2YYRA

Structural analysis of phd domain of pygopus complexed with trimethylated histone h3 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
PVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of PHD domain of Pygopus complexed with trimethylated histone H3 peptide
rcsb
source organism Mus musculus
molecule tags Metal binding protein
molecule keywords Pygopus homolog 1
total genus 11
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yyrA00
2ECJA 4L58A 1HYJA 5B79A 3M62A 2FUUA 2ZETC 1WENA 1FBVA 2MA6A 2LV9A 4B86C 4PPEA 4MSXA 3M99A 1LDKC 5DINA 3FL2A 4I7BA 4GB0A 3N9LA 4A0CD 2C2VS 2VPBA 1WEEA 1MM2A 3O36A 2VJEA 4YBMA 4I7CA 4V3KC 2E6RA 2YUCA 5AIUA 1E4UA 3T7LA 3SHBA 3C5KA 2VJEB 2KFTA 5H1UA 4S3OC 1RMDA 1T1HA 2MD7B 2CSZA 1VFYA 4AUQB 4GNFA 3O37A 3T6RA 2M85A 2YREA 2NAAA 3KQIA 2CT2A 4BHWA 4QF3A 3SOXA 2YSJA 2L0BA 3HTKC 2CKLA 4CCGX 5FB0A 3O33A 1JM7B 5I3LA 1FP0A 5TBNA 3ZTGA 2LRIC 2AN6A 1LDJB 3ZPV1 4IC2A 2LGVA 2M1RA 2HYED 2MUMA 2VJFB 3PHDA 3KV6A 3O35A 3U5OA 2Y1MA 3N9OA 4AP4A 4R2YA 2IDAA 3N9NA 2YSMA 2G6QA 4B7YC 5D1MB 2K1JA 2VNFA 4YABA 3MHHA 5B8DA 2L43A 2YHOA 2JMIA 2G43A 2RI7A 2VPGA 2ECIA 2QIZA 5LKTA 3N9PA 2KGIA 2C2LA 4GNDA 2YW8A 4S3OB 4A4CA 2H0DA 1WEUA 2MIQA 5FB1A 5B75A 3ZNIA 5KH3A 2PUYA 5TDRA 5D1LB 5G04B 3GL6A 3M63A 2MT5A 5C13A 2EA6A 1WGMA 5C11A 3V43A 4PTBA 5B76A 4GNGA 4CA1A 3O7AA 3L1XA 5LKXA 3ZYQA 1VD4A 1VYXA 3NG2A 1WFKA 2PNXA 2KR4A 4A4BA 2MNYA 2LDRA 2MD8C 4YBSA 2KU3A 4FO9A 4UP5A 2YYRA 3N9MA 1Z2QA 2ECGA 2H0DB 1WEMA 1Z6UA 2F6NA 2JMDA 3LQJA 4NN2A 4ZQLA 5TDWA 1XWHA 4XI1A 1JM7A 5LKUA 3QZVA 5H9MA 1CHCA 4YATA 2QICA 3ZVZB 2K16A 3HCTA 3VK6A 2L5UA 4IC3A 1IYMA 4L7XA 4P5OB 5TABA 2BAYA 3O70A 2YQMA 2FSAA 1WEWA 2KGGA 5B77A 2XEUA 2LQ6A 3EB5A 3L1ZB 2I50A 2JRJA 3DPLR 3ZVYA 4LKAA 2ECVA 5JG6A 4N3WA 3U5NA 2ECTA 5J3XA 2CSYA 5DKAA 2VPEA 3L11A 2KWNA 3U5MA 2E6SA 4FIPA 4W4UA 2F42A 2LXHC 1K2FA 2L80A 3U5PA 3RPGC 3RPGB 4I7DA 1X4JA 2LGLA 2L75A 5KH7A 2UZGA 2YQLA 2LXPC 3SOUA 4F52B 2YURA 4GNEA 4Q6FA 4TKPB 1WEVA 5H1TA 1WIMA 1V87A 2ECWA 2Y1NA 2KREA 1JOCA 2EGPA 4FJCA 5B78A 1WEPA 5KH9A 1BORA 1N87A 5H1VA 1DVPA 2QJ0A 4UP0A 1Z60A 3EB6A 2DX8A 3KNVA 4YAXA 3LQHA 3I2DA 2G45A 2YT5A 2KWKA 3O34A 3LQIA 2M3HA 1F62A 2OXQC 4MVTA 5G05B 1WESA 2KIZA 3DQVR 4A49A 1WEOA 5FERA 3KV5A 2MNZA 2EODA 2VPDA 2K17A 4R7EA 4WZ3B 2YHNA 3LRQA 5LKZA 5EYAF 3MHSA 2LN0A 2ECNA 2KWOA 3GV4A 3SOWA 3ZPVE 4AVXA 4WZ2A 2LGGA 2KYUA 5D1KB 3RTRB 2K4DA 4YBTA 