1LDKC

Structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
88
structure length
88
Chain Sequence
KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords CULLIN HOMOLOG
total genus 4
structure length 88
sequence length 88
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1ldkC00
3O37A 1WIMA 2RSDA 4GNDA 4WZ2A 4AP4A 4LLBA 1ZBDB 5TBNA 2CKLA 3RTRB 4IC3A 5KH9A 2Y43A 2ECJA 2K4DA 1K2FA 4FK5A 2C2LA 2E6RA 2XEUA 4A4BA 3M99A 2KGIA 3HTKC 2MNZA 3HCUA 2YHNA 5LKZA 4WZ3B 4R7EA 3ASLA 3L1ZB 2M3HA 4I7DA 1G25A 1JM7A 4YBMA 5B78A 2KFTA 1E4UA 4YBSA 5G05B 1WEMA 2D8SA 4QF2A 2JRJA 2C2VS 1VFYA 4S3OC 5JG6A 3LQIA 3C6WA 2K16A 2NAAA 1VYXA 2YUCA 4IC2A 2EODA 2KYUA 1T1HA 2L43A 3O36A 2MA6A 3KV6A 2IDAA 5B76A 2MUMA 2KIZA 4LK9A 2KREA 1VD4A 3SOWA 3LQHA 2KU3A 2F42A 3GV4A 5FB1A 4YAXA 4F52B 1CHCA 3HCTA 4LJNA 1N87A 5G0FA 2QIZA 2ECVA 5C11A 2KWKA 3T7LA 2ZETC 2YQLA 2M1RA 2HYED 2YREA 3C5KA 5DKAA 4PTBA 2CSZA 2Y1NA 4WA6A 3PUQA 2CT2A 2YURA 2KR4A 2VP7A 2LN0A 4WZ0A 2QJ0A 3ZYQA 3N9NA 2ECTA 4AYCB 4I7CA 4GB0A 2YYRA 2LGGA 2JMJA 2OXQC 2UZGA 2YSMA 3DQVR 2VJEB 4UP5A 1WEEA 1IYMA 5EYAF 2JMDA 4A49A 4AVXA 5FEYA 2FSAA 4R2YA 5KH3A 1XWHA 4ZUXU 2FUUA 2PUYA 3FL2A 4PPEA 2VPBA 4GNGA 2MD8C 1X4IA 2KGGA 3ZPV1 2VNFA 2LV9A 3U5PA 2JMIA 2AN6A 5B8DA 4MSXA 4N4FA 2EA6A 1BORA 3O34A 4P5OB 1WENA 2MIQA 4UI9B 5H1VA 5LKXA 2EGPA 4AYCA 2E6SA 2VJFA 5AITA 5H1TA 4XI1A 5AIUA 3L11A 2LXHC 3U5OA 2Y1MA 4LKAA 4R8PK 3N9PA 2KWOA 4O64A 2LGKA 3ZPVE 2CSYA 3N9OA 2ECNA 2MA5A 3QZVA 4Q6FA 1Z2QA 3MHHA 4FIPA 5C13A 4GNEA 5LKTA 2G45A 5FB0A 5D1LB 3V43A 4I7BA 4YATA 5FERA 3U5NA 2LXPC 5B75A 1HYIA 4FJCA 1RMDA 4GNFA 4LADB 4V3KC 4CCGX 3KQIA 1WEOA 1FBVA 1FP0A 1DVPA 3EB5A 2VPDA 2BAYA 2LDRA 2M6MA 4YADA 3O35A 5TABA 1LDJB 5H1UA 3KNVA 5B77A 2F6JA 5KH7A 2QICA 3KV5A 3MHSA 1WEQA 2ECGA 2YU4A 2KE1A 4ZQLA 3L1XA 4B7YC 4L58A 4V3LC 1HYJA 1WEVA 3SOUA 3M63A 5TRBA 1MM2A 4NN2A 5LCWB 4C9ZA 2G43A 1Z6UA 4AUQB 4CA1A 2MNYA 3EB6A 2LRIC 2MT5A 1JM7B 4BBQA 4QF3A 1LDKC 2FUIA 3O33A 2RI7A 2L5UA 3O70A 5LKUA 2KWJA 2CKLB 4B86C 1WESA 4YBTA 2HDPA 3ZTGA 2L75A 5B79A 4UP0A 1WEUA 5TDWA 3SOXA 4YABA 4MVTA 3HCSA 2M85A 5I3LA 5TDRA 3T6RA 5H9MA 1WEPA 2G6QA 2YSJA 1Z60A 1WE9A 2ECWA 2L80A 3RPGC 1X4UA 2VJFB 2ECIA 5DINA 4S3OB 3ZVYA 1U6GB 2K17A 3N9MA 3O7AA 3DPLR 3PURA 3ZVZB 2YHOA 3U5MA 2KWNA 2MD7B 2H0DB 3ZNIA 1X4JA 3SHBA 3LQJA 2L0BA 1MM3A 2PNXA 4W4UA 1WILA 3NG2A 2VPGA 1V87A 1JOCA 2YT5A 3I2DA 5J3XA 4FO9A 4A4CA 4ZDTA 1WFKA 4BHWA 2K1JA 2LGLA 3VK6A 4A0CD 5G04B 2F6NA 4TKPB 3RPGB 2YW8A 4N3WA 3N9QA 1WGMA 2DX8A 2VJEA 4L7XA 2LGVA 3N9LA 2I50A 3IHPA 3M62A 3PHDA 5D1KB 2YQMA 1WEWA 5D1MB 3GL6A 1F62A 2H0DA 4X3GA 2XB1A 3LRQA 2LQ6A 2VPEA 4YC9A
