M A;  3SHB A;  5DX4 A;  2E7O A;  3Q2F A;  5KH3 A;  4A9L A;  4TZ2 A;  4YYJ A;  4MR4 A;  4N4G A;  4Z1S A;  2YEL A;  4O76 A;  3U5K A;  4NR8 A;  4NRA A;  3U5O A;  3IU5 A;  3C6W A;  4IOQ A;  3U5M A;  4A9O A;  2D9E A;  4FO9 A;  2MUM A;  4FLP A;  5E9I A;  4A9K A;  4QF2 A;  1VYX A;  5HEN A;  3ONI A;  4X2I A;  5FG6 A;  1WEP A;  2VPG A;  4QR3 A;  5DLX A;  2OO1 A;  2G4A A;  5EV9 A;  4CFK A;  1Z6U A;  4P5O B;  1HYJ A;  1JOC A;  1WEE A; 
#chains in the Genus database with same CATH topology
 5ETD A;  5H9M A;  4QSS A;  1FP0 A;  2JMJ A;  5HRW A;  5CTL A;  5ENC A;  5FE1 A;  4NR6 A;  2R0S A;  5DYX A;  5LKZ A;  5TBN A;  5TDR A;  4HXM A;  5D7X A;  1K2F A;  4N4F A;  4UIW A;  3S92 A;  4Q6F A;  5FFV A;  4WA6 A;  3N9N A;  2LGK A;  5E3G A;  4LR6 A;  1WEQ A;  2JUN A;  5A7C A;  4UYD A;  2MKE A;  3GL6 A;  3MUL A;  5EWH A;  4H9D A;  5F5Z A;  2VPB A;  4CUT A;  1BOR A;  4MR5 A;  2YUC A;  2RO1 A;  5C85 A;  4YAX A;  5D26 A;  5FB1 A;  5A85 A;  5IGM A;  1WIL A;  3DPL R;  5SVI A;  3ERR A;  5C87 A;  3C5K A;  1JM7 A;  3JVL A;  5EQ1 A;  4E96 A;  2K16 A;  5FDZ A;  2YRE A;  3DWY A;  4QSX A;  4LDF A;  1CHC A;  3ZVY A;  4J0R A;  5JI8 A;  5IG6 A;  4WHW A;  1FBV A;  5CUE A;  2CKL A;  5BT3 A;  3FKM X;  4CUP A;  2LGL A;  4I7C A;  2QIC A;  4Q0N A;  4BW1 A;  2CT2 A;  5II1 A;  1WEO A;  4OGE A;  2H60 A;  2LSP B;  2ECJ A;  3K2J A;  5DW1 A;  2C2L A;  5IID A;  5E9Y A;  4BBQ A;  4Z6I A;  5BT5 A;  1WE9 A;  2EOD A;  3FM8 C;  3HTK C;  5D0C A;  5CGP A;  4ZQL A;  2D8U A;  2OXQ C;  4A9F A;  5DFC A;  1WGM A;  4QUT A;  2E3K A;  4N4H A;  5DW2 A;  2UZG A;  2L84 A;  3P1E A;  4NQM A;  5FH6 A;  5FE2 A;  2YW8 A;  3DQV R;  5KH9 A;  4O7F A;  3PUQ A;  5D3S A;  4YYD A;  3TLP A;  4ZUX U;  2B0O E;  5LJ2 A;  4A9N A;  2DJA A;  2ECG A;  3UV5 A;  2VNF A;  2KYU A;  4F52 B;  4AKN A;  3LVR E;  2KTB B;  4MEP A;  5F2P A;  4NR9 A;  4N3W A;  4TTE A;  4HXS A;  4AUQ B;  4PS5 A;  4TYL A;  5A5R A;  4AKH A;  3U5P A;  2YQL A;  4LYS A;  2G45 A;  5B77 A;  5G05 B;  5FE4 A;  2I50 A;  2ZET C;  3LQH A;  4A9J A;  4KV4 A;  5F3A A;  4WIV A;  4UP0 A;  5BT4 A;  5D1M B;  4NYV A;  4QST A;  3GG3 A;  4Z1Q A;  4UP5 A;  2G43 A;  5G4S A;  5CQ6 A;  4IR3 A;  1JSP B;  2YQM A;  2DVQ A;  4QC1 A;  5EPB A;  5E3D A;  5LKT A;  1VD4 A;  2K1J A;  5DKC A;  5CPE A;  5HQ5 A;  2XEU A;  