1HYIA 2FUIA 1X4IA 1WE9A 2VP7A 3IHPA 4UI9B 2KWJA 1X4UA 1G25A 1U6GB 1MM3A 4BBQA 3PURA 4C9ZA 2D8SA 4YADA 2F6JA 4WZ0A 4FK5A 2LGKA 4AYCA 3ASLA 2YU4A 1WEQA 2Y43A 2XB1A 3N9QA 3HCSA 4V3LC 2CKLB 3PUQA 4LLBA 5TRBA 2HDPA 4LJNA 4R8PK 4LADB 4O64A 2RSDA 2KE1A 4LK9A 4ZDTA 5FEYA 4QF2A 4X3GA 4N4FA 3C6WA 2M6MA 4WA6A 2VJFA 1WILA 2JMJA 3HCUA 1ZBDB 4YC9A 5AITA 5LCWB 4ZUXU 2MA5A 4AYCB 5G0FA
chains in the Genus database with same CATH superfamily
2EXUA 2ECJA 4L58A 1HYJA 5SVYA 5B79A 3M62A 2FUUA 2ZETC 1WENA 1FBVA 2MA6A 2LV9A 4B86C 4PPEA 4MSXA 3M99A 1LDKC 5DINA 3FL2A 3LVQE 4I7BA 4GB0A 3N9LA 4A0CD 3FJUB 2E61A 2XOCA 2C2VS 2VPBA 1WEEA 1MM2A 3O36A 2VJEA 2XP0A 4YBMA 4I7CA 4V3KC 2E6RA 5K3QA 2YUCA 5AIUA 1E4UA 3T7LA 2XOYA 3SHBA 3C5KA 2VJEB 2KFTA 2L7PA 5H1UA 4S3OC 1RMDA 1T1HA 2MD7B 4F1PA 2CSZA 1VFYA 4AUQB 4GNFA 3O37A 3T6RA 2M85A 2YREA 2NAAA 2KKYA 3KQIA 2CT2A 4BHWA 4QF3A 3SOXA 2YSJA 2L0BA 3HTKC 2CKLA 4CCGX 5FB0A 3O33A 1JM7B 5I3LA 1FP0A 5TBNA 3ZTGA 2LRIC 2AN6A 1LDJB 3ZPV1 4IC2A 2CRWA 2LGVA 2M1RA 2HYED 2MUMA 2VJFB 3FEHA 3Q1DA 3T9KA 3PHDA 3KV6A 3O35A 3U5OA 2Y1MA 3N9OA 4AP4A 4R2YA 2IDAA 3N9NA 2YSMA 2G6QA 4B7YC 5D1MB 2K1JA 2VNFA 3LDYA 4YABA 3MHHA 2RR4A 2DSMA 5B8DA 3DDTA 2L43A 2YHOA 2JMIA 2G43A 2RI7A 2VPGA 2ECIA 2QIZA 4OGEA 2FD4A 2CONA 2XOZA 5LKTA 3KDEC 3N9PA 2KGIA 2C2LA 4GNDA 2YW8A 4S3OB 4A4CA 2H0DA 1WEUA 2MIQA 5FB1A 5B75A 5SVXA 3ZNIA 5KH3A 2PUYA 5TDRA 5D1LB 4QQ4A 5G04B 3GL6A 3M63A 4Z0RA 2MT5A 3MDBC 5C13A 2EA6A 2FFWA 1WGMA 5C11A 3V43A 4PTBA 5B76A 4GNGA 4CA1A 5SVIB 2DJAA 3O7AA 3L1XA 5LKXA 3ZYQA 1VD4A 3FAOA 1VYXA 3NG2A 1WFKA 2PNXA 2KR4A 4A4BA 2MNYA 2LDRA 2MD8C 4YBSA 2KU3A 4FO9A 4UP5A 2YYRA 3N9MA 1Z2QA 2ECGA 2P57A 2H0DB 1WEMA 1Z6UA 2F6NA 2JMDA 1MBMA 3LQJA 4NN2A 4ZQLA 5TDWA 1XWHA 3PLWA 4XI1A 1JM7A 2D8UA 5LKUA 3QZVA 5H9MA 3FM8C 2YVRA 1CHCA 4YATA 2QICA 3ZVZB 2K16A 3HCTA 3VK6A 2L5UA 4IC3A 1IYMA 4L7XA 4P5OB 2EGMA 5TABA 2BAYA 3O70A 2YQMA 2FSAA 1WEWA 2KGGA 5B77A 2XEUA 2LQ6A 3EB5A 2JUNA 3L1ZB 2I50A 2JRJA 3DPLR 2MKEA 3ZVYA 4LKAA 2ECVA 5JG6A 4N3WA 3U5NA 2ECTA 5J3XA 2CSYA 5DKAA 3LJUX 2VPEA 3L11A 2KWNA 3U5MA 2E6SA 2LAUA 3LVRE 4FIPA 4W4UA 2F42A 2LXHC 1K2FA 2L80A 3U5PA 3RPGC 3RPGB 4I7DA 1X4JA 2LGLA 2L75A 5KH7A 2UZGA 2YQLA 2LXPC 3SOUA 4F52B 2YURA 4GNEA 4Q6FA 4TKPB 1WEVA 5H1TA 1WIMA 1V87A 2ECWA 2Y1NA 2KREA 1JOCA 2EGPA 4FJCA 5B78A 1WEPA 5KH9A 1BORA 1N87A 5H1VA 1DVPA 2QJ0A 4UP0A 1Z60A 3DWDA 3EB6A 3M7KA 2DX8A 3KNVA 3H7HA 4YAXA 3LQHA 