1LDKC

Structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
88
structure length
88
Chain Sequence
KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CULLIN HOMOLOG
publication title Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 4
structure length 88
sequence length 88
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1ldkC00
2CKLB 2H0DB 3L1XA 2JMDA 2K1JA 2EA6A 4LADB 4YABA 4UP0A 3N9NA 4IC2A 2RI7A 2ECJA 2QIZA 2XEUA 2MD7B 3DPLR 2K17A 1VFYA 2VNFA 1FBVA 4AP4A 4MSXA 4NN2A 4IC3A 4V3LC 2YURA 4V3KC 4QF2A 1Z60A 2BAYA 4LKAA 2LGGA 2YW8A 4B86C 5H1TA 2LXPC 1JM7A 5TABA 2YU4A 3SOWA 3MHSA 5TDRA 3HCSA 2C2VS 3HCUA 5D1LB 1Z6UA 3ASLA 5G04B 2LRIC 2PNXA 1WGMA 2LGLA 4YBSA 5H1VA 5LCWB 3LQHA 3QZVA 2MA6A 3MHHA 1X4UA 3C6WA 3EB6A 1ZBDB 1MM3A 5B77A 2VPEA 4I7DA 4N4FA 2MD8C 4UP5A 2YSJA 1K2FA 2Y43A 5G0FA 3T6RA 2K16A 1WEMA 3ZVYA 5TBNA 3U5PA 4GNDA 2CKLA 4YADA 2H0DA 4GNFA 1U6GB 4YAXA 1WESA 3O7AA 3RPGB 4XI1A 2CSZA 5LKTA 3RPGC 2M6MA 2ECTA 1T1HA 5LKUA 5AITA 3U5NA 2MUMA 2HYED 2L5UA 3HTKC 5TDWA 2CSYA 4GB0A 2ECNA 2JRJA 2YHOA 2LN0A 4AYCB 2KWOA 4N3WA 1WEUA 1XWHA 2M85A 4QF3A 1Z2QA 3M62A 5AIUA 1HYIA 3EB5A 2DX8A 5LKZA 3ZPVE 1JOCA 3N9LA 2Y1MA 3GV4A 3KQIA 3NG2A 2AN6A 2YUCA 3ZTGA 3L1ZB 5B79A 1WEPA 1VD4A 4S3OB 3N9OA 3VK6A 5KH7A 2XB1A 4S3OC 4A4CA 4TKPB 5G05B 5H1UA 1WEOA 2OXQC 3O33A 1G25A 2KGGA 4LJNA 4WZ2A 2FSAA 2YT5A 4PPEA 4AVXA 2VPDA 2M3HA 1VYXA 3I2DA 5KH9A 4FO9A 4R2YA 2YQMA 2L0BA 4YBMA 3DQVR 2KREA 4WZ0A 3ZVZB 2ECVA 1MM2A 2E6RA 2KWKA 2HDPA 3IHPA 5C13A 5FB0A 4LK9A 1BORA 3LRQA 3PURA 4GNEA 2PUYA 4FJCA 2UZGA 4A4BA 3RTRB 3O34A 3T7LA 5J3XA 5H9MA 4B7YC 3FL2A 2KWNA 1DVPA 5B78A 4ZQLA 4FK5A 2L80A 3SOXA 3SHBA 3LQIA 2VJEB 2F42A 2KGIA 1N87A 4AYCA 5D1MB 2G45A 4CA1A 4L58A 3LQJA 2MA5A 1WENA 5D1KB 4WA6A 2MT5A 4W4UA 3O35A 2L43A 2YYRA 4ZDTA 2C2LA 2FUIA 3KV6A 3N9MA 5FERA 4I7BA 4LLBA 1WIMA 2M1RA 2MNYA 3C5KA 2F6JA 5B75A 5TRBA 1WEQA 1WEVA 2L75A 5EYAF 1WE9A 1WILA 2RSDA 3U5MA 3L11A 2G43A 2VJFB 2YREA 3O70A 4PTBA 1RMDA 4I7CA 3HCTA 2LXHC 2YQLA 1WEEA 2ECIA 4ZUXU 4O64A 1IYMA 2MIQA 1LDKC 4C9ZA 2VP7A 5FEYA 3PHDA 1CHCA 4Q6FA 2KIZA 2G6QA 5LKXA 2YHNA 1X4JA 2NAAA 2ECWA 1V87A 2I50A 3V43A 2LGKA 5I3LA 1X4IA 2KFTA 4AUQB 4CCGX 1WEWA 1LDJB 2E6SA 2VJEA 4FIPA 3N9PA 5DINA 4F52B 2LDRA 3O37A 4MVTA 4P5OB 4R8PK 3GL6A 2ECGA 2JMJA 2VPGA 3M63A 2F6NA 3ZYQA 4R7EA 2CT2A 2Y1NA 5C11A 2EODA 2KU3A 1JM7B 2LGVA 2K4DA 5DKAA 3PUQA 4BHWA 2FUUA 2YSMA 4YC9A 2EGPA 3KNVA 5KH3A 4YBTA 5JG6A 2QICA 1E4UA 2QJ0A 3ZPV1 3M99A 2KWJA 2ZETC 2VJFA 4X3GA 4A0CD 2KE1A 2MNZA 3U5OA 2LQ6A 2D8SA 2LV9A 5B8DA 1WFKA 2KR4A 3KV5A 4L7XA 3ZNIA 4BBQA 5B76A 4WZ3B 3O36A 2IDAA 4A49A 2VPBA 2KYUA 4GNGA 1HYJA 3N9QA 2JMIA 1F62A 1FP0A 4UI9B 3SOUA 4YATA 5FB1A