5C13 A;  2YHO A;  2KKX A;  4YAT A;  4X3G A;  3UW9 A;  1F68 A;  5K3Q A;  4PCE A;  2YDW A;  4XYA A;  2LQ6 A;  4A9I A;  4FK5 A;  3HCS A;  4MEQ A;  5L96 A;  5FE7 A;  4QEU A;  2CRW A;  5HEL A;  1XWH A;  4F1P A;  3MB4 A;  5HQ7 A;  5D3N A;  4XUB A;  3P1D A;  2XOZ A;  4AI6 A;  4UIX A;  5C89 A;  3T9K A;  5L98 A;  4UIY A;  2VPD A;  4R2Y A;  5ENE A;  5KTU A;  5AIT A;  5DIN A;  3SOU A;  3M7K A;  4CA1 A;  4NQN A;  2MNY A;  2MT5 A;  2WP2 A;  5TCM A;  2IDA A;  2YYN A;  3O47 A;  5F61 A;  3KV6 A;  4HXL A;  4NRC A;  2LRI C;  4IC2 A;  4UYE A;  2EGP A;  1F62 A;  5CQ5 A;  4BW2 A;  1U6G B;  4KCX A;  4NYW A;  4CUR A;  5IGN A;  5CQ4 A;  5EI4 A;  5CZG A;  4TT6 A;  4PCI A;  2OUO A;  5EU1 A;  3U5N A;  1MM2 A;  5HQ6 A;  4LAD B;  4XY9 A;  4O64 A;  3RCW A;  2RSD A;  3PHD A;  4PPE A;  3VK6 A;  3G0L A;  2RFJ A;  2HDP A;  2PUY A;  3V43 A;  5E74 A;  2KRE A;  2MD7 B;  2VPE A;  2ECW A;  3SVF A;  4O75 A;  3N9M A;  2ECI A;  3D1B A;  3NG2 A;  5F1H A;  5A5N A;  3ZPV E;  5B8D A;  5E0R A;  2MIQ A;  5EWW A;  5I7X A;  2RS9 B;  2YT5 A;  2OSS A;  4YK0 A;  4NYX A;  5CP5 A;  5J0D A;  3JUE A;  5D1K B;  5E7D A;  4QSV A;  4QSQ A;  3U5J A;  5I88 A;  4GB0 A;  5DKA A;  3KQI A;  4YAD A;  2D82 A;  4MR6 A;  1WFK A;  5D3J A;  5CUD A;  5A5S A;  1LDK C;  2QJ0 A;  2DAT A;  2KWO A;  5D25 A;  5COI A;  3O33 A;  4TU6 A;  5TAB A;  1T1H A;  5E9L A;  5ENG A;  4YC9 A;  2KE1 A;  5DLZ A;  2VJF B;  2VJE B;  3DWD A;  2L7P A;  3P5O A;  4LRG A;  4MEO A;  5DYC A;  2D8S A;  5G04 B;  4HBY A;  3LJU X;  4UYF B;  2I7K A;  5CUG A;  4ZW1 A;  2FFW A;  4CCG X;  3RTR B;  2DVR A;  2YUR A;  5F60 A;  4BW4 A;  4LYI A;  2M1R A;  4Z0O A;  4N4I A;  4HXK A;  4A9H A;  4MR3 A;  2DWW A;  2RNX A;  4A9E A;  5EP7 A;  4O7E A;  4Z93 A;  5E9V A;  5FH8 A;  3M63 A;  4S3O B;  2PNX A;  2LXH C;  2MD8 C;  2N9G A;  4O7B A;  3LXJ A;  4HBX A;  5FER A;  5LJ0 A;  3UVW A;  2YU4 A;  5B78 A;  3LQI A;  4QC3 A;  5I80 A;  4UYH A;  4CUU A;  4UIT A;  1G25 A;  4QYD A;  3JVK A;  5G4R A;  2RR4 A;  3AQA A;  4O70 A;  4YYG A;  3JVM A;  5D3P A;  4QSW A;  4YYK A;  4OGI A;  3SVG A;  2L75 A;  2E6R A;  2CRR A;  2MNZ A;  3ZYQ A;  3KDE C;  4Z6H A;  2YW5 A;  3U5L A;  2CSV A;  5CRZ A;  5I7Y A;  5KTX A;  2YVR A;  3T7L A;  4LZ2 A;  2H0D B;  2XOC A;  4J0S A;  4L58 A;  3MHS A;  3ZTG A;  4LYW A;  3I2D A;  