3I2DA 2G45A 2YT5A 2KWKA 3O34A 3LQIA 2M3HA 1F62A 2JM3A 2OXQC 4MVTA 5G05B 1WESA 2KIZA 3DQVR 1WEOA 4A49A 5FERA 3KV5A 2MNZA 2EODA 2VPDA 3E2DA 2K17A 4R7EA 4WZ3B 2YHNA 3LRQA 2IQJA 5LKZA 5EYAF 3MHSA 2LN0A 2ECNA 2KWOA 3GV4A 3SOWA 3ZPVE 4AVXA 4WZ2A 2LGGA 2OWAA 2KYUA 5D1KB 3RTRB 2K4DA 4YBTA 1HYIA 2FUIA 1X4IA 1WE9A 2VP7A 3IHPA 4H9DA 4UI9B 2KWJA 1X4UA 1G25A 1U6GB 1MM3A 4BBQA 3PURA 4C9ZA 4OGCA 2D8SA 4Z0OA 4YADA 3O47A 2F6JA 4WZ0A 4FK5A 2LGKA 4AYCA 2CRRA 3JUEA 3ASLA 2YU4A 2KKXA 1WEQA 2Y43A 2XB1A 1DCQA 3FANA 3N9QA 3HCSA 4V3LC 2CKLB 3PUQA 4LLBA 5TRBA 2HDPA 4LJNA 4R8PK 4LADB 4O62A 4O64A 2RSDA 2KE1A 4LK9A 4ZDTA 5FEYA 4QF2A 4X3GA 4N4FA 3C6WA 5SVIA 2M6MA 4WA6A 2VJFA 1WILA 2B0OE 2JMJA 3HCUA 1ZBDB 2M13A 4YC9A 3SUBA 5AITA 5LCWB 2CSVA 4ZUXU 2MA5A 4AYCB 5G0FA
chains in the Genus database with same CATH topology
2ECJA 4L58A 1HYJA 5B79A 3M62A 2FUUA 2ZETC 1WENA 1FBVA 2MA6A 2LV9A 4B86C 4PPEA 4MSXA 3M99A 1LDKC 5DINA 3FL2A 4I7BA 4GB0A 3N9LA 4A0CD 2C2VS 2VPBA 1WEEA 1MM2A 3O36A 2VJEA 4YBMA 4I7CA 4V3KC 2E6RA 2YUCA 5AIUA 1E4UA 3T7LA 3SHBA 3C5KA 2VJEB 2KFTA 5H1UA 4S3OC 1RMDA 1T1HA 2MD7B 2CSZA 1VFYA 4AUQB 4GNFA 3O37A 3T6RA 2M85A 2YREA 2NAAA 3KQIA 2CT2A 4BHWA 4QF3A 3SOXA 2YSJA 2L0BA 3HTKC 2CKLA 4CCGX 5FB0A 3O33A 1JM7B 5I3LA 1FP0A 5TBNA 3ZTGA 2LRIC 2AN6A 1LDJB 3ZPV1 4IC2A 2LGVA 2M1RA 2HYED 2MUMA 2VJFB 3PHDA 3KV6A 3O35A 3U5OA 2Y1MA 3N9OA 4AP4A 4R2YA 2IDAA 3N9NA 2YSMA 2G6QA 4B7YC 5D1MB 2K1JA 2VNFA 4YABA 3MHHA 5B8DA 2L43A 2YHOA 2JMIA 2G43A 2RI7A 2VPGA 2ECIA 2QIZA 5LKTA 3N9PA 2KGIA 2C2LA 4GNDA 2YW8A 4S3OB 4A4CA 2H0DA 1WEUA 2MIQA 5FB1A 5B75A 3ZNIA 5KH3A 2PUYA 5TDRA 5D1LB 5G04B 3GL6A 3M63A 2MT5A 5C13A 2EA6A 1WGMA 5C11A 3V43A 4PTBA 5B76A 4GNGA 4CA1A 3O7AA 3L1XA 5LKXA 3ZYQA 1VD4A 1VYXA 3NG2A 1WFKA 2PNXA 2KR4A 4A4BA 2MNYA 2LDRA 2MD8C 4YBSA 2KU3A 4FO9A 4UP5A 2YYRA 3N9MA 1Z2QA 2ECGA 2H0DB 1WEMA 1Z6UA 2F6NA 2JMDA 3LQJA 4NN2A 4ZQLA 5TDWA 1XWHA 4XI1A 1JM7A 5LKUA 3QZVA 5H9MA 1CHCA 4YATA 2QICA 3ZVZB 2K16A 3HCTA 3VK6A 2L5UA 4IC3A 1IYMA 4L7XA 4P5OB 5TABA 2BAYA 3O70A 2YQMA 2FSAA 1WEWA 2KGGA 5B77A 2XEUA 2LQ6A 3EB5A 3L1ZB 2I50A 2JRJA 3DPLR 3ZVYA 4LKAA 2ECVA 5JG6A 4N3WA 3U5NA 2ECTA 5J3XA 2CSYA 5DKAA 2VPEA 3L11A 2KWNA 3U5MA 2E6SA 4FIPA 4W4UA 2F42A 2LXHC 1K2FA 2L80A 3U5PA 3RPGC 3RPGB 4I7DA 1X4JA 2LGLA 2L75A 5KH7A 2UZGA 2YQLA 2LXPC 3SOUA 4F52B 2YURA 4GNEA 4Q6FA 4TKPB 1WEVA 5H1TA 1WIMA 1V87A 2ECWA 2Y1NA 2KREA 1JOCA 2EGPA 4FJCA 5B78A 