chains in the Genus database with same CATH superfamily
2CKLB 2H0DB 3L1XA 2XOYA 2JMDA 2K1JA 2EA6A 4LADB 4YABA 4UP0A 3N9NA 4IC2A 2KKXA 2RI7A 3FM8C 2ECJA 2QIZA 2XEUA 2MD7B 3DPLR 2K17A 3MDBC 1VFYA 2VNFA 1FBVA 4AP4A 4MSXA 4NN2A 4IC3A 4V3LC 2YURA 4V3KC 4QF2A 1Z60A 2BAYA 4LKAA 2LGGA 2YW8A 4B86C 5H1TA 2LXPC 2XOCA 1JM7A 2EXUA 5TABA 2YU4A 3SOWA 2RR4A 2YVRA 3MHSA 5TDRA 3HCSA 2C2VS 3HCUA 5D1LB 3DDTA 1Z6UA 2CRRA 3T9KA 3ASLA 5G04B 2LRIC 4O62A 2PNXA 1WGMA 3H7HA 2LGLA 5SVIB 4YBSA 5H1VA 5LCWB 3LQHA 3QZVA 2MA6A 3MHHA 1X4UA 3C6WA 3EB6A 4H9DA 1ZBDB 3Q1DA 1MM3A 3LJUX 5B77A 2VPEA 4I7DA 4N4FA 2MD8C 4UP5A 2YSJA 1K2FA 2Y43A 5G0FA 3T6RA 2K16A 1WEMA 3ZVYA 5TBNA 3U5PA 2EGMA 4GNDA 3E2DA 2CKLA 2H0DA 4GNFA 2KKYA 4YADA 1U6GB 4YAXA 1WESA 3O7AA 3RPGB 4XI1A 3M7KA 2CSZA 5LKTA 2OWAA 3RPGC 4OGCA 2M6MA 2ECTA 1T1HA 5LKUA 5AITA 3U5NA 2MUMA 2HYED 2L5UA 3HTKC 5TDWA 2CSYA 4GB0A 2ECNA 2JRJA 3LVRE 2FD4A 2YHOA 2LN0A 4AYCB 2KWOA 4N3WA 2CRWA 1WEUA 1XWHA 2M85A 4QF3A 1Z2QA 3M62A 5AIUA 1HYIA 3EB5A 2DX8A 3SUBA 2JM3A 5LKZA 2M13A 3ZPVE 1JOCA 3N9LA 2Y1MA 3GV4A 3KQIA 3NG2A 2AN6A 2YUCA 3ZTGA 3L1ZB 5B79A 1WEPA 1VD4A 3JUEA 3FAOA 4S3OB 3N9OA 3VK6A 5KH7A 2XB1A 4S3OC 4A4CA 4TKPB 5G05B 2P57A 5H1UA 1WEOA 2OXQC 3O33A 1G25A 2KGGA 4LJNA 4WZ2A 2FSAA 2E61A 2YT5A 4PPEA 4AVXA 2JUNA 2D8UA 5SVIA 2VPDA 2M3HA 1VYXA 3I2DA 5KH9A 4FO9A 4R2YA 2YQMA 2L0BA 4YBMA 3DQVR 2KREA 4WZ0A 3ZVZB 2ECVA 1MM2A 2E6RA 2KWKA 2HDPA 3IHPA 5C13A 5FB0A 4LK9A 1BORA 3LRQA 3PURA 3FEHA 4GNEA 2PUYA 4FJCA 2UZGA 4A4BA 3RTRB 3O34A 3T7LA 2DSMA 5J3XA 5H9MA 4B7YC 3FL2A 3DWDA 2KWNA 1DVPA 5B78A 4ZQLA 4FK5A 2L80A 1MBMA 3SOXA 3SHBA 3LQIA 2IQJA 2VJEB 2F42A 2KGIA 1N87A 4AYCA 5D1MB 2G45A 4CA1A 4L58A 3LQJA 2XOZA 2MA5A 2L7PA 1WENA 5D1KB 4WA6A 3KDEC 2MT5A 4W4UA 3O35A 2L43A 2YYRA 4ZDTA 2C2LA 2FUIA 3KV6A 3N9MA 5FERA 4I7BA 4LLBA 1WIMA 2M1RA 2MNYA 4Z0RA 3C5KA 2F6JA 5B75A 5TRBA 1WEQA 1WEVA 2L75A 2XP0A 5EYAF 1WE9A 1WILA 2RSDA 3U5MA 3L11A 2G43A 2VJFB 2YREA 3O70A 4PTBA 4QQ4A 1RMDA 4I7CA 3HCTA 2LXHC 2YQLA 1WEEA 2ECIA 4ZUXU 4O64A 1IYMA 2MIQA 1LDKC 4C9ZA 2VP7A 5FEYA 3PHDA 1CHCA 4Q6FA 2KIZA 4Z0OA 2G6QA 2B0OE 5LKXA 