3O36 A;  4LZS A;  4ZC9 A;  4DON A;  5L99 A;  4J1P A;  2R0Y A;  5HJC A;  3O70 A;  3Q1D A;  4QEW A;  4AYC A;  4TKP B;  2KGI A;  4UI9 B;  4HXN A;  5FBX A;  4C67 A;  5EWV A;  2L43 A;  3IHP A;  3M99 A;  3VKG A;  4O7A A;  3LJW A;  4RVR A;  2M13 A;  3MDB C;  1E6I A;  4I7B A;  4A9M A;  1WUM A;  3UVD A;  3ZVZ B;  2YSM A;  5H1U A;  4O71 A;  2BAY A;  2M6M A;  4ALH A;  5I89 A;  5AMF A;  2KWK A;  4IC3 A;  5C11 A;  2DSM A;  3EB5 A;  4TS8 A;  2WP1 A;  4AKG A;  4IOO A;  4YH4 A;  5A5O A;  4CL9 A;  4IR6 A;  5SVI B;  4QSR A;  2M85 A;  3ZNI A;  5DY7 A;  2I8N A;  2RNW A;  5A5Q A;  3QZV A;  4CUQ A;  4NR4 A;  4WZ3 B;  2Y43 A;  5LVQ A;  4Z0R A;  4XY8 A;  1WES A;  4YH3 A;  5A83 A;  3SOX A;  4BHW A;  2R0V A;  5DFB A;  4AKI A;  5A5P A;  3L11 A;  4FIP A;  2KGG A;  5B79 A;  1WEN A;  2CKL B;  4BW3 A;  1X4J A;  5K29 A;  2EXU A;  2RNY A;  2DX8 A;  5EA1 A;  3MHH A;  4YYH A;  1WEV A;  2LV9 A;  4J3I A;  5H1V A;  5A81 A;  3HME A;  5EWC A;  1X4U A;  4YBT A;  1WUG A;  5C8G A;  5J3X A;  4QBM A;  1WEU A;  3MB3 A;  2IQJ A;  2F6J A;  3KV5 A;  3LVQ E;  4YY6 A;  2XP0 A;  2E61 A;  2E6S A;  4C66 A;  3MUK A;  4GNF A;  1JM4 B;  4PTB A;  2NXB A;  5TDW A;  5DYU A;  2KR4 A;  4UYF A;  3HMF A;  2L5U A;  5AIU A;  2HYE D;  4OGJ A;  4OUF A;  3Q2E A;  3I3J A;  1WIM A;  2KFT A;  3SVH A;  5EK9 A;  5HCL A;  2CSZ A;  2KWJ A;  1WEW A;  5FEY A;  1WEM A;  4YAB A;  2CON A;  3RPG B;  4LZR A;  4NR5 A;  5I83 A;  4CUS A;  1LDJ B;  5EWD A;  2JRJ A;  4GNG A;  4TT2 A;  4BJX A;  1ZKR A;  5CS8 A;  3UVY A;  5E9M A;  5IGL A;  5LUU A;  3FEH A;  3NXB A;  2VP7 A;  4NXJ A;  1E4U A;  1DVP A;  4NR7 A;  4ZDT A;  3JVJ A;  4TZ8 A;  1VFY A;  5B76 A;  2EJN A;  5EM3 A;  4QF3 A;  1V87 A;  4QB3 A;  5FG5 A;  3N9L A;  2FUI A;  5EIC A;  5AD3 A;  4NS5 A;  3AAD A;  4A0C D;  2MA5 A;  5G0F A;  5FE6 A;  4OGC A;  4QUU A;  5ENJ A;  2F42 A;  5HEM A;  5H85 A;  3N9O A;  5KU3 A;  5FE8 A;  2H0D A;  2ECV A;  3LRQ A;  4QSU A;  5FE3 A;  4MVT A;  1MM3 A;  4KV1 A;  4MSX A;  4R8P K;  5I1Q A;  2DKW A;  2NAA A;  5FE0 A;  5KTW A;  4F3I A;  5F62 A;  2FUU A;  5ETB A;  5JWM A;  4WZ0 A;  4QZS A;  5DBM A;  4XI1 A;  4I7D A;  3N9Q A;  4S3O C;  5FE9 A;  5B75 A;  3DAI A;  2L80 A;  2LDR A;  5F25 A;  4A4C A;  4O77 A;  2LGG A;  1HYI A;  5EIS A;  3LQJ A;  5HM0 A;  2XB1 A;  2OWA A;  4UIU