2YYRA

Structural analysis of phd domain of pygopus complexed with trimethylated histone h3 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
b'PVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pygopus homolog 1
publication title Structural analysis of PHD domain of Pygopus complexed with trimethylated histone H3 peptide
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 11
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yyrA00
1WEEA 5H1UA 1WE9A 2K16A 5TBNA 2RSDA 1U6GB 2ECNA 3EB6A 3MHSA 2XEUA 1HYIA 2FUUA 4YBMA 2YQLA 4MSXA 2QJ0A 1MM3A 1WEOA 5FEYA 4W4UA 4GNGA 5B79A 1ZBDB 4GNFA 4GB0A 2ECWA 2CKLB 2CSYA 5D1KB 1JOCA 2PNXA 4XI1A 5D1LB 1WFKA 4P5OB 1FP0A 5H9MA 3HCTA 3O34A 3L11A 2DX8A 4YBSA 2LGKA 2YHNA 5G05B 2M1RA 4Q6FA 3DPLR 2OXQC 2FUIA 3N9PA 3QZVA 2VPGA 1VYXA 3KV6A 2MNZA 2LRIC 4YAXA 3LQHA 5B76A 5AIUA 4S3OC 4B7YC 4R8PK 1X4IA 4LKAA 3C5KA 2ZETC 1DVPA 3N9QA 1WGMA 3SOWA 3U5MA 3N9MA 2G43A 4UP0A 4O64A 2I50A 3GV4A 5B77A 4A4BA 5G04B 4BBQA 3ZVYA 4B86C 4LK9A 4V3KC 3PHDA 3T6RA 3MHHA 5C13A 5C11A 2G6QA 1LDKC 2IDAA 3L1ZB 2FSAA 2ECVA 2UZGA 2VPDA 2ECTA 4LJNA 1X4UA 5TRBA 2F42A 2M85A 1Z2QA 5LKUA 2CSZA 3C6WA 2KWJA 3DQVR 2KREA 1VFYA 1V87A 3I2DA 4TKPB 5I3LA 2L80A 3GL6A 2YYRA 4V3LC 4C9ZA 3EB5A 4I7CA 2M3HA 2RI7A 1VD4A 1WEQA 1WEMA 5B8DA 3O70A 4A49A 3LRQA 3N9NA 2H0DA 4X3GA 2JMDA 4QF3A 3FL2A 1WESA 4YC9A 4YADA 1WILA 4CCGX 3O33A 5FB1A 4FO9A 1XWHA 2LV9A 3U5OA 4UP5A 4AYCB 5DKAA 2VJEA 4BHWA 5B75A 4ZUXU 3RTRB 2VNFA 2VP7A 1HYJA 1LDJB 1F62A 5G0FA 5TDRA 3HCUA 5LKZA 2MIQA 2YSJA 2L0BA 3O36A 2QIZA 4PTBA 2VJFB 3SOXA 3LQIA 2HDPA 4S3OB 1JM7B 4WA6A 2KGIA 2KWOA 3NG2A 2KGGA 3HCSA 2EGPA 2L43A 2Y1NA 4WZ2A 2QICA 2CT2A 4YBTA 2C2LA 2CKLA 4CA1A 4ZDTA 5LKXA 5D1MB 1WEVA 4I7DA 2KE1A 2E6SA 2MT5A 2KR4A 1T1HA 2LXHC 5KH3A 2YU4A 5JG6A 5LKTA 3O7AA 1WEUA 4I7BA 2XB1A 5AITA 1MM2A 2JMIA 4MVTA 3O35A 1Z60A 4YABA 3RPGB 3HTKC 4UI9B 2JMJA 4IC2A 3T7LA 4N4FA 2M6MA 1FBVA 2F6NA 1N87A 2LN0A 2LGVA 5FERA 1WENA 4YATA 2YQMA 4R7EA 2K1JA 4NN2A 2D8SA 5H1VA 3M62A 4A4CA 4L7XA 2BAYA 2YW8A 5J3XA 5TABA 2ECIA 4PPEA 2G45A 4WZ3B 2MUMA 4L58A 2LXPC 1K2FA 2F6JA 2L75A 5EYAF 4FJCA 2E6RA 2Y43A 2KIZA 5KH7A 5TDWA 3ASLA 5H1TA 2VPEA 3PUQA 2LDRA 3ZPVE 2HYED 2YT5A 4FK5A 2LGGA 2KYUA 3ZYQA 5KH9A 2KWKA 2EA6A 3ZVZB 2Y1MA 4GNEA 2MA5A 3M63A 3V43A 3ZTGA 2NAAA 2PUYA 2YREA 2YSMA 3M99A 4F52B 2MA6A 4ZQLA 2EODA 4LADB 1X4JA 2L5UA 5B78A 1Z6UA 2KU3A 2MD7B 4LLBA 1WEPA 5DINA 