2YHNA 2CONA 1X4JA 2NAAA 2ECWA 1V87A 3LVQE 2I50A 3V43A 2LGKA 5I3LA 5SVYA 1X4IA 2KFTA 4AUQB 3LDYA 2LAUA 5SVXA 4CCGX 1WEWA 1LDJB 2E6SA 2VJEA 4FIPA 3N9PA 5DINA 3FJUB 4F52B 2LDRA 3O47A 3O37A 4MVTA 4P5OB 4OGEA 4R8PK 5K3QA 1DCQA 3GL6A 2ECGA 2JMJA 2VPGA 3M63A 2F6NA 3ZYQA 2FFWA 4R7EA 2CT2A 2Y1NA 5C11A 2EODA 2KU3A 1JM7B 2LGVA 2K4DA 5DKAA 3PUQA 4BHWA 2FUUA 2YSMA 4YC9A 2EGPA 3KNVA 3FANA 5KH3A 4YBTA 5JG6A 2QICA 1E4UA 2QJ0A 3ZPV1 4F1PA 3M99A 2KWJA 2ZETC 2VJFA 4X3GA 4A0CD 2KE1A 2MNZA 3PLWA 3U5OA 2CSVA 2LQ6A 2MKEA 2D8SA 2LV9A 5B8DA 1WFKA 2KR4A 3KV5A 4L7XA 3ZNIA 4BBQA 5B76A 4WZ3B 3O36A 2IDAA 4A49A 2VPBA 2KYUA 4GNGA 1HYJA 3N9QA 2JMIA 2DJAA 1F62A 1FP0A 4UI9B 3SOUA 4YATA 5FB1A
chains in the Genus database with same CATH topology
2CKLB 2H0DB 3L1XA 2JMDA 2K1JA 2EA6A 4LADB 4YABA 4UP0A 3N9NA 4IC2A 2RI7A 2ECJA 2QIZA 2XEUA 2MD7B 3DPLR 2K17A 1VFYA 2VNFA 1FBVA 4AP4A 4MSXA 4NN2A 4IC3A 4V3LC 2YURA 4V3KC 4QF2A 1Z60A 2BAYA 4LKAA 2LGGA 2YW8A 4B86C 5H1TA 2LXPC 1JM7A 5TABA 2YU4A 3SOWA 3MHSA 5TDRA 3HCSA 2C2VS 3HCUA 5D1LB 1Z6UA 3ASLA 5G04B 2LRIC 2PNXA 1WGMA 2LGLA 4YBSA 5H1VA 5LCWB 3LQHA 3QZVA 2MA6A 3MHHA 1X4UA 3C6WA 3EB6A 1ZBDB 1MM3A 5B77A 2VPEA 4I7DA 4N4FA 2MD8C 4UP5A 2YSJA 1K2FA 2Y43A 5G0FA 3T6RA 2K16A 1WEMA 3ZVYA 5TBNA 3U5PA 4GNDA 2CKLA 4YADA 2H0DA 4GNFA 1U6GB 4YAXA 1WESA 3O7AA 3RPGB 4XI1A 2CSZA 5LKTA 3RPGC 2M6MA 2ECTA 1T1HA 5LKUA 5AITA 3U5NA 2MUMA 2HYED 2L5UA 3HTKC 5TDWA 2CSYA 4GB0A 2ECNA 2JRJA 2YHOA 2LN0A 4AYCB 2KWOA 4N3WA 1WEUA 1XWHA 2M85A 4QF3A 1Z2QA 3M62A 5AIUA 1HYIA 3EB5A 2DX8A 5LKZA 3ZPVE 1JOCA 3N9LA 2Y1MA 3GV4A 3KQIA 3NG2A 2AN6A 2YUCA 3ZTGA 3L1ZB 5B79A 1WEPA 1VD4A 4S3OB 3N9OA 3VK6A 5KH7A 2XB1A 4S3OC 4A4CA 4TKPB 5G05B 5H1UA 1WEOA 2OXQC 3O33A 1G25A 2KGGA 4LJNA 4WZ2A 2FSAA 2YT5A 4PPEA 4AVXA 2VPDA 2M3HA 1VYXA 3I2DA 5KH9A 4FO9A 4R2YA 2YQMA 2L0BA 4YBMA 3DQVR 2KREA 4WZ0A 3ZVZB 2ECVA 1MM2A 2E6RA 2KWKA 2HDPA 3IHPA 5C13A 5FB0A 4LK9A 1BORA 3LRQA 3PURA 4GNEA 2PUYA 4FJCA 2UZGA 4A4BA 3RTRB 3O34A 3T7LA 5J3XA 5H9MA 4B7YC 3FL2A 2KWNA 1DVPA 5B78A 4ZQLA 4FK5A 2L80A 3SOXA 3SHBA 3LQIA 2VJEB 2F42A 2KGIA 1N87A 4AYCA 5D1MB 2G45A 4CA1A 4L58A 3LQJA 2MA5A 1WENA 5D1KB 4WA6A 2MT5A 4W4UA 3O35A 2L43A 2YYRA 4ZDTA 2C2LA 2FUIA 3KV6A 3N9MA 5FERA 4I7BA 4LLBA 1WIMA 2M1RA 2MNYA 3C5KA 2F6JA 5B75A 5TRBA 1WEQA 1WEVA 2L75A 5EYAF 1WE9A 1WILA 2RSDA 3U5MA 3L11A 2G43A 2VJFB 2YREA 3O70A 4PTBA 1RMDA 4I7CA 3HCTA 2LXHC 2YQLA 1WEEA 