chains in the Genus database with same CATH superfamily
3O37A 1WIMA 2RSDA 4GNDA 5SVIB 4WZ2A 4AP4A 4LLBA 1ZBDB 5TBNA 2CKLA 3RTRB 4IC3A 5KH9A 2Y43A 3FAOA 2ECJA 2K4DA 1K2FA 4FK5A 2C2LA 2E6RA 2XEUA 4A4BA 3M99A 2KGIA 3HTKC 2MNZA 3HCUA 2YHNA 1MBMA 5LKZA 4WZ3B 4R7EA 3ASLA 3L1ZB 2M3HA 4I7DA 1G25A 1JM7A 4YBMA 3PLWA 5B78A 2KFTA 1E4UA 4YBSA 5G05B 1WEMA 2D8SA 4QF2A 2JRJA 2C2VS 2FD4A 1VFYA 4S3OC 5JG6A 3LQIA 3C6WA 2K16A 2NAAA 1VYXA 2YUCA 3M7KA 4IC2A 2CRWA 2EODA 2KYUA 1T1HA 2L43A 3O36A 2MA6A 3KV6A 2IDAA 5B76A 2MUMA 2KIZA 4LK9A 2KREA 1VD4A 3SOWA 3LQHA 2KU3A 2F42A 3GV4A 5FB1A 2D8UA 1DCQA 4YAXA 4F52B 1CHCA 2JUNA 3HCTA 4LJNA 1N87A 5G0FA 2QIZA 2ECVA 3T9KA 5C11A 2KWKA 2CSVA 3T7LA 2ZETC 2YQLA 2M1RA 2HYED 2YREA 3C5KA 5DKAA 4PTBA 3E2DA 2CSZA 2Y1NA 4WA6A 3FM8C 2DSMA 3PUQA 2CT2A 2YURA 2KR4A 2VP7A 2LN0A 4WZ0A 2QJ0A 3ZYQA 3N9NA 2XOYA 2ECTA 4AYCB 4I7CA 4GB0A 2YYRA 2LGGA 2JMJA 2OXQC 2UZGA 2YSMA 3DQVR 2VJEB 4UP5A 1WEEA 4Z0OA 1IYMA 5EYAF 2JMDA 4A49A 4AVXA 5FEYA 2FSAA 4R2YA 2XP0A 5KH3A 1XWHA 3FJUB 3Q1DA 4ZUXU 2FUUA 2B0OE 3DDTA 2PUYA 3FL2A 4PPEA 2VPBA 4GNGA 2MD8C 1X4IA 2KGGA 3ZPV1 2VNFA 2P57A 2LV9A 3U5PA 2JMIA 2AN6A 5B8DA 4MSXA 4N4FA 2EA6A 1BORA 3O34A 2XOZA 4P5OB 4Z0RA 1WENA 2MIQA 4UI9B 4OGEA 5H1VA 5LKXA 3FANA 2EGPA 3MDBC 4AYCA 2E6SA 2VJFA 5AITA 3FEHA 5H1TA 4XI1A 2LAUA 5AIUA 3LDYA 3L11A 2LXHC 3U5OA 2Y1MA 4LKAA 4R8PK 3N9PA 2KWOA 4O64A 2LGKA 3ZPVE 2CSYA 3N9OA 2ECNA 2MA5A 3QZVA 4Q6FA 1Z2QA 3MHHA 4FIPA 5C13A 4GNEA 2YVRA 5LKTA 2G45A 5FB0A 5D1LB 3V43A 4I7BA 4YATA 5FERA 3U5NA 2LXPC 5B75A 1HYIA 4FJCA 3SUBA 1RMDA 4GNFA 4LADB 4V3KC 4CCGX 3KQIA 3O47A 4O62A 1WEOA 1FBVA 1FP0A 1DVPA 3EB5A 2VPDA 2BAYA 2LDRA 5SVYA 2M6MA 4YADA 2E61A 3O35A 5TABA 1LDJB 5H1UA 3KNVA 4F1PA 5SVXA 5B77A 2F6JA 5KH7A 2IQJA 2QICA 3KV5A 3MHSA 1WEQA 2ECGA 2YU4A 2KE1A 4ZQLA 3L1XA 4B7YC 4L58A 4V3LC 1HYJA 1WEVA 3SOUA 3M63A 5TRBA 1MM2A 4NN2A 5LCWB 4C9ZA 2G43A 1Z6UA 4AUQB 4CA1A 2MNYA 3EB6A 2LRIC 2MT5A 1JM7B 4BBQA 4QF3A 1LDKC 2FUIA 3O33A 2DJAA 2RI7A 2L5UA 3O70A 5LKUA 2KWJA 2CKLB 4B86C 4QQ4A 3DWDA 1WESA 4YBTA 2HDPA 3ZTGA 2EXUA 2L75A 5B79A 5K3QA 4UP0A 1WEUA 5TDWA 3SOXA 4YABA 4MVTA 3HCSA 2M85A 5I3LA 5TDRA 3T6RA 