1WEPA 5KH9A 1BORA 1N87A 5H1VA 1DVPA 2QJ0A 4UP0A 1Z60A 3EB6A 2DX8A 3KNVA 4YAXA 3LQHA 3I2DA 2G45A 2YT5A 2KWKA 3O34A 3LQIA 2M3HA 1F62A 2OXQC 4MVTA 5G05B 1WESA 2KIZA 3DQVR 4A49A 1WEOA 5FERA 3KV5A 2MNZA 2EODA 2VPDA 2K17A 4R7EA 4WZ3B 2YHNA 3LRQA 5LKZA 5EYAF 3MHSA 2LN0A 2ECNA 2KWOA 3GV4A 3SOWA 3ZPVE 4AVXA 4WZ2A 2LGGA 2KYUA 5D1KB 3RTRB 2K4DA 4YBTA 1HYIA 2FUIA 1X4IA 1WE9A 2VP7A 3IHPA 4UI9B 2KWJA 1X4UA 1G25A 1U6GB 1MM3A 4BBQA 3PURA 4C9ZA 2D8SA 4YADA 2F6JA 4WZ0A 4FK5A 2LGKA 4AYCA 3ASLA 2YU4A 1WEQA 2Y43A 2XB1A 3N9QA 3HCSA 4V3LC 2CKLB 3PUQA 4LLBA 5TRBA 2HDPA 4LJNA 4R8PK 4LADB 4O64A 2RSDA 2KE1A 4LK9A 4ZDTA 5FEYA 4QF2A 4X3GA 4N4FA 3C6WA 2M6MA 4WA6A 2VJFA 1WILA 2JMJA 3HCUA 1ZBDB 4YC9A 5AITA 5LCWB 4ZUXU 2MA5A 4AYCB 5G0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECJ A;  4L58 A;  1HYJ A;  5B79 A;  3M62 A;  2FUU A;  2ZET C;  1WEN A;  1FBV A;  2MA6 A;  2LV9 A;  4B86 C;  4PPE A;  4MSX A;  3M99 A;  1LDK C;  5DIN A;  3FL2 A;  4I7B A;  4GB0 A;  3N9L A;  4A0C D;  2C2V S;  2VPB A;  1WEE A;  1MM2 A;  3O36 A;  2VJE A;  4YBM A;  4I7C A;  4V3K C;  2E6R A;  2YUC A;  5AIU A;  1E4U A;  3T7L A;  3SHB A;  3C5K A;  2VJE B;  2KFT A;  5H1U A;  4S3O C;  1RMD A;  1T1H A;  2MD7 B;  2CSZ A;  1VFY A;  4AUQ B;  4GNF A;  3O37 A;  3T6R A;  2M85 A;  2YRE A;  2NAA A;  3KQI A;  2CT2 A;  4BHW A;  4QF3 A;  3SOX A;  2YSJ A;  2L0B A;  3HTK C;  2CKL A;  4CCG X;  5FB0 A;  3O33 A;  1JM7 B;  5I3L A;  1FP0 A;  5TBN A;  3ZTG A;  2LRI C;  2AN6 A;  1LDJ B;  3ZPV 1;  4IC2 A;  2LGV A;  2M1R A;  2HYE D;  2MUM A;  2VJF B;  3PHD A;  3KV6 A;  3O35 A;  3U5O A;  2Y1M A;  3N9O A;  4AP4 A;  4R2Y A;  2IDA A;  3N9N A;  2YSM A;  2G6Q A;  4B7Y C;  5D1M B;  2K1J A;  2VNF A;  4YAB A;  3MHH A;  5B8D A;  2L43 A;  2YHO A;  2JMI A;  2G43 A;  2RI7 A;  2VPG A;  2ECI A;  2QIZ A;  5LKT A;  3N9P A;  2KGI A;  2C2L A;  4GND A;  2YW8 A;  4S3O B;  4A4C A;  2H0D A;  1WEU A;  2MIQ A;  5FB1 A;  5B75 A;  3ZNI A;  5KH3 A;  2PUY A;  5TDR A;  5D1L B;  5G04 B;  3GL6 A;  3M63 A;  2MT5 A;  5C13 A;  2EA6 A;  1WGM A;  5C11 A;  3V43 A;  4PTB A;  5B76 A;  4GNG A;  4CA1 A;  3O7A A;  3L1X A;  5LKX A;  3ZYQ A;  1VD4 A;  1VYX A;  3NG2 A;  1WFK A;  2PNX A;  2KR4 A;  4A4B A;  2MNY A;  2LDR A;  2MD8 C;  4YBS A;  2KU3 A;  4FO9 A;  4UP5 A;  2YYR A;  3N9M A;  1Z2Q A;  2ECG A;  2H0D B;  1WEM A;  1Z6U A;  2F6N A;  2JMD A;  3LQJ A;  4NN2 A;  4ZQL A;  5TDW A;  1XWH A;  4XI1 