2ECIA 4ZUXU 4O64A 1IYMA 2MIQA 1LDKC 4C9ZA 2VP7A 5FEYA 3PHDA 1CHCA 4Q6FA 2KIZA 2G6QA 5LKXA 2YHNA 1X4JA 2NAAA 2ECWA 1V87A 2I50A 3V43A 2LGKA 5I3LA 1X4IA 2KFTA 4AUQB 4CCGX 1WEWA 1LDJB 2E6SA 2VJEA 4FIPA 3N9PA 5DINA 4F52B 2LDRA 3O37A 4MVTA 4P5OB 4R8PK 3GL6A 2ECGA 2JMJA 2VPGA 3M63A 2F6NA 3ZYQA 4R7EA 2CT2A 2Y1NA 5C11A 2EODA 2KU3A 1JM7B 2LGVA 2K4DA 5DKAA 3PUQA 4BHWA 2FUUA 2YSMA 4YC9A 2EGPA 3KNVA 5KH3A 4YBTA 5JG6A 2QICA 1E4UA 2QJ0A 3ZPV1 3M99A 2KWJA 2ZETC 2VJFA 4X3GA 4A0CD 2KE1A 2MNZA 3U5OA 2LQ6A 2D8SA 2LV9A 5B8DA 1WFKA 2KR4A 3KV5A 4L7XA 3ZNIA 4BBQA 5B76A 4WZ3B 3O36A 2IDAA 4A49A 2VPBA 2KYUA 4GNGA 1HYJA 3N9QA 2JMIA 1F62A 1FP0A 4UI9B 3SOUA 4YATA 5FB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKL B;  2H0D B;  3L1X A;  2JMD A;  2K1J A;  2EA6 A;  4LAD B;  4YAB A;  4UP0 A;  3N9N A;  4IC2 A;  2RI7 A;  2ECJ A;  2QIZ A;  2XEU A;  2MD7 B;  3DPL R;  2K17 A;  1VFY A;  2VNF A;  1FBV A;  4AP4 A;  4MSX A;  4NN2 A;  4IC3 A;  4V3L C;  2YUR A;  4V3K C;  4QF2 A;  1Z60 A;  2BAY A;  4LKA A;  2LGG A;  2YW8 A;  4B86 C;  5H1T A;  2LXP C;  1JM7 A;  5TAB A;  2YU4 A;  3SOW A;  3MHS A;  5TDR A;  3HCS A;  2C2V S;  3HCU A;  5D1L B;  1Z6U A;  3ASL A;  5G04 B;  2LRI C;  2PNX A;  1WGM A;  2LGL A;  4YBS A;  5H1V A;  5LCW B;  3LQH A;  3QZV A;  2MA6 A;  3MHH A;  1X4U A;  3C6W A;  3EB6 A;  1ZBD B;  1MM3 A;  5B77 A;  2VPE A;  4I7D A;  4N4F A;  2MD8 C;  4UP5 A;  2YSJ A;  1K2F A;  2Y43 A;  5G0F A;  3T6R A;  2K16 A;  1WEM A;  3ZVY A;  5TBN A;  3U5P A;  4GND A;  2CKL A;  4YAD A;  2H0D A;  4GNF A;  1U6G B;  4YAX A;  1WES A;  3O7A A;  3RPG B;  4XI1 A;  2CSZ A;  5LKT A;  3RPG C;  2M6M A;  2ECT A;  1T1H A;  5LKU A;  5AIT A;  3U5N A;  2MUM A;  2HYE D;  2L5U A;  3HTK C;  5TDW A;  2CSY A;  4GB0 A;  2ECN A;  2JRJ A;  2YHO A;  2LN0 A;  4AYC B;  2KWO A;  4N3W A;  1WEU A;  1XWH A;  2M85 A;  4QF3 A;  1Z2Q A;  3M62 A;  5AIU A;  1HYI A;  3EB5 A;  2DX8 A;  5LKZ A;  3ZPV E;  1JOC A;  3N9L A;  2Y1M A;  3GV4 A;  3KQI A;  3NG2 A;  2AN6 A;  2YUC A;  3ZTG A;  3L1Z B;  5B79 A;  1WEP A;  1VD4 A;  4S3O B;  3N9O A;  3VK6 A;  5KH7 A;  2XB1 A;  4S3O C;  4A4C A;  4TKP B;  5G05 B;  5H1U A;  1WEO A;  2OXQ C;  3O33 A;  1G25 A;  2KGG A;  4LJN A;  4WZ2 A;  2FSA A;  2YT5 A;  4PPE A;  4AVX A;  2VPD A;  2M3H A;  1VYX A;  3I2D A;  5KH9 A;  4FO9 A;  4R2Y A;  2YQM A;  2L0B A;  4YBM A;  3DQV R;  2KRE A;  4WZ0 A;  3ZVZ B;  2ECV A;  1MM2 