A;  3H7H A;  5L8U A;  4TT4 A;  3UV4 A;  5D24 A;  5HRV A;  4QNS A;  5F36 A;  2G6Q A;  2YHN A;  2MA6 A;  2E7N A;  4UIV A;  5CY9 A;  5FFW A;  2KU3 A;  2FSA A;  4QYL A;  5FG4 A;  3HCT A;  3O35 A;  4YBS A;  4LK9 A;  4AVX A;  5FE5 A;  4IOR A;  3PLW A;  3HCU A;  1Z2Q A;  4UYG A;  3P1C A;  2GRC A;  5CQ3 A;  5H1T A;  5F63 A;  2L85 A;  4UIZ A;  5D1L B;  3G0J A;  4C9Z A;  3UVX A;  2LAU A;  3L1Z B;  4HXR A;  5CQT A;  3P1F A;  2FD4 A;  5AD2 A;  5ENF A;  4TU4 A;  2R10 A;  5D3L A;  3FAO A;  4PKL A;  1N87 A;  4NUD A;  5DYA A;  5FB0 A;  2YQD A;  4CLB A;  2AN6 A;  2JMI A;  5CQ7 A;  3FJU B;  5CRM A;  5CQA A;  5EPR A;  3ZYU A;  4TQN A;  4Y03 A;  4YYI A;  2LGV A;  2M3H A;  4LKA A;  5D3R A;  2LN0 A;  4YYN A;  2K4D A;  3GV4 A;  5E9K A;  3HMH A;  4NRB A;  4Q0O A;  4QEV A;  5ENI A;  5TRB A;  5ENB A;  4HXP A;  2Y1N A;  5A82 A;  1RMD A;  4FJC A;  4W4U A;  2YYR A;  5KH7 A;  5HRX A;  4ALG A;  4R7E A;  5ENH A;  2JMD A;  4V3K C;  2DVS A;  5DKH A;  4QSP A;  5CUA A;  4HBW A;  4HBV A;  4O78 A;  4YBM A;  5C7N A;  5F1L A;  5ACY A;  2P57 A;  4XUA A;  5KO4 A;  4WZ2 A;  4V3L C;  4O7C A;  3M62 A;  5I40 A;  4NUC A;  4NUE A;  3D7C A;  2KWN A;  4GNE A;  1JM7 B;  3O37 A;  3DDT A;  3UV2 A;  5CUC A;  5D3H A;  1PUO A;  5FH7 A;  5L8T A;  5JG6 A;  3O7A A;  4YYM A;  4B86 C;  5EPS A;  2L5E A;  2YEM A;  4LLB A;  4QR4 A;  2RI7 A;  5DFD A;  1N72 A;  2ECT A;  1X4I A;  4MEN A;  2F6N A;  3EB6 A;  4O72 A;  3PUR A;  3E2D A;  1ZS5 A;  3MQM A;  5I29 A;  4PY6 A;  4LJN A;  4AP4 A;  5KHM A;  5D3T A;  4A4B A;  3O34 A;  1Z60 A;  3IU6 A;  1DCQ A;  2EGM A;  4O74 A;  5DKD A;  5EYA F;  4QY4 A;  5LCW B;  4NN2 A;  4CFL A;  4YY4 A;  3LDY A;  5FFY A;  2VJF A;  2VJE A;  4GND A;  3SOW A;  3S91 A;  4B7Y C;  2DVV A;  5HFR A;  2KIZ A;  4L7X A;  2L0B A;  5I3L A;  4HXO A;  2XOY A;  3L1X A;  5HLS A;  3ASL A;  5EVA A;  2QIZ A;  4QQ4 A;  3MXF A;  2EA6 A;  1X0J A;  5HFQ A;  2K17 A;  2YSJ A;  3T6R A;  1ZBD B;  4A49 A;  5L97 A;  4IR4 A;  5II2 A;  5CFW A;  5LVR A;  3RPG C;  3QZT A;  5CUB A;  3QZS A;  4LC2 A;  4WHU A;  2MJV B;  2ECN A;  1IYM A;  5CQ8 A;  5E73 A;  3D1D A;  5CU8 A;  3N9P A;  5AME A;  4AYC B;  2YEK A;  1MBM A;  5EGU A;  5LKX A;  5C4Q A;  5IGK A;  1EQF A;  5LJ1 A;  3VKH A;  2C2V S;  5I86 A;  4IR5 A;  2CSY A;  2KKY A;  2LXP C;  5TB6 A;  3KNV