5H9MA 1WEPA 2G6QA 2YSJA 1Z60A 2OWAA 1WE9A 3LVQE 2ECWA 4OGCA 2L80A 3RPGC 1X4UA 2VJFB 5SVIA 2ECIA 5DINA 4S3OB 2L7PA 3ZVYA 1U6GB 2JM3A 2K17A 3N9MA 3O7AA 3DPLR 3PURA 3ZVZB 2YHOA 3U5MA 2KWNA 3LVRE 2MD7B 3LJUX 2H0DB 3ZNIA 1X4JA 2XOCA 3SHBA 3LQJA 2L0BA 2CONA 1MM3A 2EGMA 2MKEA 3JUEA 2PNXA 4H9DA 4W4UA 1WILA 3NG2A 2VPGA 1V87A 1JOCA 2KKXA 2YT5A 3I2DA 4FO9A 5J3XA 4A4CA 4ZDTA 1WFKA 4BHWA 2K1JA 2LGLA 3VK6A 4A0CD 5G04B 2F6NA 3H7HA 4TKPB 2RR4A 3RPGB 2YW8A 4N3WA 3N9QA 1WGMA 2M13A 2KKYA 2DX8A 2VJEA 4L7XA 2LGVA 3KDEC 3N9LA 2I50A 3IHPA 3M62A 2FFWA 3PHDA 5D1KB 2YQMA 1WEWA 5D1MB 3GL6A 1F62A 2H0DA 4X3GA 2CRRA 2XB1A 3LRQA 2LQ6A 2VPEA 4YC9A
chains in the Genus database with same CATH topology
3O37A 1WIMA 2RSDA 4GNDA 4WZ2A 4AP4A 4LLBA 1ZBDB 5TBNA 2CKLA 3RTRB 4IC3A 5KH9A 2Y43A 2ECJA 2K4DA 1K2FA 4FK5A 2C2LA 2E6RA 2XEUA 4A4BA 3M99A 2KGIA 3HTKC 2MNZA 3HCUA 2YHNA 5LKZA 4WZ3B 4R7EA 3ASLA 3L1ZB 2M3HA 4I7DA 1G25A 1JM7A 4YBMA 5B78A 2KFTA 1E4UA 4YBSA 5G05B 1WEMA 2D8SA 4QF2A 2JRJA 2C2VS 1VFYA 4S3OC 5JG6A 3LQIA 3C6WA 2K16A 2NAAA 1VYXA 2YUCA 4IC2A 2EODA 2KYUA 1T1HA 2L43A 3O36A 2MA6A 3KV6A 2IDAA 5B76A 2MUMA 2KIZA 4LK9A 2KREA 1VD4A 3SOWA 3LQHA 2KU3A 2F42A 3GV4A 5FB1A 4YAXA 4F52B 1CHCA 3HCTA 4LJNA 1N87A 5G0FA 2QIZA 2ECVA 5C11A 2KWKA 3T7LA 2ZETC 2YQLA 2M1RA 2HYED 2YREA 3C5KA 5DKAA 4PTBA 2CSZA 2Y1NA 4WA6A 3PUQA 2CT2A 2YURA 2KR4A 2VP7A 2LN0A 4WZ0A 2QJ0A 3ZYQA 3N9NA 2ECTA 4AYCB 4I7CA 4GB0A 2YYRA 2LGGA 2JMJA 2OXQC 2UZGA 2YSMA 3DQVR 2VJEB 4UP5A 1WEEA 1IYMA 5EYAF 2JMDA 4A49A 4AVXA 5FEYA 2FSAA 4R2YA 5KH3A 1XWHA 4ZUXU 2FUUA 2PUYA 3FL2A 4PPEA 2VPBA 4GNGA 2MD8C 1X4IA 2KGGA 3ZPV1 2VNFA 2LV9A 3U5PA 2JMIA 2AN6A 5B8DA 4MSXA 4N4FA 2EA6A 1BORA 3O34A 4P5OB 1WENA 2MIQA 4UI9B 5H1VA 5LKXA 2EGPA 4AYCA 2E6SA 2VJFA 5AITA 5H1TA 4XI1A 5AIUA 3L11A 2LXHC 3U5OA 2Y1MA 4LKAA 4R8PK 3N9PA 2KWOA 4O64A 2LGKA 3ZPVE 2CSYA 3N9OA 2ECNA 2MA5A 3QZVA 4Q6FA 1Z2QA 3MHHA 4FIPA 5C13A 4GNEA 5LKTA 2G45A 5FB0A 5D1LB 3V43A 4I7BA 4YATA 5FERA 3U5NA 2LXPC 5B75A 1HYIA 4FJCA 1RMDA 4GNFA 4LADB 4V3KC 4CCGX 3KQIA 1WEOA 1FBVA 1FP0A 1DVPA 3EB5A 2VPDA 2BAYA 2LDRA 2M6MA 4YADA 3O35A 5TABA 1LDJB 5H1UA 3KNVA 5B77A 2F6JA 5KH7A 2QICA 3KV5A 3MHSA 1WEQA 2ECGA 2YU4A 2KE1A 4ZQLA 3L1XA 4B7YC 4L58A 4V3LC 1HYJA 1WEVA 3SOUA 3M63A 5TRBA 1MM2A 4NN2A 5LCWB 4C9ZA 2G43A 1Z6UA 4AUQB 4CA1A 2MNYA 3EB6A 2LRIC 2MT5A 1JM7B 4BBQA 4QF3A 1LDKC 2FUIA 3O33A 2RI7A 2L5UA 3O70A 