A;  2E6R A;  2KWK A;  2HDP A;  3IHP A;  5C13 A;  5FB0 A;  4LK9 A;  1BOR A;  3LRQ A;  3PUR A;  4GNE A;  2PUY A;  4FJC A;  2UZG A;  4A4B A;  3RTR B;  3O34 A;  3T7L A;  5J3X A;  5H9M A;  4B7Y C;  3FL2 A;  2KWN A;  1DVP A;  5B78 A;  4ZQL A;  4FK5 A;  2L80 A;  3SOX A;  3SHB A;  3LQI A;  2VJE B;  2F42 A;  2KGI A;  1N87 A;  4AYC A;  5D1M B;  2G45 A;  4CA1 A;  4L58 A;  3LQJ A;  2MA5 A;  1WEN A;  5D1K B;  4WA6 A;  2MT5 A;  4W4U A;  3O35 A;  2L43 A;  2YYR A;  4ZDT A;  2C2L A;  2FUI A;  3KV6 A;  3N9M A;  5FER A;  4I7B A;  4LLB A;  1WIM A;  2M1R A;  2MNY A;  3C5K A;  2F6J A;  5B75 A;  5TRB A;  1WEQ A;  1WEV A;  2L75 A;  5EYA F;  1WE9 A;  1WIL A;  2RSD A;  3U5M A;  3L11 A;  2G43 A;  2VJF B;  2YRE A;  3O70 A;  4PTB A;  1RMD A;  4I7C A;  3HCT A;  2LXH C;  2YQL A;  1WEE A;  2ECI A;  4ZUX U;  4O64 A;  1IYM A;  2MIQ A;  1LDK C;  4C9Z A;  2VP7 A;  5FEY A;  3PHD A;  1CHC A;  4Q6F A;  2KIZ A;  2G6Q A;  5LKX A;  2YHN A;  1X4J A;  2NAA A;  2ECW A;  1V87 A;  2I50 A;  3V43 A;  2LGK A;  5I3L A;  1X4I A;  2KFT A;  4AUQ B;  4CCG X;  1WEW A;  1LDJ B;  2E6S A;  2VJE A;  4FIP A;  3N9P A;  5DIN A;  4F52 B;  2LDR A;  3O37 A;  4MVT A;  4P5O B;  4R8P K;  3GL6 A;  2ECG A;  2JMJ A;  2VPG A;  3M63 A;  2F6N A;  3ZYQ A;  4R7E A;  2CT2 A;  2Y1N A;  5C11 A;  2EOD A;  2KU3 A;  1JM7 B;  2LGV A;  2K4D A;  5DKA A;  3PUQ A;  4BHW A;  2FUU A;  2YSM A;  4YC9 A;  2EGP A;  3KNV A;  5KH3 A;  4YBT A;  5JG6 A;  2QIC A;  1E4U A;  2QJ0 A;  3ZPV 1;  3M99 A;  2KWJ A;  2ZET C;  2VJF A;  4X3G A;  4A0C D;  2KE1 A;  2MNZ A;  3U5O A;  2LQ6 A;  2D8S A;  2LV9 A;  5B8D A;  1WFK A;  2KR4 A;  3KV5 A;  4L7X A;  3ZNI A;  4BBQ A;  5B76 A;  4WZ3 B;  3O36 A;  2IDA A;  4A49 A;  2VPB A;  2KYU A;  4GNG A;  1HYJ A;  3N9Q A;  2JMI A;  1F62 A;  1FP0 A;  4UI9 B;  3SOU A;  4YAT A;  5FB1 A; 
#chains in the Genus database with same CATH topology
 2CKL B;  2H0D B;  3L1X A;  2XOY A;  2JMD A;  2K1J A;  2EA6 A;  4LAD B;  4YAB A;  4UP0 A;  3N9N A;  4IC2 A;  2KKX A;  2RI7 A;  3FM8 C;  2ECJ A;  2QIZ A;  2XEU A;  2MD7 B;  3DPL R;  2K17 A;  3MDB C;  1VFY A;  2VNF A;  1FBV A;  4AP4 A;  4MSX A;  4NN2 A;  4IC3 A;  4V3L C;  2YUR A;  4V3K C;  4QF2 A;  1Z60 A;  2BAY A;  4LKA A;  2LGG A;  2YW8 A;  4B86 C;  5H1T A;  2LXP C;  2XOC A;  1JM7 A;  2EXU A;  5TAB A;  2YU4 A;  3SOW A;  2RR4 A;  2YVR A;  3MHS A;  5TDR A;  3HCS A;  2C2V S;  3HCU A;  5D1L B;  3DDT