2ECGA 2YHOA 1IYMA 3LQJA 3ZPV1 3U5PA 3PURA 3L1XA 2ECJA 2JRJA 3N9LA 3KV5A 4AP4A 1WEWA 1WIMA 4IC3A 3VK6A 2KFTA 1RMDA 5FB0A 3SOUA 2YURA 2MNYA 2YUCA 4WZ0A 3SHBA 2K4DA 1E4UA 4AUQB 2K17A 2LQ6A 1BORA 4AYCA 2C2VS 2AN6A 4QF2A 4N3WA 3N9OA 3U5NA 2H0DB 2VPBA 4R2YA 3ZNIA 2LGLA 1CHCA 2MD8C 2VJFA 1G25A 5LCWB 4FIPA 4AVXA 1JM7A 4GNDA 2KWNA 3KQIA 3O37A 3IHPA 4A0CD 2VJEB 3KNVA 3RPGC
chains in the Genus database with same CATH superfamily
1WEEA 5H1UA 1WE9A 2K16A 4O62A 5TBNA 2RSDA 1U6GB 2ECNA 3EB6A 3MHSA 2XEUA 1HYIA 4Z0OA 2FUUA 4YBMA 2YQLA 4MSXA 3JUEA 2QJ0A 2DJAA 1MM3A 1WEOA 3LVQE 5FEYA 4W4UA 4GNGA 5B79A 1ZBDB 4GNFA 2CRWA 4GB0A 2XOZA 2ECWA 2CKLB 2EGMA 2CSYA 5D1KB 1JOCA 2PNXA 4XI1A 3DDTA 5D1LB 1WFKA 4P5OB 1FP0A 5H9MA 3HCTA 3O34A 3L11A 2DX8A 4YBSA 2LGKA 2D8UA 2YHNA 5G05B 2M1RA 4Q6FA 3DPLR 2OXQC 2FUIA 3N9PA 3QZVA 2VPGA 1VYXA 3KV6A 5SVXA 2MNZA 3FJUB 2LRIC 4YAXA 3LQHA 5B76A 5AIUA 4S3OC 4B7YC 4R8PK 1X4IA 4LKAA 3C5KA 2ZETC 1DVPA 3N9QA 1WGMA 3SOWA 3U5MA 3N9MA 2G43A 4UP0A 2MKEA 4O64A 2I50A 3GV4A 1DCQA 5B77A 4A4BA 5G04B 4BBQA 3ZVYA 2YVRA 4B86C 4LK9A 4V3KC 3PHDA 3T6RA 3MHHA 2LAUA 5C13A 5C11A 3T9KA 2JM3A 2G6QA 1LDKC 2IDAA 3L1ZB 2FSAA 2ECVA 2UZGA 2VPDA 3E2DA 2M13A 2ECTA 4LJNA 1X4UA 5TRBA 2F42A 2M85A 1Z2QA 5LKUA 4Z0RA 5SVIA 2CSVA 4QQ4A 2CSZA 3C6WA 2KWJA 3DQVR 2KREA 1VFYA 1V87A 3I2DA 3PLWA 4TKPB 5I3LA 2L80A 3GL6A 2YYRA 4V3LC 4C9ZA 3EB5A 4I7CA 2M3HA 2RI7A 1VD4A 1WEQA 1WEMA 3LDYA 5B8DA 3O70A 4A49A 3LRQA 3N9NA 2H0DA 3SUBA 4X3GA 4OGCA 2JMDA 4QF3A 3FL2A 1WESA 2KKXA 4YC9A 4YADA 1WILA 4CCGX 3O33A 5FB1A 4FO9A 1XWHA 2LV9A 3U5OA 4UP5A 4AYCB 2E61A 2XP0A 5DKAA 2VJEA 4BHWA 5B75A 4ZUXU 4H9DA 2VNFA 3RTRB 2VP7A 1HYJA 1LDJB 1F62A 5G0FA 5TDRA 3HCUA 5LKZA 2MIQA 2YSJA 4F1PA 2L0BA 3O36A 2QIZA 4PTBA 2VJFB 3SOXA 3LQIA 2HDPA 4S3OB 1JM7B 4WA6A 2KGIA 2KWOA 3NG2A 2KGGA 3HCSA 2EGPA 3LJUX 2L43A 2Y1NA 4WZ2A 3M7KA 2EXUA 2QICA 2CT2A 4YBTA 2C2LA 2CKLA 4CA1A 4ZDTA 5LKXA 5D1MB 1WEVA 4I7DA 2KE1A 2E6SA 2MT5A 2KR4A 1T1HA 2LXHC 5KH3A 2YU4A 5JG6A 5LKTA 3O7AA 3H7HA 1WEUA 4I7BA 2XB1A 5AITA 1MM2A 2JMIA 4OGEA 4MVTA 2RR4A 3FAOA 3O35A 1Z60A 3LVRE 4YABA 3RPGB 3Q1DA 3HTKC 4UI9B 2JMJA 4IC2A 3T7LA 4N4FA 2XOYA 2M6MA 3FM8C 1FBVA 2F6NA 1N87A 2LN0A 5SVYA 2LGVA 5FERA 1WENA 2FFWA 2YQMA 4YATA 4R7EA 2K1JA 4NN2A 2D8SA 5H1VA 3M62A 2DSMA 4A4CA 4L7XA 2BAYA 2KKYA 2YW8A 5J3XA 2XOCA 5TABA 2ECIA 4PPEA 2G45A 4WZ3B 2MUMA 4L58A 2LXPC 1K2FA 2F6JA 2B0OE 2L75A 5EYAF 4FJCA 