5LKUA 2KWJA 2CKLB 4B86C 1WESA 4YBTA 2HDPA 3ZTGA 2L75A 5B79A 4UP0A 1WEUA 5TDWA 3SOXA 4YABA 4MVTA 3HCSA 2M85A 5I3LA 5TDRA 3T6RA 5H9MA 1WEPA 2G6QA 2YSJA 1Z60A 1WE9A 2ECWA 2L80A 3RPGC 1X4UA 2VJFB 2ECIA 5DINA 4S3OB 3ZVYA 1U6GB 2K17A 3N9MA 3O7AA 3DPLR 3PURA 3ZVZB 2YHOA 3U5MA 2KWNA 2MD7B 2H0DB 3ZNIA 1X4JA 3SHBA 3LQJA 2L0BA 1MM3A 2PNXA 4W4UA 1WILA 3NG2A 2VPGA 1V87A 1JOCA 2YT5A 3I2DA 5J3XA 4FO9A 4A4CA 4ZDTA 1WFKA 4BHWA 2K1JA 2LGLA 3VK6A 4A0CD 5G04B 2F6NA 4TKPB 3RPGB 2YW8A 4N3WA 3N9QA 1WGMA 2DX8A 2VJEA 4L7XA 2LGVA 3N9LA 2I50A 3IHPA 3M62A 3PHDA 5D1KB 2YQMA 1WEWA 5D1MB 3GL6A 1F62A 2H0DA 4X3GA 2XB1A 3LRQA 2LQ6A 2VPEA 4YC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O37 A;  1WIM A;  2RSD A;  4GND A;  4WZ2 A;  4AP4 A;  4LLB A;  1ZBD B;  5TBN A;  2CKL A;  3RTR B;  4IC3 A;  5KH9 A;  2Y43 A;  2ECJ A;  2K4D A;  1K2F A;  4FK5 A;  2C2L A;  2E6R A;  2XEU A;  4A4B A;  3M99 A;  2KGI A;  3HTK C;  2MNZ A;  3HCU A;  2YHN A;  5LKZ A;  4WZ3 B;  4R7E A;  3ASL A;  3L1Z B;  2M3H A;  4I7D A;  1G25 A;  1JM7 A;  4YBM A;  5B78 A;  2KFT A;  1E4U A;  4YBS A;  5G05 B;  1WEM A;  2D8S A;  4QF2 A;  2JRJ A;  2C2V S;  1VFY A;  4S3O C;  5JG6 A;  3LQI A;  3C6W A;  2K16 A;  2NAA A;  1VYX A;  2YUC A;  4IC2 A;  2EOD A;  2KYU A;  1T1H A;  2L43 A;  3O36 A;  2MA6 A;  3KV6 A;  2IDA A;  5B76 A;  2MUM A;  2KIZ A;  4LK9 A;  2KRE A;  1VD4 A;  3SOW A;  3LQH A;  2KU3 A;  2F42 A;  3GV4 A;  5FB1 A;  4YAX A;  4F52 B;  1CHC A;  3HCT A;  4LJN A;  1N87 A;  5G0F A;  2QIZ A;  2ECV A;  5C11 A;  2KWK A;  3T7L A;  2ZET C;  2YQL A;  2M1R A;  2HYE D;  2YRE A;  3C5K A;  5DKA A;  4PTB A;  2CSZ A;  2Y1N A;  4WA6 A;  3PUQ A;  2CT2 A;  2YUR A;  2KR4 A;  2VP7 A;  2LN0 A;  4WZ0 A;  2QJ0 A;  3ZYQ A;  3N9N A;  2ECT A;  4AYC B;  4I7C A;  4GB0 A;  2YYR A;  2LGG A;  2JMJ A;  2OXQ C;  2UZG A;  2YSM A;  3DQV R;  2VJE B;  4UP5 A;  1WEE A;  1IYM A;  5EYA F;  2JMD A;  4A49 A;  4AVX A;  5FEY A;  2FSA A;  4R2Y A;  5KH3 A;  1XWH A;  4ZUX U;  2FUU A;  2PUY A;  3FL2 A;  4PPE A;  2VPB A;  4GNG A;  2MD8 C;  1X4I A;  2KGG A;  3ZPV 1;  2VNF A;  2LV9 A;  3U5P A;  2JMI A;  2AN6 A;  5B8D A;  4MSX A;  4N4F A;  2EA6 A;  1BOR A;  3O34 A;  4P5O B;  1WEN A;  2MIQ A;  4UI9 B;  5H1V A;  5LKX A;  2EGP A;  4AYC A;  2E6S A;  2VJF A;  5AIT A;  5H1T A;  4XI1 A;  5AIU A;  3L11 A;  2LXH C;  3U5O A;  2Y1M A;  4LKA A;  4R8P K;  3N9P A;  2KWO A;  4O64 A;  2LGK