A;  1JM7 A;  5LKU A;  3QZV A;  5H9M A;  1CHC A;  4YAT A;  2QIC A;  3ZVZ B;  2K16 A;  3HCT A;  3VK6 A;  2L5U A;  4IC3 A;  1IYM A;  4L7X A;  4P5O B;  5TAB A;  2BAY A;  3O70 A;  2YQM A;  2FSA A;  1WEW A;  2KGG A;  5B77 A;  2XEU A;  2LQ6 A;  3EB5 A;  3L1Z B;  2I50 A;  2JRJ A;  3DPL R;  3ZVY A;  4LKA A;  2ECV A;  5JG6 A;  4N3W A;  3U5N A;  2ECT A;  5J3X A;  2CSY A;  5DKA A;  2VPE A;  3L11 A;  2KWN A;  3U5M A;  2E6S A;  4FIP A;  4W4U A;  2F42 A;  2LXH C;  1K2F A;  2L80 A;  3U5P A;  3RPG C;  3RPG B;  4I7D A;  1X4J A;  2LGL A;  2L75 A;  5KH7 A;  2UZG A;  2YQL A;  2LXP C;  3SOU A;  4F52 B;  2YUR A;  4GNE A;  4Q6F A;  4TKP B;  1WEV A;  5H1T A;  1WIM A;  1V87 A;  2ECW A;  2Y1N A;  2KRE A;  1JOC A;  2EGP A;  4FJC A;  5B78 A;  1WEP A;  5KH9 A;  1BOR A;  1N87 A;  5H1V A;  1DVP A;  2QJ0 A;  4UP0 A;  1Z60 A;  3EB6 A;  2DX8 A;  3KNV A;  4YAX A;  3LQH A;  3I2D A;  2G45 A;  2YT5 A;  2KWK A;  3O34 A;  3LQI A;  2M3H A;  1F62 A;  2OXQ C;  4MVT A;  5G05 B;  1WES A;  2KIZ A;  3DQV R;  4A49 A;  1WEO A;  5FER A;  3KV5 A;  2MNZ A;  2EOD A;  2VPD A;  2K17 A;  4R7E A;  4WZ3 B;  2YHN A;  3LRQ A;  5LKZ A;  5EYA F;  3MHS A;  2LN0 A;  2ECN A;  2KWO A;  3GV4 A;  3SOW A;  3ZPV E;  4AVX A;  4WZ2 A;  2LGG A;  2KYU A;  5D1K B;  3RTR B;  2K4D A;  4YBT A;  1HYI A;  2FUI A;  1X4I A;  1WE9 A;  2VP7 A;  3IHP A;  4UI9 B;  2KWJ A;  1X4U A;  1G25 A;  1U6G B;  1MM3 A;  4BBQ A;  3PUR A;  4C9Z A;  2D8S A;  4YAD A;  2F6J A;  4WZ0 A;  4FK5 A;  2LGK A;  4AYC A;  3ASL A;  2YU4 A;  1WEQ A;  2Y43 A;  2XB1 A;  3N9Q A;  3HCS A;  4V3L C;  2CKL B;  3PUQ A;  4LLB A;  5TRB A;  2HDP A;  4LJN A;  4R8P K;  4LAD B;  4O64 A;  2RSD A;  2KE1 A;  4LK9 A;  4ZDT A;  5FEY A;  4QF2 A;  4X3G A;  4N4F A;  3C6W A;  2M6M A;  4WA6 A;  2VJF A;  1WIL A;  2JMJ A;  3HCU A;  1ZBD B;  4YC9 A;  5AIT A;  5LCW B;  4ZUX U;  2MA5 A;  4AYC B;  5G0F A; 
#chains in the Genus database with same CATH topology
 2EXU A;  2ECJ A;  4L58 A;  1HYJ A;  5SVY A;  5B79 A;  3M62 A;  2FUU A;  2ZET C;  1WEN A;  1FBV A;  2MA6 A;  2LV9 A;  4B86 C;  4PPE A;  4MSX A;  3M99 A;  1LDK C;  5DIN A;  3FL2 A;  3LVQ E;  4I7B A;  4GB0 A;  3N9L A;  4A0C D;  3FJU B;  2E61 A;  2XOC A;  2C2V S;  2VPB A;  1WEE A;  1MM2 A;  3O36 A;  2VJE A;  2XP0 A;  4YBM A;  4I7C A;  4V3K C;  2E6R A;  5K3Q A;  2YUC A;  5AIU A;  1E4U A;  3T7L A;  2XOY A;  3SHB A;  3C5K A;  2VJE B;  2KFT A;  2L7P A;  5H1U A;  