A;  1Z6U A;  2CRR A;  3T9K A;  3ASL A;  5G04 B;  2LRI C;  4O62 A;  2PNX A;  1WGM A;  3H7H A;  2LGL A;  5SVI B;  4YBS A;  5H1V A;  5LCW B;  3LQH A;  3QZV A;  2MA6 A;  3MHH A;  1X4U A;  3C6W A;  3EB6 A;  4H9D A;  1ZBD B;  3Q1D A;  1MM3 A;  3LJU X;  5B77 A;  2VPE A;  4I7D A;  4N4F A;  2MD8 C;  4UP5 A;  2YSJ A;  1K2F A;  2Y43 A;  5G0F A;  3T6R A;  2K16 A;  1WEM A;  3ZVY A;  5TBN A;  3U5P A;  2EGM A;  4GND A;  3E2D A;  2CKL A;  2H0D A;  4GNF A;  2KKY A;  4YAD A;  1U6G B;  4YAX A;  1WES A;  3O7A A;  3RPG B;  4XI1 A;  3M7K A;  2CSZ A;  5LKT A;  2OWA A;  3RPG C;  4OGC A;  2M6M A;  2ECT A;  1T1H A;  5LKU A;  5AIT A;  3U5N A;  2MUM A;  2HYE D;  2L5U A;  3HTK C;  5TDW A;  2CSY A;  4GB0 A;  2ECN A;  2JRJ A;  3LVR E;  2FD4 A;  2YHO A;  2LN0 A;  4AYC B;  2KWO A;  4N3W A;  2CRW A;  1WEU A;  1XWH A;  2M85 A;  4QF3 A;  1Z2Q A;  3M62 A;  5AIU A;  1HYI A;  3EB5 A;  2DX8 A;  3SUB A;  2JM3 A;  5LKZ A;  2M13 A;  3ZPV E;  1JOC A;  3N9L A;  2Y1M A;  3GV4 A;  3KQI A;  3NG2 A;  2AN6 A;  2YUC A;  3ZTG A;  3L1Z B;  5B79 A;  1WEP A;  1VD4 A;  3JUE A;  3FAO A;  4S3O B;  3N9O A;  3VK6 A;  5KH7 A;  2XB1 A;  4S3O C;  4A4C A;  4TKP B;  5G05 B;  2P57 A;  5H1U A;  1WEO A;  2OXQ C;  3O33 A;  1G25 A;  2KGG A;  4LJN A;  4WZ2 A;  2FSA A;  2E61 A;  2YT5 A;  4PPE A;  4AVX A;  2JUN A;  2D8U A;  5SVI A;  2VPD A;  2M3H A;  1VYX A;  3I2D A;  5KH9 A;  4FO9 A;  4R2Y A;  2YQM A;  2L0B A;  4YBM A;  3DQV R;  2KRE A;  4WZ0 A;  3ZVZ B;  2ECV A;  1MM2 A;  2E6R A;  2KWK A;  2HDP A;  3IHP A;  5C13 A;  5FB0 A;  4LK9 A;  1BOR A;  3LRQ A;  3PUR A;  3FEH A;  4GNE A;  2PUY A;  4FJC A;  2UZG A;  4A4B A;  3RTR B;  3O34 A;  3T7L A;  2DSM A;  5J3X A;  5H9M A;  4B7Y C;  3FL2 A;  3DWD A;  2KWN A;  1DVP A;  5B78 A;  4ZQL A;  4FK5 A;  2L80 A;  1MBM A;  3SOX A;  3SHB A;  3LQI A;  2IQJ A;  2VJE B;  2F42 A;  2KGI A;  1N87 A;  4AYC A;  5D1M B;  2G45 A;  4CA1 A;  4L58 A;  3LQJ A;  2XOZ A;  2MA5 A;  2L7P A;  1WEN A;  5D1K B;  4WA6 A;  3KDE C;  2MT5 A;  4W4U A;  3O35 A;  2L43 A;  2YYR A;  4ZDT A;  2C2L A;  2FUI A;  3KV6 A;  3N9M A;  5FER A;  4I7B A;  4LLB A;  1WIM A;  2M1R A;  2MNY A;  4Z0R A;  3C5K A;  2F6J A;  5B75 A;  5TRB A;  1WEQ A;  1WEV A;  2L75 A;  2XP0 A;  5EYA F;  1WE9 A;  1WIL A;  2RSD A;  3U5M A;  3L11 A;  2G43 A;  2VJF B;  2YRE A;  3O70 A;  4PTB A;  4QQ4 A;  1RMD A;  4I7C A;  3HCT A;  2LXH C;  2YQL A;  1WEE A;  2ECI