A;  4QR5 A;  4GPJ A;  5LKU A;  5IBN A;  3FL2 A;  5SVY A;  3ZPV 1;  2Y1M A;  3SHB A;  5DX4 A;  3SUB A;  2E7O A;  3Q2F A;  5KH3 A;  4A9L A;  4TZ2 A;  4YYJ A;  4MR4 A;  4N4G A;  4Z1S A;  2YEL A;  4O76 A;  3U5K A;  4NR8 A;  4NRA A;  3U5O A;  3IU5 A;  3C6W A;  4IOQ A;  4O62 A;  3U5M A;  4A9O A;  2D9E A;  4FO9 A;  2MUM A;  4FLP A;  5E9I A;  4A9K A;  4QF2 A;  1VYX A;  2JM3 A;  5HEN A;  3ONI A;  4X2I A;  5FG6 A;  1WEP A;  2VPG A;  4QR3 A;  5DLX A;  3FAN A;  2OO1 A;  2G4A A;  5EV9 A;  4CFK A;  1Z6U A;  4P5O B;  5SVX A;  1HYJ A;  1JOC A;  1WEE A; 
#chains in the Genus database with same CATH homology
 5ETD A;  5H9M A;  4QSS A;  1FP0 A;  2JMJ A;  5HRW A;  5CTL A;  5ENC A;  5FE1 A;  4NR6 A;  2R0S A;  5DYX A;  5LKZ A;  5TBN A;  5TDR A;  4HXM A;  5D7X A;  1K2F A;  4N4F A;  4UIW A;  3S92 A;  4Q6F A;  5FFV A;  4WA6 A;  3N9N A;  2LGK A;  5E3G A;  4LR6 A;  1WEQ A;  3GL6 A;  5A7C A;  4UYD A;  3MUL A;  5EWH A;  5F5Z A;  2VPB A;  4CUT A;  1BOR A;  4MR5 A;  2YUC A;  2RO1 A;  5C85 A;  4YAX A;  5D26 A;  5FB1 A;  5A85 A;  5IGM A;  1WIL A;  3DPL R;  5C87 A;  3C5K A;  1JM7 A;  3JVL A;  5EQ1 A;  4E96 A;  2K16 A;  5FDZ A;  2YRE A;  3DWY A;  4QSX A;  4LDF A;  1CHC A;  3ZVY A;  4J0R A;  5JI8 A;  5IG6 A;  4WHW A;  1FBV A;  5CUE A;  2CKL A;  5BT3 A;  3FKM X;  4CUP A;  2LGL A;  4I7C A;  2QIC A;  4Q0N A;  4BW1 A;  2CT2 A;  5II1 A;  1WEO A;  2H60 A;  2LSP B;  2ECJ A;  3K2J A;  5DW1 A;  2C2L A;  5IID A;  5E9Y A;  4BBQ A;  4Z6I A;  5BT5 A;  1WE9 A;  2EOD A;  3HTK C;  5D0C A;  5CGP A;  4ZQL A;  2OXQ C;  4A9F A;  5DFC A;  1WGM A;  4QUT A;  2E3K A;  4N4H A;  5DW2 A;  2UZG A;  2L84 A;  3P1E A;  4NQM A;  5FH6 A;  5FE2 A;  2YW8 A;  3DQV R;  5KH9 A;  4O7F A;  3PUQ A;  5D3S A;  4YYD A;  3TLP A;  4ZUX U;  5LJ2 A;  4A9N A;  2ECG A;  3UV5 A;  2VNF A;  2KYU A;  4F52 B;  4AKN A;  2KTB B;  4MEP A;  5F2P A;  4NR9 A;  4N3W A;  4TTE A;  4HXS A;  4AUQ B;  4PS5 A;  4TYL A;  5A5R A;  2YQL A;  3U5P A;  5B77 A;  4LYS A;  2G45 A;  5G05 B;  5FE4 A;  2I50 A;  2ZET C;  3LQH A;  4A9J A;  4KV4 A;  5F3A A;  4WIV A;  4UP0 A;  5BT4 A;  5D1M B;  4NYV A;  4QST A;  3GG3 A;  4Z1Q A;  4UP5 A;  2G43 A;  5G4S A;  5CQ6 A;  4IR3 A;  1JSP B;  2YQM A;  2DVQ A;  4QC1 A;  5EPB A;  5E3D A;  5LKT A;  1VD4 A;  2K1J A;  5DKC A;  5CPE A;  5HQ5 A;  