2E6RA 2Y43A 2KIZA 5KH7A 5TDWA 3ASLA 5H1TA 2VPEA 3PUQA 3KDEC 2LDRA 3ZPVE 2HYED 2YT5A 4FK5A 2LGGA 2OWAA 2KYUA 3ZYQA 5KH9A 2KWKA 2EA6A 3ZVZB 2Y1MA 4GNEA 2MA5A 2FD4A 3M63A 3V43A 3O47A 3ZTGA 2JUNA 2NAAA 2PUYA 5K3QA 2YREA 2YSMA 3M99A 4F52B 2MA6A 4ZQLA 2EODA 4LADB 1X4JA 2L5UA 5B78A 1Z6UA 2IQJA 2KU3A 5SVIB 2MD7B 4LLBA 1WEPA 5DINA 2ECGA 2YHOA 3FANA 1IYMA 3LQJA 3ZPV1 3U5PA 3PURA 3L1XA 2ECJA 2JRJA 3N9LA 3KV5A 4AP4A 1WEWA 1WIMA 4IC3A 3VK6A 2KFTA 1RMDA 5FB0A 2YURA 3SOUA 2MNYA 2YUCA 4WZ0A 2CONA 3SHBA 2K4DA 1E4UA 4AUQB 2K17A 2L7PA 2LQ6A 1BORA 4AYCA 2C2VS 3FEHA 2AN6A 4QF2A 4N3WA 3N9OA 3U5NA 2H0DB 2P57A 2VPBA 4R2YA 2CRRA 3ZNIA 2LGLA 3DWDA 1CHCA 2MD8C 2VJFA 1G25A 5LCWB 4FIPA 4AVXA 1JM7A 4GNDA 2KWNA 1MBMA 3KQIA 3O37A 3MDBC 3IHPA 4A0CD 2VJEB 3KNVA 3RPGC
chains in the Genus database with same CATH topology
1WEEA 5H1UA 1WE9A 2K16A 5TBNA 2RSDA 1U6GB 2ECNA 3EB6A 3MHSA 2XEUA 1HYIA 2FUUA 4YBMA 2YQLA 4MSXA 2QJ0A 1MM3A 1WEOA 5FEYA 4W4UA 4GNGA 5B79A 1ZBDB 4GNFA 4GB0A 2ECWA 2CKLB 2CSYA 5D1KB 1JOCA 2PNXA 4XI1A 5D1LB 1WFKA 4P5OB 1FP0A 5H9MA 3HCTA 3O34A 3L11A 2DX8A 4YBSA 2LGKA 2YHNA 5G05B 2M1RA 4Q6FA 3DPLR 2OXQC 2FUIA 3N9PA 3QZVA 2VPGA 1VYXA 3KV6A 2MNZA 2LRIC 4YAXA 3LQHA 5B76A 5AIUA 4S3OC 4B7YC 4R8PK 1X4IA 4LKAA 3C5KA 2ZETC 1DVPA 3N9QA 1WGMA 3SOWA 3U5MA 3N9MA 2G43A 4UP0A 4O64A 2I50A 3GV4A 5B77A 4A4BA 5G04B 4BBQA 3ZVYA 4B86C 4LK9A 4V3KC 3PHDA 3T6RA 3MHHA 5C13A 5C11A 2G6QA 1LDKC 2IDAA 3L1ZB 2FSAA 2ECVA 2UZGA 2VPDA 2ECTA 4LJNA 1X4UA 5TRBA 2F42A 2M85A 1Z2QA 5LKUA 2CSZA 3C6WA 2KWJA 3DQVR 2KREA 1VFYA 1V87A 3I2DA 4TKPB 5I3LA 2L80A 3GL6A 2YYRA 4V3LC 4C9ZA 3EB5A 4I7CA 2M3HA 2RI7A 1VD4A 1WEQA 1WEMA 5B8DA 3O70A 4A49A 3LRQA 3N9NA 2H0DA 4X3GA 2JMDA 4QF3A 3FL2A 1WESA 4YC9A 4YADA 1WILA 4CCGX 3O33A 5FB1A 4FO9A 1XWHA 2LV9A 3U5OA 4UP5A 4AYCB 5DKAA 2VJEA 4BHWA 5B75A 4ZUXU 3RTRB 2VNFA 2VP7A 1HYJA 1LDJB 1F62A 5G0FA 5TDRA 3HCUA 5LKZA 2MIQA 2YSJA 2L0BA 3O36A 2QIZA 4PTBA 2VJFB 3SOXA 3LQIA 2HDPA 4S3OB 1JM7B 4WA6A 2KGIA 2KWOA 3NG2A 2KGGA 3HCSA 2EGPA 2L43A 2Y1NA 4WZ2A 2QICA 2CT2A 4YBTA 2C2LA 2CKLA 4CA1A 4ZDTA 5LKXA 5D1MB 1WEVA 4I7DA 2KE1A 2E6SA 2MT5A 2KR4A 1T1HA 2LXHC 5KH3A 2YU4A 5JG6A 5LKTA 3O7AA 1WEUA 4I7BA 2XB1A 5AITA 1MM2A 2JMIA 4MVTA 3O35A 1Z60A 4YABA 3RPGB 3HTKC 4UI9B 2JMJA 4IC2A 3T7LA 4N4FA 2M6MA 1FBVA 2F6NA 1N87A 2LN0A 2LGVA 5FERA 1WENA 4YATA 2YQMA 4R7EA 2K1JA 4NN2A 2D8SA 5H1VA 3M62A 4A4CA 4L7XA 2BAYA 2YW8A 5J3XA 5TABA 