A;  4ZUX U;  4O64 A;  1IYM A;  2MIQ A;  1LDK C;  4C9Z A;  2VP7 A;  5FEY A;  3PHD A;  1CHC A;  4Q6F A;  2KIZ A;  4Z0O A;  2G6Q A;  2B0O E;  5LKX A;  2YHN A;  2CON A;  1X4J A;  2NAA A;  2ECW A;  1V87 A;  3LVQ E;  2I50 A;  3V43 A;  2LGK A;  5I3L A;  5SVY A;  1X4I A;  2KFT A;  4AUQ B;  3LDY A;  2LAU A;  5SVX A;  4CCG X;  1WEW A;  1LDJ B;  2E6S A;  2VJE A;  4FIP A;  3N9P A;  5DIN A;  3FJU B;  4F52 B;  2LDR A;  3O47 A;  3O37 A;  4MVT A;  4P5O B;  4OGE A;  4R8P K;  5K3Q A;  1DCQ A;  3GL6 A;  2ECG A;  2JMJ A;  2VPG A;  3M63 A;  2F6N A;  3ZYQ A;  2FFW A;  4R7E A;  2CT2 A;  2Y1N A;  5C11 A;  2EOD A;  2KU3 A;  1JM7 B;  2LGV A;  2K4D A;  5DKA A;  3PUQ A;  4BHW A;  2FUU A;  2YSM A;  4YC9 A;  2EGP A;  3KNV A;  3FAN A;  5KH3 A;  4YBT A;  5JG6 A;  2QIC A;  1E4U A;  2QJ0 A;  3ZPV 1;  4F1P A;  3M99 A;  2KWJ A;  2ZET C;  2VJF A;  4X3G A;  4A0C D;  2KE1 A;  2MNZ A;  3PLW A;  3U5O A;  2CSV A;  2LQ6 A;  2MKE A;  2D8S A;  2LV9 A;  5B8D A;  1WFK A;  2KR4 A;  3KV5 A;  4L7X A;  3ZNI A;  4BBQ A;  5B76 A;  4WZ3 B;  3O36 A;  2IDA A;  4A49 A;  2VPB A;  2KYU A;  4GNG A;  1HYJ A;  3N9Q A;  2JMI A;  2DJA A;  1F62 A;  1FP0 A;  4UI9 B;  3SOU A;  4YAT A;  5FB1 A; 
#chains in the Genus database with same CATH homology
 2CKL B;  2H0D B;  3L1X A;  2JMD A;  2K1J A;  2EA6 A;  4LAD B;  4YAB A;  4UP0 A;  3N9N A;  4IC2 A;  2RI7 A;  2ECJ A;  2QIZ A;  2XEU A;  2MD7 B;  3DPL R;  2K17 A;  1VFY A;  2VNF A;  1FBV A;  4AP4 A;  4MSX A;  4NN2 A;  4IC3 A;  4V3L C;  2YUR A;  4V3K C;  4QF2 A;  1Z60 A;  2BAY A;  4LKA A;  2LGG A;  2YW8 A;  4B86 C;  5H1T A;  2LXP C;  1JM7 A;  5TAB A;  2YU4 A;  3SOW A;  3MHS A;  5TDR A;  3HCS A;  2C2V S;  3HCU A;  5D1L B;  1Z6U A;  3ASL A;  5G04 B;  2LRI C;  2PNX A;  1WGM A;  2LGL A;  4YBS A;  5H1V A;  5LCW B;  3LQH A;  3QZV A;  2MA6 A;  3MHH A;  1X4U A;  3C6W A;  3EB6 A;  1ZBD B;  1MM3 A;  5B77 A;  2VPE A;  4I7D A;  4N4F A;  2MD8 C;  4UP5 A;  2YSJ A;  1K2F A;  2Y43 A;  5G0F A;  3T6R A;  2K16 A;  1WEM A;  3ZVY A;  5TBN A;  3U5P A;  4GND A;  2CKL A;  4YAD A;  2H0D A;  4GNF A;  1U6G B;  4YAX A;  1WES A;  3O7A A;  3RPG B;  4XI1 A;  2CSZ A;  5LKT A;  3RPG C;  2M6M A;  2ECT A;  1T1H A;  5LKU A;  5AIT A;  3U5N A;  2MUM A;  2HYE D;  2L5U A;  3HTK C;  5TDW A;  2CSY A;  4GB0 A;  2ECN A;  2JRJ A;  2YHO A;  2LN0 A;  4AYC B;  2KWO A;  4N3W A;  1WEU A;  1XWH A;  2M85 A;  4QF3 A;  1Z2Q A;  3M62 