2XEU A;  5C13 A;  2YHO A;  4YAT A;  4X3G A;  3UW9 A;  1F68 A;  4PCE A;  2YDW A;  4XYA A;  2LQ6 A;  4A9I A;  4FK5 A;  3HCS A;  4MEQ A;  5L96 A;  5FE7 A;  4QEU A;  5HEL A;  1XWH A;  3MB4 A;  5HQ7 A;  5D3N A;  4XUB A;  3P1D A;  4UIX A;  5C89 A;  5L98 A;  4UIY A;  2VPD A;  4R2Y A;  5ENE A;  5KTU A;  5AIT A;  5DIN A;  3SOU A;  4CA1 A;  4NQN A;  2MNY A;  2MT5 A;  2WP2 A;  5TCM A;  2IDA A;  2YYN A;  5F61 A;  3KV6 A;  4HXL A;  4NRC A;  2LRI C;  4IC2 A;  4UYE A;  2EGP A;  1F62 A;  5CQ5 A;  4BW2 A;  1U6G B;  4KCX A;  4NYW A;  4CUR A;  5IGN A;  5CQ4 A;  5EI4 A;  5CZG A;  4TT6 A;  4PCI A;  2OUO A;  5EU1 A;  3U5N A;  1MM2 A;  5HQ6 A;  4LAD B;  4XY9 A;  4O64 A;  3RCW A;  2RSD A;  3PHD A;  4PPE A;  3VK6 A;  3G0L A;  2RFJ A;  2HDP A;  2PUY A;  3V43 A;  5E74 A;  2KRE A;  2MD7 B;  2VPE A;  2ECW A;  3SVF A;  4O75 A;  3N9M A;  2ECI A;  3NG2 A;  3ZPV E;  5F1H A;  5A5N A;  5B8D A;  5E0R A;  2MIQ A;  5EWW A;  5I7X A;  2RS9 B;  2YT5 A;  2OSS A;  4YK0 A;  4NYX A;  5CP5 A;  5J0D A;  5D1K B;  5E7D A;  4QSV A;  4QSQ A;  3U5J A;  5I88 A;  4GB0 A;  5DKA A;  3KQI A;  4YAD A;  2D82 A;  4MR6 A;  1WFK A;  5D3J A;  5CUD A;  5A5S A;  1LDK C;  2QJ0 A;  2DAT A;  2KWO A;  5D25 A;  5COI A;  3O33 A;  4TU6 A;  5TAB A;  1T1H A;  5E9L A;  5ENG A;  4YC9 A;  2KE1 A;  5DLZ A;  2VJF B;  2VJE B;  3P5O A;  4LRG A;  4MEO A;  5DYC A;  2D8S A;  5G04 B;  4HBY A;  4UYF B;  2I7K A;  5CUG A;  4ZW1 A;  4CCG X;  3RTR B;  2DVR A;  2YUR A;  5F60 A;  4BW4 A;  4LYI A;  2M1R A;  4N4I A;  4HXK A;  4A9H A;  4MR3 A;  2DWW A;  2RNX A;  4A9E A;  5EP7 A;  4O7E A;  4Z93 A;  5E9V A;  5FH8 A;  3M63 A;  4S3O B;  2PNX A;  2LXH C;  2MD8 C;  2N9G A;  4O7B A;  3LXJ A;  4HBX A;  5FER A;  5LJ0 A;  3UVW A;  2YU4 A;  5B78 A;  3LQI A;  4QC3 A;  5I80 A;  4UYH A;  4CUU A;  4UIT A;  1G25 A;  4QYD A;  3JVK A;  5G4R A;  3AQA A;  4O70 A;  4YYG A;  3JVM A;  5D3P A;  4QSW A;  4YYK A;  4OGI A;  3SVG A;  2L75 A;  2E6R A;  2MNZ A;  3ZYQ A;  4Z6H A;  2YW5 A;  3U5L A;  5CRZ A;  5I7Y A;  5KTX A;  3T7L A;  4LZ2 A;  2H0D B;  4J0S A;  4L58 A;  3MHS A;  3ZTG A;  4LYW A;  3I2D A;  3O36 A;  4LZS A;  4ZC9 A;  4DON A;  5L99 A;  4J1P A;  2R0Y A;  5HJC A;  3O70 A;  4AYC A;  4QEW A;  4TKP B;  2KGI A;  4UI9 B;  4HXN A;  5FBX A;  4C67 A;  5EWV A;  2L43 A;  3IHP A;  3M99 A;  