A;  3ZPV E;  2CSY A;  3N9O A;  2ECN A;  2MA5 A;  3QZV A;  4Q6F A;  1Z2Q A;  3MHH A;  4FIP A;  5C13 A;  4GNE A;  5LKT A;  2G45 A;  5FB0 A;  5D1L B;  3V43 A;  4I7B A;  4YAT A;  5FER A;  3U5N A;  2LXP C;  5B75 A;  1HYI A;  4FJC A;  1RMD A;  4GNF A;  4LAD B;  4V3K C;  4CCG X;  3KQI A;  1WEO A;  1FBV A;  1FP0 A;  1DVP A;  3EB5 A;  2VPD A;  2BAY A;  2LDR A;  2M6M A;  4YAD A;  3O35 A;  5TAB A;  1LDJ B;  5H1U A;  3KNV A;  5B77 A;  2F6J A;  5KH7 A;  2QIC A;  3KV5 A;  3MHS A;  1WEQ A;  2ECG A;  2YU4 A;  2KE1 A;  4ZQL A;  3L1X A;  4B7Y C;  4L58 A;  4V3L C;  1HYJ A;  1WEV A;  3SOU A;  3M63 A;  5TRB A;  1MM2 A;  4NN2 A;  5LCW B;  4C9Z A;  2G43 A;  1Z6U A;  4AUQ B;  4CA1 A;  2MNY A;  3EB6 A;  2LRI C;  2MT5 A;  1JM7 B;  4BBQ A;  4QF3 A;  1LDK C;  2FUI A;  3O33 A;  2RI7 A;  2L5U A;  3O70 A;  5LKU A;  2KWJ A;  2CKL B;  4B86 C;  1WES A;  4YBT A;  2HDP A;  3ZTG A;  2L75 A;  5B79 A;  4UP0 A;  1WEU A;  5TDW A;  3SOX A;  4YAB A;  4MVT A;  3HCS A;  2M85 A;  5I3L A;  5TDR A;  3T6R A;  5H9M A;  1WEP A;  2G6Q A;  2YSJ A;  1Z60 A;  1WE9 A;  2ECW A;  2L80 A;  3RPG C;  1X4U A;  2VJF B;  2ECI A;  5DIN A;  4S3O B;  3ZVY A;  1U6G B;  2K17 A;  3N9M A;  3O7A A;  3DPL R;  3PUR A;  3ZVZ B;  2YHO A;  3U5M A;  2KWN A;  2MD7 B;  2H0D B;  3ZNI A;  1X4J A;  3SHB A;  3LQJ A;  2L0B A;  1MM3 A;  2PNX A;  4W4U A;  1WIL A;  3NG2 A;  2VPG A;  1V87 A;  1JOC A;  2YT5 A;  3I2D A;  5J3X A;  4FO9 A;  4A4C A;  4ZDT A;  1WFK A;  4BHW A;  2K1J A;  2LGL A;  3VK6 A;  4A0C D;  5G04 B;  2F6N A;  4TKP B;  3RPG B;  2YW8 A;  4N3W A;  3N9Q A;  1WGM A;  2DX8 A;  2VJE A;  4L7X A;  2LGV A;  3N9L A;  2I50 A;  3IHP A;  3M62 A;  3PHD A;  5D1K B;  2YQM A;  1WEW A;  5D1M B;  3GL6 A;  1F62 A;  2H0D A;  4X3G A;  2XB1 A;  3LRQ A;  2LQ6 A;  2VPE A;  4YC9 A; 
#chains in the Genus database with same CATH topology
 3O37 A;  1WIM A;  2RSD A;  4GND A;  5SVI B;  4WZ2 A;  4AP4 A;  4LLB A;  1ZBD B;  5TBN A;  2CKL A;  3RTR B;  4IC3 A;  5KH9 A;  2Y43 A;  3FAO A;  2ECJ A;  2K4D A;  1K2F A;  4FK5 A;  2C2L A;  2E6R A;  2XEU A;  4A4B A;  3M99 A;  2KGI A;  3HTK C;  2MNZ A;  3HCU A;  2YHN A;  1MBM A;  5LKZ A;  4WZ3 B;  4R7E A;  3ASL A;  3L1Z B;  2M3H A;  4I7D A;  1G25 A;  1JM7 A;  4YBM A;  3PLW A;  5B78 A;  2KFT A;  1E4U A;  4YBS A;  5G05 B;  1WEM A;  2D8S A;  4QF2 A;  2JRJ A;  2C2V S;  2FD4 A;  1VFY A;  4S3O C;  5JG6 A;  3LQI A;  3C6W