4S3O C;  1RMD A;  1T1H A;  2MD7 B;  4F1P A;  2CSZ A;  1VFY A;  4AUQ B;  4GNF A;  3O37 A;  3T6R A;  2M85 A;  2YRE A;  2NAA A;  2KKY A;  3KQI A;  2CT2 A;  4BHW A;  4QF3 A;  3SOX A;  2YSJ A;  2L0B A;  3HTK C;  2CKL A;  4CCG X;  5FB0 A;  3O33 A;  1JM7 B;  5I3L A;  1FP0 A;  5TBN A;  3ZTG A;  2LRI C;  2AN6 A;  1LDJ B;  3ZPV 1;  4IC2 A;  2CRW A;  2LGV A;  2M1R A;  2HYE D;  2MUM A;  2VJF B;  3FEH A;  3Q1D A;  3T9K A;  3PHD A;  3KV6 A;  3O35 A;  3U5O A;  2Y1M A;  3N9O A;  4AP4 A;  4R2Y A;  2IDA A;  3N9N A;  2YSM A;  2G6Q A;  4B7Y C;  5D1M B;  2K1J A;  2VNF A;  3LDY A;  4YAB A;  3MHH A;  2RR4 A;  2DSM A;  5B8D A;  3DDT A;  2L43 A;  2YHO A;  2JMI A;  2G43 A;  2RI7 A;  2VPG A;  2ECI A;  2QIZ A;  4OGE A;  2FD4 A;  2CON A;  2XOZ A;  5LKT A;  3KDE C;  3N9P A;  2KGI A;  2C2L A;  4GND A;  2YW8 A;  4S3O B;  4A4C A;  2H0D A;  1WEU A;  2MIQ A;  5FB1 A;  5B75 A;  5SVX A;  3ZNI A;  5KH3 A;  2PUY A;  5TDR A;  5D1L B;  4QQ4 A;  5G04 B;  3GL6 A;  3M63 A;  4Z0R A;  2MT5 A;  3MDB C;  5C13 A;  2EA6 A;  2FFW A;  1WGM A;  5C11 A;  3V43 A;  4PTB A;  5B76 A;  4GNG A;  4CA1 A;  5SVI B;  2DJA A;  3O7A A;  3L1X A;  5LKX A;  3ZYQ A;  1VD4 A;  3FAO A;  1VYX A;  3NG2 A;  1WFK A;  2PNX A;  2KR4 A;  4A4B A;  2MNY A;  2LDR A;  2MD8 C;  4YBS A;  2KU3 A;  4FO9 A;  4UP5 A;  2YYR A;  3N9M A;  1Z2Q A;  2ECG A;  2P57 A;  2H0D B;  1WEM A;  1Z6U A;  2F6N A;  2JMD A;  1MBM A;  3LQJ A;  4NN2 A;  4ZQL A;  5TDW A;  1XWH A;  3PLW A;  4XI1 A;  1JM7 A;  2D8U A;  5LKU A;  3QZV A;  5H9M A;  3FM8 C;  2YVR A;  1CHC A;  4YAT A;  2QIC A;  3ZVZ B;  2K16 A;  3HCT A;  3VK6 A;  2L5U A;  4IC3 A;  1IYM A;  4L7X A;  4P5O B;  2EGM A;  5TAB A;  2BAY A;  3O70 A;  2YQM A;  2FSA A;  1WEW A;  2KGG A;  5B77 A;  2XEU A;  2LQ6 A;  3EB5 A;  2JUN A;  3L1Z B;  2I50 A;  2JRJ A;  3DPL R;  2MKE A;  3ZVY A;  4LKA A;  2ECV A;  5JG6 A;  4N3W A;  3U5N A;  2ECT A;  5J3X A;  2CSY A;  5DKA A;  3LJU X;  2VPE A;  3L11 A;  2KWN A;  3U5M A;  2E6S A;  2LAU A;  3LVR E;  4FIP A;  4W4U A;  2F42 A;  2LXH C;  1K2F A;  2L80 A;  3U5P A;  3RPG C;  3RPG B;  4I7D A;  1X4J A;  2LGL A;  2L75 A;  5KH7 A;  2UZG A;  2YQL A;  2LXP C;  3SOU A;  4F52 B;  2YUR A;  4GNE A;  4Q6F A;  4TKP B;  1WEV A;  5H1T A;  1WIM A;  1V87 A;  2ECW A;  2Y1N A;  2KRE A;  1JOC A;  2EGP A;  4FJC A;  5B78 A;  1WEP A;  5KH9 A;  1BOR A;  1N87 A;  5H1V A;  1DVP A;  2QJ0 A;  4UP0 A;  1Z60 A;  3DWD A;  3EB6 