2ECIA 4PPEA 2G45A 4WZ3B 2MUMA 4L58A 2LXPC 1K2FA 2F6JA 2L75A 5EYAF 4FJCA 2E6RA 2Y43A 2KIZA 5KH7A 5TDWA 3ASLA 5H1TA 2VPEA 3PUQA 2LDRA 3ZPVE 2HYED 2YT5A 4FK5A 2LGGA 2KYUA 3ZYQA 5KH9A 2KWKA 2EA6A 3ZVZB 2Y1MA 4GNEA 2MA5A 3M63A 3V43A 3ZTGA 2NAAA 2PUYA 2YREA 2YSMA 3M99A 4F52B 2MA6A 4ZQLA 2EODA 4LADB 1X4JA 2L5UA 5B78A 1Z6UA 2KU3A 2MD7B 4LLBA 1WEPA 5DINA 2ECGA 2YHOA 1IYMA 3LQJA 3ZPV1 3U5PA 3PURA 3L1XA 2ECJA 2JRJA 3N9LA 3KV5A 4AP4A 1WEWA 1WIMA 4IC3A 3VK6A 2KFTA 1RMDA 5FB0A 3SOUA 2YURA 2MNYA 2YUCA 4WZ0A 3SHBA 2K4DA 1E4UA 4AUQB 2K17A 2LQ6A 1BORA 4AYCA 2C2VS 2AN6A 4QF2A 4N3WA 3N9OA 3U5NA 2H0DB 2VPBA 4R2YA 3ZNIA 2LGLA 1CHCA 2MD8C 2VJFA 1G25A 5LCWB 4FIPA 4AVXA 1JM7A 4GNDA 2KWNA 3KQIA 3O37A 3IHPA 4A0CD 2VJEB 3KNVA 3RPGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEE A;  5H1U A;  1WE9 A;  2K16 A;  5TBN A;  2RSD A;  1U6G B;  2ECN A;  3EB6 A;  3MHS A;  2XEU A;  1HYI A;  2FUU A;  4YBM A;  2YQL A;  4MSX A;  2QJ0 A;  1MM3 A;  1WEO A;  5FEY A;  4W4U A;  4GNG A;  5B79 A;  1ZBD B;  4GNF A;  4GB0 A;  2ECW A;  2CKL B;  2CSY A;  5D1K B;  1JOC A;  2PNX A;  4XI1 A;  5D1L B;  1WFK A;  4P5O B;  1FP0 A;  5H9M A;  3HCT A;  3O34 A;  3L11 A;  2DX8 A;  4YBS A;  2LGK A;  2YHN A;  5G05 B;  2M1R A;  4Q6F A;  3DPL R;  2OXQ C;  2FUI A;  3N9P A;  3QZV A;  2VPG A;  1VYX A;  3KV6 A;  2MNZ A;  2LRI C;  4YAX A;  3LQH A;  5B76 A;  5AIU A;  4S3O C;  4B7Y C;  4R8P K;  1X4I A;  4LKA A;  3C5K A;  2ZET C;  1DVP A;  3N9Q A;  1WGM A;  3SOW A;  3U5M A;  3N9M A;  2G43 A;  4UP0 A;  4O64 A;  2I50 A;  3GV4 A;  5B77 A;  4A4B A;  5G04 B;  4BBQ A;  3ZVY A;  4B86 C;  4LK9 A;  4V3K C;  3PHD A;  3T6R A;  3MHH A;  5C13 A;  5C11 A;  2G6Q A;  1LDK C;  2IDA A;  3L1Z B;  2FSA A;  2ECV A;  2UZG A;  2VPD A;  2ECT A;  4LJN A;  1X4U A;  5TRB A;  2F42 A;  2M85 A;  1Z2Q A;  5LKU A;  2CSZ A;  3C6W A;  2KWJ A;  3DQV R;  2KRE A;  1VFY A;  1V87 A;  3I2D A;  4TKP B;  5I3L A;  2L80 A;  3GL6 A;  2YYR A;  4V3L C;  4C9Z A;  3EB5 A;  4I7C A;  2M3H A;  2RI7 A;  1VD4 A;  1WEQ A;  1WEM A;  5B8D A;  3O70 A;  4A49 A;  3LRQ A;  3N9N A;  2H0D A;  4X3G A;  2JMD A;  4QF3 A;  3FL2 A;  1WES A;  4YC9 A;  4YAD A;  1WIL A;  4CCG X;  3O33 A;  5FB1 A;  4FO9 A;  1XWH A;  2LV9 A;  3U5O A;  4UP5 A;  4AYC B;  5DKA A;  2VJE A;  4BHW A;  5B75 A;  4ZUX U;  3RTR B;  2VNF A;  2VP7 A;  1HYJ A;  1LDJ B;  1F62 A;  5G0F A;  5TDR A;  3HCU A;  5LKZ A;  2MIQ A;  2YSJ A;  2L0B A;  