A;  5AIU A;  1HYI A;  3EB5 A;  2DX8 A;  5LKZ A;  3ZPV E;  1JOC A;  3N9L A;  2Y1M A;  3GV4 A;  3KQI A;  3NG2 A;  2AN6 A;  2YUC A;  3ZTG A;  3L1Z B;  5B79 A;  1WEP A;  1VD4 A;  4S3O B;  3N9O A;  3VK6 A;  5KH7 A;  2XB1 A;  4S3O C;  4A4C A;  4TKP B;  5G05 B;  5H1U A;  1WEO A;  2OXQ C;  3O33 A;  1G25 A;  2KGG A;  4LJN A;  4WZ2 A;  2FSA A;  2YT5 A;  4PPE A;  4AVX A;  2VPD A;  2M3H A;  1VYX A;  3I2D A;  5KH9 A;  4FO9 A;  4R2Y A;  2YQM A;  2L0B A;  4YBM A;  3DQV R;  2KRE A;  4WZ0 A;  3ZVZ B;  2ECV A;  1MM2 A;  2E6R A;  2KWK A;  2HDP A;  3IHP A;  5C13 A;  5FB0 A;  4LK9 A;  1BOR A;  3LRQ A;  3PUR A;  4GNE A;  2PUY A;  4FJC A;  2UZG A;  4A4B A;  3RTR B;  3O34 A;  3T7L A;  5J3X A;  5H9M A;  4B7Y C;  3FL2 A;  2KWN A;  1DVP A;  5B78 A;  4ZQL A;  4FK5 A;  2L80 A;  3SOX A;  3SHB A;  3LQI A;  2VJE B;  2F42 A;  2KGI A;  1N87 A;  4AYC A;  5D1M B;  2G45 A;  4CA1 A;  4L58 A;  3LQJ A;  2MA5 A;  1WEN A;  5D1K B;  4WA6 A;  2MT5 A;  4W4U A;  3O35 A;  2L43 A;  2YYR A;  4ZDT A;  2C2L A;  2FUI A;  3KV6 A;  3N9M A;  5FER A;  4I7B A;  4LLB A;  1WIM A;  2M1R A;  2MNY A;  3C5K A;  2F6J A;  5B75 A;  5TRB A;  1WEQ A;  1WEV A;  2L75 A;  5EYA F;  1WE9 A;  1WIL A;  2RSD A;  3U5M A;  3L11 A;  2G43 A;  2VJF B;  2YRE A;  3O70 A;  4PTB A;  1RMD A;  4I7C A;  3HCT A;  2LXH C;  2YQL A;  1WEE A;  2ECI A;  4ZUX U;  4O64 A;  1IYM A;  2MIQ A;  1LDK C;  4C9Z A;  2VP7 A;  5FEY A;  3PHD A;  1CHC A;  4Q6F A;  2KIZ A;  2G6Q A;  5LKX A;  2YHN A;  1X4J A;  2NAA A;  2ECW A;  1V87 A;  2I50 A;  3V43 A;  2LGK A;  5I3L A;  1X4I A;  2KFT A;  4AUQ B;  4CCG X;  1WEW A;  1LDJ B;  2E6S A;  2VJE A;  4FIP A;  3N9P A;  5DIN A;  4F52 B;  2LDR A;  3O37 A;  4MVT A;  4P5O B;  4R8P K;  3GL6 A;  2ECG A;  2JMJ A;  2VPG A;  3M63 A;  2F6N A;  3ZYQ A;  4R7E A;  2CT2 A;  2Y1N A;  5C11 A;  2EOD A;  2KU3 A;  1JM7 B;  2LGV A;  2K4D A;  5DKA A;  3PUQ A;  4BHW A;  2FUU A;  2YSM A;  4YC9 A;  2EGP A;  3KNV A;  5KH3 A;  4YBT A;  5JG6 A;  2QIC A;  1E4U A;  2QJ0 A;  3ZPV 1;  3M99 A;  2KWJ A;  2ZET C;  2VJF A;  4X3G A;  4A0C D;  2KE1 A;  2MNZ A;  3U5O A;  2LQ6 A;  2D8S A;  2LV9 A;  5B8D A;  1WFK A;  2KR4 A;  3KV5 A;  4L7X A;  3ZNI A;  4BBQ A;  5B76 A;  4WZ3 B;  3O36 A;  2IDA A;  4A49 A;  2VPB A;  2KYU A;  4GNG A;  1HYJ A;  3N9Q A;  2JMI A;  1F62 A;  1FP0 A;  4UI9 B;  3SOU A;  4YAT A;  5FB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...