A;  2K16 A;  2NAA A;  1VYX A;  2YUC A;  3M7K A;  4IC2 A;  2CRW A;  2EOD A;  2KYU A;  1T1H A;  2L43 A;  3O36 A;  2MA6 A;  3KV6 A;  2IDA A;  5B76 A;  2MUM A;  2KIZ A;  4LK9 A;  2KRE A;  1VD4 A;  3SOW A;  3LQH A;  2KU3 A;  2F42 A;  3GV4 A;  5FB1 A;  2D8U A;  1DCQ A;  4YAX A;  4F52 B;  1CHC A;  2JUN A;  3HCT A;  4LJN A;  1N87 A;  5G0F A;  2QIZ A;  2ECV A;  3T9K A;  5C11 A;  2KWK A;  2CSV A;  3T7L A;  2ZET C;  2YQL A;  2M1R A;  2HYE D;  2YRE A;  3C5K A;  5DKA A;  4PTB A;  3E2D A;  2CSZ A;  2Y1N A;  4WA6 A;  3FM8 C;  2DSM A;  3PUQ A;  2CT2 A;  2YUR A;  2KR4 A;  2VP7 A;  2LN0 A;  4WZ0 A;  2QJ0 A;  3ZYQ A;  3N9N A;  2XOY A;  2ECT A;  4AYC B;  4I7C A;  4GB0 A;  2YYR A;  2LGG A;  2JMJ A;  2OXQ C;  2UZG A;  2YSM A;  3DQV R;  2VJE B;  4UP5 A;  1WEE A;  4Z0O A;  1IYM A;  5EYA F;  2JMD A;  4A49 A;  4AVX A;  5FEY A;  2FSA A;  4R2Y A;  2XP0 A;  5KH3 A;  1XWH A;  3FJU B;  3Q1D A;  4ZUX U;  2FUU A;  2B0O E;  3DDT A;  2PUY A;  3FL2 A;  4PPE A;  2VPB A;  4GNG A;  2MD8 C;  1X4I A;  2KGG A;  3ZPV 1;  2VNF A;  2P57 A;  2LV9 A;  3U5P A;  2JMI A;  2AN6 A;  5B8D A;  4MSX A;  4N4F A;  2EA6 A;  1BOR A;  3O34 A;  2XOZ A;  4P5O B;  4Z0R A;  1WEN A;  2MIQ A;  4UI9 B;  4OGE A;  5H1V A;  5LKX A;  3FAN A;  2EGP A;  3MDB C;  4AYC A;  2E6S A;  2VJF A;  5AIT A;  3FEH A;  5H1T A;  4XI1 A;  2LAU A;  5AIU A;  3LDY A;  3L11 A;  2LXH C;  3U5O A;  2Y1M A;  4LKA A;  4R8P K;  3N9P A;  2KWO A;  4O64 A;  2LGK A;  3ZPV E;  2CSY A;  3N9O A;  2ECN A;  2MA5 A;  3QZV A;  4Q6F A;  1Z2Q A;  3MHH A;  4FIP A;  5C13 A;  4GNE A;  2YVR A;  5LKT A;  2G45 A;  5FB0 A;  5D1L B;  3V43 A;  4I7B A;  4YAT A;  5FER A;  3U5N A;  2LXP C;  5B75 A;  1HYI A;  4FJC A;  3SUB A;  1RMD A;  4GNF A;  4LAD B;  4V3K C;  4CCG X;  3KQI A;  3O47 A;  4O62 A;  1WEO A;  1FBV A;  1FP0 A;  1DVP A;  3EB5 A;  2VPD A;  2BAY A;  2LDR A;  5SVY A;  2M6M A;  4YAD A;  2E61 A;  3O35 A;  5TAB A;  1LDJ B;  5H1U A;  3KNV A;  4F1P A;  5SVX A;  5B77 A;  2F6J A;  5KH7 A;  2IQJ A;  2QIC A;  3KV5 A;  3MHS A;  1WEQ A;  2ECG A;  2YU4 A;  2KE1 A;  4ZQL A;  3L1X A;  4B7Y C;  4L58 A;  4V3L C;  1HYJ A;  1WEV A;  3SOU A;  3M63 A;  5TRB A;  1MM2 A;  4NN2 A;  5LCW B;  4C9Z A;  2G43 A;  1Z6U A;  4AUQ B;  4CA1 A;  2MNY A;  3EB6 A;  2LRI C;  2MT5 A;  1JM7 B;  4BBQ A;  4QF3 A;  1LDK C;  2FUI A;  3O33 A;  2DJA A;  2RI7 A;  2L5U A;  3O70 A;  5LKU A;  2KWJ A;  2CKL B;  