3O36 A;  2QIZ A;  4PTB A;  2VJF B;  3SOX A;  3LQI A;  2HDP A;  4S3O B;  1JM7 B;  4WA6 A;  2KGI A;  2KWO A;  3NG2 A;  2KGG A;  3HCS A;  2EGP A;  2L43 A;  2Y1N A;  4WZ2 A;  2QIC A;  2CT2 A;  4YBT A;  2C2L A;  2CKL A;  4CA1 A;  4ZDT A;  5LKX A;  5D1M B;  1WEV A;  4I7D A;  2KE1 A;  2E6S A;  2MT5 A;  2KR4 A;  1T1H A;  2LXH C;  5KH3 A;  2YU4 A;  5JG6 A;  5LKT A;  3O7A A;  1WEU A;  4I7B A;  2XB1 A;  5AIT A;  1MM2 A;  2JMI A;  4MVT A;  3O35 A;  1Z60 A;  4YAB A;  3RPG B;  3HTK C;  4UI9 B;  2JMJ A;  4IC2 A;  3T7L A;  4N4F A;  2M6M A;  1FBV A;  2F6N A;  1N87 A;  2LN0 A;  2LGV A;  5FER A;  1WEN A;  4YAT A;  2YQM A;  4R7E A;  2K1J A;  4NN2 A;  2D8S A;  5H1V A;  3M62 A;  4A4C A;  4L7X A;  2BAY A;  2YW8 A;  5J3X A;  5TAB A;  2ECI A;  4PPE A;  2G45 A;  4WZ3 B;  2MUM A;  4L58 A;  2LXP C;  1K2F A;  2F6J A;  2L75 A;  5EYA F;  4FJC A;  2E6R A;  2Y43 A;  2KIZ A;  5KH7 A;  5TDW A;  3ASL A;  5H1T A;  2VPE A;  3PUQ A;  2LDR A;  3ZPV E;  2HYE D;  2YT5 A;  4FK5 A;  2LGG A;  2KYU A;  3ZYQ A;  5KH9 A;  2KWK A;  2EA6 A;  3ZVZ B;  2Y1M A;  4GNE A;  2MA5 A;  3M63 A;  3V43 A;  3ZTG A;  2NAA A;  2PUY A;  2YRE A;  2YSM A;  3M99 A;  4F52 B;  2MA6 A;  4ZQL A;  2EOD A;  4LAD B;  1X4J A;  2L5U A;  5B78 A;  1Z6U A;  2KU3 A;  2MD7 B;  4LLB A;  1WEP A;  5DIN A;  2ECG A;  2YHO A;  1IYM A;  3LQJ A;  3ZPV 1;  3U5P A;  3PUR A;  3L1X A;  2ECJ A;  2JRJ A;  3N9L A;  3KV5 A;  4AP4 A;  1WEW A;  1WIM A;  4IC3 A;  3VK6 A;  2KFT A;  1RMD A;  5FB0 A;  3SOU A;  2YUR A;  2MNY A;  2YUC A;  4WZ0 A;  3SHB A;  2K4D A;  1E4U A;  4AUQ B;  2K17 A;  2LQ6 A;  1BOR A;  4AYC A;  2C2V S;  2AN6 A;  4QF2 A;  4N3W A;  3N9O A;  3U5N A;  2H0D B;  2VPB A;  4R2Y A;  3ZNI A;  2LGL A;  1CHC A;  2MD8 C;  2VJF A;  1G25 A;  5LCW B;  4FIP A;  4AVX A;  1JM7 A;  4GND A;  2KWN A;  3KQI A;  3O37 A;  3IHP A;  4A0C D;  2VJE B;  3KNV A;  3RPG C; 
#chains in the Genus database with same CATH topology
 1WEE A;  5H1U A;  1WE9 A;  2K16 A;  4O62 A;  5TBN A;  2RSD A;  1U6G B;  2ECN A;  3EB6 A;  3MHS A;  2XEU A;  1HYI A;  4Z0O A;  2FUU A;  4YBM A;  2YQL A;  4MSX A;  3JUE A;  2QJ0 A;  2DJA A;  1MM3 A;  1WEO A;  3LVQ E;  5FEY A;  4W4U A;  4GNG A;  5B79 A;  1ZBD B;  4GNF A;  2CRW A;  4GB0 A;  2XOZ A;  2ECW A;  2CKL B;  2EGM A;  2CSY A;  5D1K B;  1JOC A;  2PNX A;  4XI1 A;  3DDT A;  5D1L B;  1WFK A;  4P5O B;  1FP0 A;  5H9M A;  3HCT A;  3O34 A;  3L11 A;  2DX8 A;  