4O7A A;  3LJW A;  4RVR A;  1E6I A;  4I7B A;  4A9M A;  1WUM A;  3UVD A;  3ZVZ B;  2YSM A;  5H1U A;  4O71 A;  2BAY A;  2M6M A;  4ALH A;  5I89 A;  5AMF A;  2KWK A;  4IC3 A;  5C11 A;  3EB5 A;  4TS8 A;  2WP1 A;  4IOO A;  4YH4 A;  5A5O A;  4CL9 A;  4IR6 A;  4QSR A;  2M85 A;  3ZNI A;  5DY7 A;  2I8N A;  2RNW A;  5A5Q A;  3QZV A;  4CUQ A;  4NR4 A;  4WZ3 B;  2Y43 A;  5LVQ A;  4XY8 A;  1WES A;  4YH3 A;  5A83 A;  3SOX A;  4BHW A;  2R0V A;  5DFB A;  3L11 A;  5A5P A;  4FIP A;  2KGG A;  5B79 A;  1WEN A;  2CKL B;  4BW3 A;  1X4J A;  5K29 A;  2RNY A;  2DX8 A;  5EA1 A;  3MHH A;  4YYH A;  1WEV A;  2LV9 A;  4J3I A;  5H1V A;  5A81 A;  3HME A;  5EWC A;  1X4U A;  4YBT A;  1WUG A;  5C8G A;  5J3X A;  4QBM A;  1WEU A;  3MB3 A;  2F6J A;  3KV5 A;  4YY6 A;  2E6S A;  4C66 A;  3MUK A;  4GNF A;  1JM4 B;  4PTB A;  2NXB A;  5TDW A;  5DYU A;  2KR4 A;  4UYF A;  3HMF A;  2L5U A;  5AIU A;  2HYE D;  4OGJ A;  4OUF A;  3Q2E A;  3I3J A;  1WIM A;  2KFT A;  3SVH A;  5EK9 A;  5HCL A;  2CSZ A;  2KWJ A;  1WEW A;  5FEY A;  1WEM A;  4YAB A;  3RPG B;  4LZR A;  4NR5 A;  5I83 A;  4CUS A;  1LDJ B;  5EWD A;  2JRJ A;  4GNG A;  4TT2 A;  4BJX A;  5CS8 A;  3UVY A;  5E9M A;  5IGL A;  5LUU A;  3NXB A;  2VP7 A;  4NXJ A;  1E4U A;  1DVP A;  4NR7 A;  4ZDT A;  3JVJ A;  4TZ8 A;  1VFY A;  5B76 A;  5EM3 A;  4QF3 A;  1V87 A;  4QB3 A;  5FG5 A;  3N9L A;  2FUI A;  5EIC A;  5AD3 A;  4NS5 A;  3AAD A;  4A0C D;  2MA5 A;  5G0F A;  5FE6 A;  4QUU A;  5ENJ A;  2F42 A;  5HEM A;  5H85 A;  3N9O A;  5KU3 A;  5FE8 A;  2H0D A;  2ECV A;  3LRQ A;  4QSU A;  5FE3 A;  4MVT A;  1MM3 A;  4KV1 A;  4MSX A;  4R8P K;  5I1Q A;  2DKW A;  2NAA A;  5FE0 A;  5KTW A;  4F3I A;  5F62 A;  2FUU A;  5ETB A;  5JWM A;  4WZ0 A;  4QZS A;  5DBM A;  4XI1 A;  4I7D A;  3N9Q A;  4S3O C;  5FE9 A;  5B75 A;  3DAI A;  2L80 A;  2LDR A;  5F25 A;  4A4C A;  4O77 A;  2LGG A;  1HYI A;  5EIS A;  3LQJ A;  5HM0 A;  2XB1 A;  4UIU A;  5L8U A;  4TT4 A;  3UV4 A;  5D24 A;  5HRV A;  4QNS A;  5F36 A;  2G6Q A;  2YHN A;  2MA6 A;  2E7N A;  4UIV A;  5CY9 A;  5FFW A;  2KU3 A;  2FSA A;  4QYL A;  5FG4 A;  3HCT A;  3O35 A;  4YBS A;  4LK9 A;  4AVX A;  5FE5 A;  4IOR A;  3HCU A;  1Z2Q A;  4UYG A;  3P1C A;  2GRC A;  5CQ3 A;  5H1T A;  5F63 A;  2L85 A;  4UIZ A;  5D1L B;  3G0J A;  4C9Z A;  3UVX A;  3L1Z B;  4HXR