A;  3M7K A;  2DX8 A;  3KNV A;  3H7H A;  4YAX A;  3LQH A;  3I2D A;  2G45 A;  2YT5 A;  2KWK A;  3O34 A;  3LQI A;  2M3H A;  1F62 A;  2JM3 A;  2OXQ C;  4MVT A;  5G05 B;  1WES A;  2KIZ A;  3DQV R;  1WEO A;  4A49 A;  5FER A;  3KV5 A;  2MNZ A;  2EOD A;  2VPD A;  3E2D A;  2K17 A;  4R7E A;  4WZ3 B;  2YHN A;  3LRQ A;  2IQJ A;  5LKZ A;  5EYA F;  3MHS A;  2LN0 A;  2ECN A;  2KWO A;  3GV4 A;  3SOW A;  3ZPV E;  4AVX A;  4WZ2 A;  2LGG A;  2OWA A;  2KYU A;  5D1K B;  3RTR B;  2K4D A;  4YBT A;  1HYI A;  2FUI A;  1X4I A;  1WE9 A;  2VP7 A;  3IHP A;  4H9D A;  4UI9 B;  2KWJ A;  1X4U A;  1G25 A;  1U6G B;  1MM3 A;  4BBQ A;  3PUR A;  4C9Z A;  4OGC A;  2D8S A;  4Z0O A;  4YAD A;  3O47 A;  2F6J A;  4WZ0 A;  4FK5 A;  2LGK A;  4AYC A;  2CRR A;  3JUE A;  3ASL A;  2YU4 A;  2KKX A;  1WEQ A;  2Y43 A;  2XB1 A;  1DCQ A;  3FAN A;  3N9Q A;  3HCS A;  4V3L C;  2CKL B;  3PUQ A;  4LLB A;  5TRB A;  2HDP A;  4LJN A;  4R8P K;  4LAD B;  4O62 A;  4O64 A;  2RSD A;  2KE1 A;  4LK9 A;  4ZDT A;  5FEY A;  4QF2 A;  4X3G A;  4N4F A;  3C6W A;  5SVI A;  2M6M A;  4WA6 A;  2VJF A;  1WIL A;  2B0O E;  2JMJ A;  3HCU A;  1ZBD B;  2M13 A;  4YC9 A;  3SUB A;  5AIT A;  5LCW B;  2CSV A;  4ZUX U;  2MA5 A;  4AYC B;  5G0F A; 
#chains in the Genus database with same CATH homology
 2ECJ A;  4L58 A;  1HYJ A;  5B79 A;  3M62 A;  2FUU A;  2ZET C;  1WEN A;  1FBV A;  2MA6 A;  2LV9 A;  4B86 C;  4PPE A;  4MSX A;  3M99 A;  1LDK C;  5DIN A;  3FL2 A;  4I7B A;  4GB0 A;  3N9L A;  4A0C D;  2C2V S;  2VPB A;  1WEE A;  1MM2 A;  3O36 A;  2VJE A;  4YBM A;  4I7C A;  4V3K C;  2E6R A;  2YUC A;  5AIU A;  1E4U A;  3T7L A;  3SHB A;  3C5K A;  2VJE B;  2KFT A;  5H1U A;  4S3O C;  1RMD A;  1T1H A;  2MD7 B;  2CSZ A;  1VFY A;  4AUQ B;  4GNF A;  3O37 A;  3T6R A;  2M85 A;  2YRE A;  2NAA A;  3KQI A;  2CT2 A;  4BHW A;  4QF3 A;  3SOX A;  2YSJ A;  2L0B A;  3HTK C;  2CKL A;  4CCG X;  5FB0 A;  3O33 A;  1JM7 B;  5I3L A;  1FP0 A;  5TBN A;  3ZTG A;  2LRI C;  2AN6 A;  1LDJ B;  3ZPV 1;  4IC2 A;  2LGV A;  2M1R A;  2HYE D;  2MUM A;  2VJF B;  3PHD A;  3KV6 A;  3O35 A;  3U5O A;  2Y1M A;  3N9O A;  4AP4 A;  4R2Y A;  2IDA A;  3N9N A;  2YSM A;  2G6Q A;  4B7Y C;  5D1M B;  2K1J A;  2VNF A;  4YAB A;  3MHH A;  5B8D A;  2L43 A;  2YHO A;  2JMI A;  2G43 A;  2RI7 A;  2VPG A;  2ECI A;  2QIZ A;  5LKT A;  3N9P A;  2KGI A;  2C2L A;  4GND A;  2YW8 A;  4S3O B;  4A4C A;  2H0D A;  1WEU A;  2MIQ A;  5FB1 A;  