4B86 C;  4QQ4 A;  3DWD A;  1WES A;  4YBT A;  2HDP A;  3ZTG A;  2EXU A;  2L75 A;  5B79 A;  5K3Q A;  4UP0 A;  1WEU A;  5TDW A;  3SOX A;  4YAB A;  4MVT A;  3HCS A;  2M85 A;  5I3L A;  5TDR A;  3T6R A;  5H9M A;  1WEP A;  2G6Q A;  2YSJ A;  1Z60 A;  2OWA A;  1WE9 A;  3LVQ E;  2ECW A;  4OGC A;  2L80 A;  3RPG C;  1X4U A;  2VJF B;  5SVI A;  2ECI A;  5DIN A;  4S3O B;  2L7P A;  3ZVY A;  1U6G B;  2JM3 A;  2K17 A;  3N9M A;  3O7A A;  3DPL R;  3PUR A;  3ZVZ B;  2YHO A;  3U5M A;  2KWN A;  3LVR E;  2MD7 B;  3LJU X;  2H0D B;  3ZNI A;  1X4J A;  2XOC A;  3SHB A;  3LQJ A;  2L0B A;  2CON A;  1MM3 A;  2EGM A;  2MKE A;  3JUE A;  2PNX A;  4H9D A;  4W4U A;  1WIL A;  3NG2 A;  2VPG A;  1V87 A;  1JOC A;  2KKX A;  2YT5 A;  3I2D A;  4FO9 A;  5J3X A;  4A4C A;  4ZDT A;  1WFK A;  4BHW A;  2K1J A;  2LGL A;  3VK6 A;  4A0C D;  5G04 B;  2F6N A;  3H7H A;  4TKP B;  2RR4 A;  3RPG B;  2YW8 A;  4N3W A;  3N9Q A;  1WGM A;  2M13 A;  2KKY A;  2DX8 A;  2VJE A;  4L7X A;  2LGV A;  3KDE C;  3N9L A;  2I50 A;  3IHP A;  3M62 A;  2FFW A;  3PHD A;  5D1K B;  2YQM A;  1WEW A;  5D1M B;  3GL6 A;  1F62 A;  2H0D A;  4X3G A;  2CRR A;  2XB1 A;  3LRQ A;  2LQ6 A;  2VPE A;  4YC9 A; 
#chains in the Genus database with same CATH homology
 3O37 A;  1WIM A;  2RSD A;  4GND A;  4WZ2 A;  4AP4 A;  4LLB A;  1ZBD B;  5TBN A;  2CKL A;  3RTR B;  4IC3 A;  5KH9 A;  2Y43 A;  2ECJ A;  2K4D A;  1K2F A;  4FK5 A;  2C2L A;  2E6R A;  2XEU A;  4A4B A;  3M99 A;  2KGI A;  3HTK C;  2MNZ A;  3HCU A;  2YHN A;  5LKZ A;  4WZ3 B;  4R7E A;  3ASL A;  3L1Z B;  2M3H A;  4I7D A;  1G25 A;  1JM7 A;  4YBM A;  5B78 A;  2KFT A;  1E4U A;  4YBS A;  5G05 B;  1WEM A;  2D8S A;  4QF2 A;  2JRJ A;  2C2V S;  1VFY A;  4S3O C;  5JG6 A;  3LQI A;  3C6W A;  2K16 A;  2NAA A;  1VYX A;  2YUC A;  4IC2 A;  2EOD A;  2KYU A;  1T1H A;  2L43 A;  3O36 A;  2MA6 A;  3KV6 A;  2IDA A;  5B76 A;  2MUM A;  2KIZ A;  4LK9 A;  2KRE A;  1VD4 A;  3SOW A;  3LQH A;  2KU3 A;  2F42 A;  3GV4 A;  5FB1 A;  4YAX A;  4F52 B;  1CHC A;  3HCT A;  4LJN A;  1N87 A;  5G0F A;  2QIZ A;  2ECV A;  5C11 A;  2KWK A;  3T7L A;  2ZET C;  2YQL A;  2M1R A;  2HYE D;  2YRE A;  3C5K A;  5DKA A;  4PTB A;  2CSZ A;  2Y1N A;  4WA6 A;  3PUQ A;  2CT2 A;  2YUR A;  2KR4 A;  2VP7 A;  2LN0 A;  4WZ0 A;  2QJ0 A;  3ZYQ A;  3N9N A;  2ECT A;  4AYC B;  4I7C A;  4GB0 A;  2YYR A;  2LGG A;  2JMJ A;  2OXQ C;  2UZG A;  2YSM A;  3DQV R;  