4YBS A;  2LGK A;  2D8U A;  2YHN A;  5G05 B;  2M1R A;  4Q6F A;  3DPL R;  2OXQ C;  2FUI A;  3N9P A;  3QZV A;  2VPG A;  1VYX A;  3KV6 A;  5SVX A;  2MNZ A;  3FJU B;  2LRI C;  4YAX A;  3LQH A;  5B76 A;  5AIU A;  4S3O C;  4B7Y C;  4R8P K;  1X4I A;  4LKA A;  3C5K A;  2ZET C;  1DVP A;  3N9Q A;  1WGM A;  3SOW A;  3U5M A;  3N9M A;  2G43 A;  4UP0 A;  2MKE A;  4O64 A;  2I50 A;  3GV4 A;  1DCQ A;  5B77 A;  4A4B A;  5G04 B;  4BBQ A;  3ZVY A;  2YVR A;  4B86 C;  4LK9 A;  4V3K C;  3PHD A;  3T6R A;  3MHH A;  2LAU A;  5C13 A;  5C11 A;  3T9K A;  2JM3 A;  2G6Q A;  1LDK C;  2IDA A;  3L1Z B;  2FSA A;  2ECV A;  2UZG A;  2VPD A;  3E2D A;  2M13 A;  2ECT A;  4LJN A;  1X4U A;  5TRB A;  2F42 A;  2M85 A;  1Z2Q A;  5LKU A;  4Z0R A;  5SVI A;  2CSV A;  4QQ4 A;  2CSZ A;  3C6W A;  2KWJ A;  3DQV R;  2KRE A;  1VFY A;  1V87 A;  3I2D A;  3PLW A;  4TKP B;  5I3L A;  2L80 A;  3GL6 A;  2YYR A;  4V3L C;  4C9Z A;  3EB5 A;  4I7C A;  2M3H A;  2RI7 A;  1VD4 A;  1WEQ A;  1WEM A;  3LDY A;  5B8D A;  3O70 A;  4A49 A;  3LRQ A;  3N9N A;  2H0D A;  3SUB A;  4X3G A;  4OGC A;  2JMD A;  4QF3 A;  3FL2 A;  1WES A;  2KKX A;  4YC9 A;  4YAD A;  1WIL A;  4CCG X;  3O33 A;  5FB1 A;  4FO9 A;  1XWH A;  2LV9 A;  3U5O A;  4UP5 A;  4AYC B;  2E61 A;  2XP0 A;  5DKA A;  2VJE A;  4BHW A;  5B75 A;  4ZUX U;  4H9D A;  2VNF A;  3RTR B;  2VP7 A;  1HYJ A;  1LDJ B;  1F62 A;  5G0F A;  5TDR A;  3HCU A;  5LKZ A;  2MIQ A;  2YSJ A;  4F1P A;  2L0B A;  3O36 A;  2QIZ A;  4PTB A;  2VJF B;  3SOX A;  3LQI A;  2HDP A;  4S3O B;  1JM7 B;  4WA6 A;  2KGI A;  2KWO A;  3NG2 A;  2KGG A;  3HCS A;  2EGP A;  3LJU X;  2L43 A;  2Y1N A;  4WZ2 A;  3M7K A;  2EXU A;  2QIC A;  2CT2 A;  4YBT A;  2C2L A;  2CKL A;  4CA1 A;  4ZDT A;  5LKX A;  5D1M B;  1WEV A;  4I7D A;  2KE1 A;  2E6S A;  2MT5 A;  2KR4 A;  1T1H A;  2LXH C;  5KH3 A;  2YU4 A;  5JG6 A;  5LKT A;  3O7A A;  3H7H A;  1WEU A;  4I7B A;  2XB1 A;  5AIT A;  1MM2 A;  2JMI A;  4OGE A;  4MVT A;  2RR4 A;  3FAO A;  3O35 A;  1Z60 A;  3LVR E;  4YAB A;  3RPG B;  3Q1D A;  3HTK C;  4UI9 B;  2JMJ A;  4IC2 A;  3T7L A;  4N4F A;  2XOY A;  2M6M A;  3FM8 C;  1FBV A;  2F6N A;  1N87 A;  2LN0 A;  5SVY A;  2LGV A;  5FER A;  1WEN A;  2FFW A;  2YQM A;  4YAT A;  4R7E A;  2K1J A;  4NN2 A;  2D8S A;  5H1V A;  3M62 A;  2DSM A;  4A4C A;  4L7X A;  2BAY A;  2KKY A;  2YW8 A;  5J3X A;  2XOC A;  5TAB A;  2ECI A;  4PPE A;  2G45 A;  4WZ3 B;  2MUM A;  4L58 A;  2LXP