A;  5CQT A;  3P1F A;  5AD2 A;  5ENF A;  4TU4 A;  2R10 A;  5D3L A;  4PKL A;  1N87 A;  4NUD A;  5DYA A;  5FB0 A;  2YQD A;  4CLB A;  2AN6 A;  2JMI A;  5CQ7 A;  5CRM A;  5CQA A;  5EPR A;  3ZYU A;  4TQN A;  4Y03 A;  4YYI A;  2LGV A;  2M3H A;  4LKA A;  5D3R A;  2LN0 A;  4YYN A;  2K4D A;  3GV4 A;  5E9K A;  3HMH A;  4NRB A;  4Q0O A;  4QEV A;  5ENI A;  5TRB A;  5ENB A;  4HXP A;  2Y1N A;  5A82 A;  1RMD A;  4FJC A;  4W4U A;  2YYR A;  5KH7 A;  5HRX A;  4ALG A;  4R7E A;  5ENH A;  2JMD A;  4V3K C;  2DVS A;  5DKH A;  4QSP A;  5CUA A;  4HBW A;  4HBV A;  4O78 A;  4YBM A;  5C7N A;  5F1L A;  5ACY A;  4XUA A;  5KO4 A;  4WZ2 A;  4V3L C;  4O7C A;  3M62 A;  5I40 A;  4NUC A;  4NUE A;  3D7C A;  2KWN A;  4GNE A;  1JM7 B;  3O37 A;  3UV2 A;  5CUC A;  5D3H A;  5FH7 A;  5L8T A;  5JG6 A;  3O7A A;  4YYM A;  4B86 C;  5EPS A;  2L5E A;  2YEM A;  4LLB A;  4QR4 A;  2RI7 A;  5DFD A;  1N72 A;  2ECT A;  1X4I A;  4MEN A;  2F6N A;  3EB6 A;  4O72 A;  3PUR A;  4AP4 A;  1ZS5 A;  3MQM A;  5I29 A;  4PY6 A;  4LJN A;  5KHM A;  5D3T A;  4A4B A;  3O34 A;  1Z60 A;  3IU6 A;  4O74 A;  5DKD A;  5EYA F;  4QY4 A;  5LCW B;  4NN2 A;  4CFL A;  4YY4 A;  5FFY A;  2VJF A;  2VJE A;  4GND A;  3SOW A;  3S91 A;  4B7Y C;  2DVV A;  5HFR A;  2KIZ A;  4L7X A;  2L0B A;  5I3L A;  4HXO A;  3L1X A;  5HLS A;  3ASL A;  5EVA A;  2QIZ A;  3MXF A;  2EA6 A;  1X0J A;  5HFQ A;  2K17 A;  2YSJ A;  3T6R A;  1ZBD B;  4A49 A;  5L97 A;  4IR4 A;  5II2 A;  5CFW A;  5LVR A;  3RPG C;  3QZT A;  5CUB A;  3QZS A;  4LC2 A;  4WHU A;  2MJV B;  2ECN A;  1IYM A;  5CQ8 A;  5E73 A;  5CU8 A;  4AYC B;  3N9P A;  5AME A;  2YEK A;  5EGU A;  5LKX A;  5C4Q A;  5IGK A;  1EQF A;  5LJ1 A;  2C2V S;  2CSY A;  5I86 A;  4IR5 A;  2LXP C;  3KNV A;  5TB6 A;  4QR5 A;  4GPJ A;  5LKU A;  5IBN A;  3FL2 A;  3ZPV 1;  2Y1M A;  3SHB A;  5DX4 A;  2E7O A;  3Q2F A;  5KH3 A;  4A9L A;  4TZ2 A;  4YYJ A;  4MR4 A;  4N4G A;  4Z1S A;  2YEL A;  4O76 A;  3U5K A;  4NR8 A;  4NRA A;  3U5O A;  3IU5 A;  3C6W A;  4IOQ A;  3U5M A;  4A9O A;  2D9E A;  4FO9 A;  2MUM A;  4FLP A;  5E9I A;  4A9K A;  4QF2 A;  1VYX A;  5HEN A;  3ONI A;  4X2I A;  5FG6 A;  1WEP A;  2VPG A;  4QR3 A;  5DLX A;  2OO1 A;  2G4A A;  5EV9 A;  4CFK A;  1Z6U A;  4P5O B;  1HYJ A;  1JOC A;  1WEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...