2VJE B;  4UP5 A;  1WEE A;  1IYM A;  5EYA F;  2JMD A;  4A49 A;  4AVX A;  5FEY A;  2FSA A;  4R2Y A;  5KH3 A;  1XWH A;  4ZUX U;  2FUU A;  2PUY A;  3FL2 A;  4PPE A;  2VPB A;  4GNG A;  2MD8 C;  1X4I A;  2KGG A;  3ZPV 1;  2VNF A;  2LV9 A;  3U5P A;  2JMI A;  2AN6 A;  5B8D A;  4MSX A;  4N4F A;  2EA6 A;  1BOR A;  3O34 A;  4P5O B;  1WEN A;  2MIQ A;  4UI9 B;  5H1V A;  5LKX A;  2EGP A;  4AYC A;  2E6S A;  2VJF A;  5AIT A;  5H1T A;  4XI1 A;  5AIU A;  3L11 A;  2LXH C;  3U5O A;  2Y1M A;  4LKA A;  4R8P K;  3N9P A;  2KWO A;  4O64 A;  2LGK A;  3ZPV E;  2CSY A;  3N9O A;  2ECN A;  2MA5 A;  3QZV A;  4Q6F A;  1Z2Q A;  3MHH A;  4FIP A;  5C13 A;  4GNE A;  5LKT A;  2G45 A;  5FB0 A;  5D1L B;  3V43 A;  4I7B A;  4YAT A;  5FER A;  3U5N A;  2LXP C;  5B75 A;  1HYI A;  4FJC A;  1RMD A;  4GNF A;  4LAD B;  4V3K C;  4CCG X;  3KQI A;  1WEO A;  1FBV A;  1FP0 A;  1DVP A;  3EB5 A;  2VPD A;  2BAY A;  2LDR A;  2M6M A;  4YAD A;  3O35 A;  5TAB A;  1LDJ B;  5H1U A;  3KNV A;  5B77 A;  2F6J A;  5KH7 A;  2QIC A;  3KV5 A;  3MHS A;  1WEQ A;  2ECG A;  2YU4 A;  2KE1 A;  4ZQL A;  3L1X A;  4B7Y C;  4L58 A;  4V3L C;  1HYJ A;  1WEV A;  3SOU A;  3M63 A;  5TRB A;  1MM2 A;  4NN2 A;  5LCW B;  4C9Z A;  2G43 A;  1Z6U A;  4AUQ B;  4CA1 A;  2MNY A;  3EB6 A;  2LRI C;  2MT5 A;  1JM7 B;  4BBQ A;  4QF3 A;  1LDK C;  2FUI A;  3O33 A;  2RI7 A;  2L5U A;  3O70 A;  5LKU A;  2KWJ A;  2CKL B;  4B86 C;  1WES A;  4YBT A;  2HDP A;  3ZTG A;  2L75 A;  5B79 A;  4UP0 A;  1WEU A;  5TDW A;  3SOX A;  4YAB A;  4MVT A;  3HCS A;  2M85 A;  5I3L A;  5TDR A;  3T6R A;  5H9M A;  1WEP A;  2G6Q A;  2YSJ A;  1Z60 A;  1WE9 A;  2ECW A;  2L80 A;  3RPG C;  1X4U A;  2VJF B;  2ECI A;  5DIN A;  4S3O B;  3ZVY A;  1U6G B;  2K17 A;  3N9M A;  3O7A A;  3DPL R;  3PUR A;  3ZVZ B;  2YHO A;  3U5M A;  2KWN A;  2MD7 B;  2H0D B;  3ZNI A;  1X4J A;  3SHB A;  3LQJ A;  2L0B A;  1MM3 A;  2PNX A;  4W4U A;  1WIL A;  3NG2 A;  2VPG A;  1V87 A;  1JOC A;  2YT5 A;  3I2D A;  5J3X A;  4FO9 A;  4A4C A;  4ZDT A;  1WFK A;  4BHW A;  2K1J A;  2LGL A;  3VK6 A;  4A0C D;  5G04 B;  2F6N A;  4TKP B;  3RPG B;  2YW8 A;  4N3W A;  3N9Q A;  1WGM A;  2DX8 A;  2VJE A;  4L7X A;  2LGV A;  3N9L A;  2I50 A;  3IHP A;  3M62 A;  3PHD A;  5D1K B;  2YQM A;  1WEW A;  5D1M B;  3GL6 A;  1F62 A;  2H0D A;  4X3G A;  2XB1 A;  3LRQ A;  2LQ6 A;  2VPE A;  4YC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...