C;  1K2F A;  2F6J A;  2B0O E;  2L75 A;  5EYA F;  4FJC A;  2E6R A;  2Y43 A;  2KIZ A;  5KH7 A;  5TDW A;  3ASL A;  5H1T A;  2VPE A;  3PUQ A;  3KDE C;  2LDR A;  3ZPV E;  2HYE D;  2YT5 A;  4FK5 A;  2LGG A;  2OWA A;  2KYU A;  3ZYQ A;  5KH9 A;  2KWK A;  2EA6 A;  3ZVZ B;  2Y1M A;  4GNE A;  2MA5 A;  2FD4 A;  3M63 A;  3V43 A;  3O47 A;  3ZTG A;  2JUN A;  2NAA A;  2PUY A;  5K3Q A;  2YRE A;  2YSM A;  3M99 A;  4F52 B;  2MA6 A;  4ZQL A;  2EOD A;  4LAD B;  1X4J A;  2L5U A;  5B78 A;  1Z6U A;  2IQJ A;  2KU3 A;  5SVI B;  2MD7 B;  4LLB A;  1WEP A;  5DIN A;  2ECG A;  2YHO A;  3FAN A;  1IYM A;  3LQJ A;  3ZPV 1;  3U5P A;  3PUR A;  3L1X A;  2ECJ A;  2JRJ A;  3N9L A;  3KV5 A;  4AP4 A;  1WEW A;  1WIM A;  4IC3 A;  3VK6 A;  2KFT A;  1RMD A;  5FB0 A;  2YUR A;  3SOU A;  2MNY A;  2YUC A;  4WZ0 A;  2CON A;  3SHB A;  2K4D A;  1E4U A;  4AUQ B;  2K17 A;  2L7P A;  2LQ6 A;  1BOR A;  4AYC A;  2C2V S;  3FEH A;  2AN6 A;  4QF2 A;  4N3W A;  3N9O A;  3U5N A;  2H0D B;  2P57 A;  2VPB A;  4R2Y A;  2CRR A;  3ZNI A;  2LGL A;  3DWD A;  1CHC A;  2MD8 C;  2VJF A;  1G25 A;  5LCW B;  4FIP A;  4AVX A;  1JM7 A;  4GND A;  2KWN A;  1MBM A;  3KQI A;  3O37 A;  3MDB C;  3IHP A;  4A0C D;  2VJE B;  3KNV A;  3RPG C; 
#chains in the Genus database with same CATH homology
 1WEE A;  5H1U A;  1WE9 A;  2K16 A;  5TBN A;  2RSD A;  1U6G B;  2ECN A;  3EB6 A;  3MHS A;  2XEU A;  1HYI A;  2FUU A;  4YBM A;  2YQL A;  4MSX A;  2QJ0 A;  1MM3 A;  1WEO A;  5FEY A;  4W4U A;  4GNG A;  5B79 A;  1ZBD B;  4GNF A;  4GB0 A;  2ECW A;  2CKL B;  2CSY A;  5D1K B;  1JOC A;  2PNX A;  4XI1 A;  5D1L B;  1WFK A;  4P5O B;  1FP0 A;  5H9M A;  3HCT A;  3O34 A;  3L11 A;  2DX8 A;  4YBS A;  2LGK A;  2YHN A;  5G05 B;  2M1R A;  4Q6F A;  3DPL R;  2OXQ C;  2FUI A;  3N9P A;  3QZV A;  2VPG A;  1VYX A;  3KV6 A;  2MNZ A;  2LRI C;  4YAX A;  3LQH A;  5B76 A;  5AIU A;  4S3O C;  4B7Y C;  4R8P K;  1X4I A;  4LKA A;  3C5K A;  2ZET C;  1DVP A;  3N9Q A;  1WGM A;  3SOW A;  3U5M A;  3N9M A;  2G43 A;  4UP0 A;  4O64 A;  2I50 A;  3GV4 A;  5B77 A;  4A4B A;  5G04 B;  4BBQ A;  3ZVY A;  4B86 C;  4LK9 A;  4V3K C;  3PHD A;  3T6R A;  3MHH A;  5C13 A;  5C11 A;  2G6Q A;  1LDK C;  2IDA A;  3L1Z B;  2FSA A;  2ECV A;  2UZG A;  2VPD A;  2ECT A;  4LJN A;  1X4U A;  5TRB A;  2F42 A;  2M85 A;  1Z2Q A;  5LKU A;  2CSZ A;  3C6W A;  2KWJ A;  3DQV R;  2KRE A;  1VFY A;  1V87 A;  3I2D A;  4TKP B;  5I3L A;  2L80 A;  