5B75 A;  3ZNI A;  5KH3 A;  2PUY A;  5TDR A;  5D1L B;  5G04 B;  3GL6 A;  3M63 A;  2MT5 A;  5C13 A;  2EA6 A;  1WGM A;  5C11 A;  3V43 A;  4PTB A;  5B76 A;  4GNG A;  4CA1 A;  3O7A A;  3L1X A;  5LKX A;  3ZYQ A;  1VD4 A;  1VYX A;  3NG2 A;  1WFK A;  2PNX A;  2KR4 A;  4A4B A;  2MNY A;  2LDR A;  2MD8 C;  4YBS A;  2KU3 A;  4FO9 A;  4UP5 A;  2YYR A;  3N9M A;  1Z2Q A;  2ECG A;  2H0D B;  1WEM A;  1Z6U A;  2F6N A;  2JMD A;  3LQJ A;  4NN2 A;  4ZQL A;  5TDW A;  1XWH A;  4XI1 A;  1JM7 A;  5LKU A;  3QZV A;  5H9M A;  1CHC A;  4YAT A;  2QIC A;  3ZVZ B;  2K16 A;  3HCT A;  3VK6 A;  2L5U A;  4IC3 A;  1IYM A;  4L7X A;  4P5O B;  5TAB A;  2BAY A;  3O70 A;  2YQM A;  2FSA A;  1WEW A;  2KGG A;  5B77 A;  2XEU A;  2LQ6 A;  3EB5 A;  3L1Z B;  2I50 A;  2JRJ A;  3DPL R;  3ZVY A;  4LKA A;  2ECV A;  5JG6 A;  4N3W A;  3U5N A;  2ECT A;  5J3X A;  2CSY A;  5DKA A;  2VPE A;  3L11 A;  2KWN A;  3U5M A;  2E6S A;  4FIP A;  4W4U A;  2F42 A;  2LXH C;  1K2F A;  2L80 A;  3U5P A;  3RPG C;  3RPG B;  4I7D A;  1X4J A;  2LGL A;  2L75 A;  5KH7 A;  2UZG A;  2YQL A;  2LXP C;  3SOU A;  4F52 B;  2YUR A;  4GNE A;  4Q6F A;  4TKP B;  1WEV A;  5H1T A;  1WIM A;  1V87 A;  2ECW A;  2Y1N A;  2KRE A;  1JOC A;  2EGP A;  4FJC A;  5B78 A;  1WEP A;  5KH9 A;  1BOR A;  1N87 A;  5H1V A;  1DVP A;  2QJ0 A;  4UP0 A;  1Z60 A;  3EB6 A;  2DX8 A;  3KNV A;  4YAX A;  3LQH A;  3I2D A;  2G45 A;  2YT5 A;  2KWK A;  3O34 A;  3LQI A;  2M3H A;  1F62 A;  2OXQ C;  4MVT A;  5G05 B;  1WES A;  2KIZ A;  3DQV R;  4A49 A;  1WEO A;  5FER A;  3KV5 A;  2MNZ A;  2EOD A;  2VPD A;  2K17 A;  4R7E A;  4WZ3 B;  2YHN A;  3LRQ A;  5LKZ A;  5EYA F;  3MHS A;  2LN0 A;  2ECN A;  2KWO A;  3GV4 A;  3SOW A;  3ZPV E;  4AVX A;  4WZ2 A;  2LGG A;  2KYU A;  5D1K B;  3RTR B;  2K4D A;  4YBT A;  1HYI A;  2FUI A;  1X4I A;  1WE9 A;  2VP7 A;  3IHP A;  4UI9 B;  2KWJ A;  1X4U A;  1G25 A;  1U6G B;  1MM3 A;  4BBQ A;  3PUR A;  4C9Z A;  2D8S A;  4YAD A;  2F6J A;  4WZ0 A;  4FK5 A;  2LGK A;  4AYC A;  3ASL A;  2YU4 A;  1WEQ A;  2Y43 A;  2XB1 A;  3N9Q A;  3HCS A;  4V3L C;  2CKL B;  3PUQ A;  4LLB A;  5TRB A;  2HDP A;  4LJN A;  4R8P K;  4LAD B;  4O64 A;  2RSD A;  2KE1 A;  4LK9 A;  4ZDT A;  5FEY A;  4QF2 A;  4X3G A;  4N4F A;  3C6W A;  2M6M A;  4WA6 A;  2VJF A;  1WIL A;  2JMJ A;  3HCU A;  1ZBD B;  4YC9 A;  5AIT A;  5LCW B;  4ZUX U;  2MA5 A;  4AYC B;  5G0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...