3GL6 A;  2YYR A;  4V3L C;  4C9Z A;  3EB5 A;  4I7C A;  2M3H A;  2RI7 A;  1VD4 A;  1WEQ A;  1WEM A;  5B8D A;  3O70 A;  4A49 A;  3LRQ A;  3N9N A;  2H0D A;  4X3G A;  2JMD A;  4QF3 A;  3FL2 A;  1WES A;  4YC9 A;  4YAD A;  1WIL A;  4CCG X;  3O33 A;  5FB1 A;  4FO9 A;  1XWH A;  2LV9 A;  3U5O A;  4UP5 A;  4AYC B;  5DKA A;  2VJE A;  4BHW A;  5B75 A;  4ZUX U;  3RTR B;  2VNF A;  2VP7 A;  1HYJ A;  1LDJ B;  1F62 A;  5G0F A;  5TDR A;  3HCU A;  5LKZ A;  2MIQ A;  2YSJ A;  2L0B A;  3O36 A;  2QIZ A;  4PTB A;  2VJF B;  3SOX A;  3LQI A;  2HDP A;  4S3O B;  1JM7 B;  4WA6 A;  2KGI A;  2KWO A;  3NG2 A;  2KGG A;  3HCS A;  2EGP A;  2L43 A;  2Y1N A;  4WZ2 A;  2QIC A;  2CT2 A;  4YBT A;  2C2L A;  2CKL A;  4CA1 A;  4ZDT A;  5LKX A;  5D1M B;  1WEV A;  4I7D A;  2KE1 A;  2E6S A;  2MT5 A;  2KR4 A;  1T1H A;  2LXH C;  5KH3 A;  2YU4 A;  5JG6 A;  5LKT A;  3O7A A;  1WEU A;  4I7B A;  2XB1 A;  5AIT A;  1MM2 A;  2JMI A;  4MVT A;  3O35 A;  1Z60 A;  4YAB A;  3RPG B;  3HTK C;  4UI9 B;  2JMJ A;  4IC2 A;  3T7L A;  4N4F A;  2M6M A;  1FBV A;  2F6N A;  1N87 A;  2LN0 A;  2LGV A;  5FER A;  1WEN A;  4YAT A;  2YQM A;  4R7E A;  2K1J A;  4NN2 A;  2D8S A;  5H1V A;  3M62 A;  4A4C A;  4L7X A;  2BAY A;  2YW8 A;  5J3X A;  5TAB A;  2ECI A;  4PPE A;  2G45 A;  4WZ3 B;  2MUM A;  4L58 A;  2LXP C;  1K2F A;  2F6J A;  2L75 A;  5EYA F;  4FJC A;  2E6R A;  2Y43 A;  2KIZ A;  5KH7 A;  5TDW A;  3ASL A;  5H1T A;  2VPE A;  3PUQ A;  2LDR A;  3ZPV E;  2HYE D;  2YT5 A;  4FK5 A;  2LGG A;  2KYU A;  3ZYQ A;  5KH9 A;  2KWK A;  2EA6 A;  3ZVZ B;  2Y1M A;  4GNE A;  2MA5 A;  3M63 A;  3V43 A;  3ZTG A;  2NAA A;  2PUY A;  2YRE A;  2YSM A;  3M99 A;  4F52 B;  2MA6 A;  4ZQL A;  2EOD A;  4LAD B;  1X4J A;  2L5U A;  5B78 A;  1Z6U A;  2KU3 A;  2MD7 B;  4LLB A;  1WEP A;  5DIN A;  2ECG A;  2YHO A;  1IYM A;  3LQJ A;  3ZPV 1;  3U5P A;  3PUR A;  3L1X A;  2ECJ A;  2JRJ A;  3N9L A;  3KV5 A;  4AP4 A;  1WEW A;  1WIM A;  4IC3 A;  3VK6 A;  2KFT A;  1RMD A;  5FB0 A;  3SOU A;  2YUR A;  2MNY A;  2YUC A;  4WZ0 A;  3SHB A;  2K4D A;  1E4U A;  4AUQ B;  2K17 A;  2LQ6 A;  1BOR A;  4AYC A;  2C2V S;  2AN6 A;  4QF2 A;  4N3W A;  3N9O A;  3U5N A;  2H0D B;  2VPB A;  4R2Y A;  3ZNI A;  2LGL A;  1CHC A;  2MD8 C;  2VJF A;  1G25 A;  5LCW B;  4FIP A;  4AVX A;  1JM7 A;  4GND A;  2KWN A;  3KQI A;  3O37 A;  3IHP A;  4A0C D;  2VJE B;  3KNV A;  3RPG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...