2YYRA

Structural analysis of phd domain of pygopus complexed with trimethylated histone h3 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
PVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pygopus homolog 1
publication title Structural analysis of PHD domain of Pygopus complexed with trimethylated histone H3 peptide
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 11
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yyrA00
2M85A 1Z60A 3DPLR 2VNFA 3QZVA 2G43A 3I2DA 2L80A 1X4UA 4LADB 3VK6A 1WGMA 2JMJA 4I7BA 2LGVA 3ZVZB 2F6JA 3MHHA 2ECWA 5FERA 4BBQA 3GV4A 4A49A 4V3LC 1ZBDB 3SOWA 2YU4A 3N9OA 3L11A 2NAAA 4N3WA 3ASLA 3N9QA 4WZ3B 3T7LA 5B77A 1MM2A 2C2VS 5TBNA 4MVTA 4Q6FA 5TABA 2L43A 4V3KC 1Z6UA 1WEEA 4L7XA 2EA6A 3O36A 3N9NA 2KE1A 3NG2A 2ECTA 3L1XA 2YSMA 2K4DA 2YT5A 4XI1A 2MNYA 1Z2QA 4R8PK 5TDRA 1WILA 5LKZA 3RPGB 2LN0A 4N4FA 5AITA 3LQJA 2VP7A 2PUYA 2JMDA 4GNEA 2M1RA 2KWNA 1WENA 3KV5A 4GNDA 3FL2A 3N9LA 3PURA 1HYIA 2VJEB 4ZQLA 3U5PA 5JG6A 4X3GA 2LGGA 2JMIA 1WEUA 4ZDTA 4ZUXU 3V43A 3N9PA 2VPGA 4GB0A 2ECNA 2CT2A 2YHNA 1G25A 2XB1A 3EB5A 1JM7A 2MT5A 4W4UA 4B7YC 4YADA 2MD8C 5D1MB 2QICA 5H1UA 4AUQB 5KH9A 2KGGA 3PHDA 4AP4A 2BAYA 4R7EA 2D8SA 4GNGA 4YC9A 4YBMA 3M63A 1WFKA 5I3LA 3RPGC 2ECVA 3HCTA 2PNXA 1MM3A 2LQ6A 1U6GB 2YSJA 3O70A 1LDJB 2CSYA 3DQVR 2G45A 4B86C 4UP5A 5H1VA 4BHWA 1IYMA 5J3XA 4FIPA 4TKPB 4S3OB 4I7CA 4AYCA 2EGPA 4YBSA 3KQIA 2YURA 3HCUA 2KREA 2VPBA 1WESA 2MD7B 4A0CD 3HCSA 2YUCA 3SOUA 1DVPA 2LXHC 2KGIA 2K1JA 4LK9A 2AN6A 2YQMA 2E6SA 3ZYQA 4O64A 4I7DA 2KWKA 3T6RA 5D1KB 2ECGA 1E4UA 4UP0A 4IC3A 2CKLA 3ZPV1 5TRBA 2KYUA 5D1LB 3LRQA 4MSXA 2FSAA 1WEVA 4FK5A 2JRJA 3ZVYA 2CSZA 3O37A 1CHCA 3LQHA 5G05B 1N87A 1X4JA 2RSDA 5DKAA 3C5KA 3SOXA 2VJFA 2H0DA 2Y1MA 2ECIA 3O35A 4WZ0A 2OXQC 2F42A 4S3OC 1WIMA 4AVXA 3KV6A 3O7AA 4YBTA 3N9MA 4WZ2A 2YW8A 4AYCB 1BORA 2KWOA 2M6MA 2K16A 2E6RA 2DX8A 3SHBA 4LKAA 3LQIA 4P5OB 2YYRA 5C11A 2C2LA 4L58A 5B79A 2KU3A 2Y43A 4C9ZA 5LKTA 4QF2A 2ZETC 2HDPA 4QF3A 2VJEA 3KNVA 2LGLA 5B78A 1X4IA 2FUUA 5G04B 2MIQA 2Y1NA 5AIUA 4LJNA 1WEQA 2UZGA 4FO9A 2VPEA 3HTKC 2MUMA 5B8DA 2L0BA 2KFTA 2ECJA 3ZPVE 4NN2A 2YREA 5G0FA 4YABA 2QIZA 4YAXA 2VJFB 3IHPA 3MHSA 2H0DB 5LCWB 4PPEA 4A4BA 5B76A 5FB1A 1XWHA 3ZTGA 3GL6A 4PTBA 1JM7B 2L75A 5H1TA 2L5UA 1F62A 3U5NA 2MA5A 3M62A 5FB0A 1WEOA 4CCGX 5DINA 2QJ0A 4GNFA 1V87A 4LLBA 1FP0A 1VD4A 4FJCA 4YATA 1T1HA 5EYAF 3PUQA 2K17A 5KH3A 3RTRB 4UI9B 2HYED 4F52B 2M3HA 3O33A 5LKUA 1VFYA 1K2FA 5B75A 2KR4A 2I50A 5TDWA 2FUIA 2VPDA 2IDAA 1WEPA 3L1ZB 3ZNIA 2YQLA 1VYXA 2XEUA 2LXPC 3U5MA 1JOCA 1WEWA 1LDKC 2EODA 4R2YA 1HYJA 2LDRA 5FEYA 5KH7A 3U5OA 4A4CA 2MA6A 2MNZA 1RMDA 2YHOA 1WEMA 2G6QA 2RI7A 3EB6A 1WE9A 2KIZA 1FBVA 2LRIC 4IC2A 3M99A 5LKXA 5C13A 2LV9A 4CA1A 2LGKA 5H9MA 2KWJA 2CKLB 4WA6A 2F6NA 3O34A 3C6WA
chains in the Genus database with same CATH superfamily
2M85A 1Z60A 3DPLR 2VNFA 3QZVA 2G43A 3I2DA 2L80A 1X4UA 3M7KA 4LADB 3VK6A 3FAOA 1WGMA 2JMJA 3JUEA 4I7BA 2LGVA 3DDTA 3ZVZB 2JUNA 2F6JA 5SVYA 2XOZA 4H9DA 3MHHA 2ECWA 5FERA 4BBQA 3GV4A 4A49A 2FD4A 3LVRE 4V3LC 2KKYA 2FFWA 1ZBDB 3SOWA 2YU4A 3N9OA 3L11A 2NAAA 2RR4A 4N3WA 3ASLA 3N9QA 4WZ3B 3T7LA 5B77A 1MM2A 2C2VS 5TBNA 4MVTA 4Q6FA 2E61A 5TABA 2L43A 4V3KC 1Z6UA 1WEEA 4L7XA 2EA6A 3O36A 3N9NA 2KE1A 3NG2A 2ECTA 3L1XA 2YSMA 2K4DA 2YT5A 4XI1A 2MNYA 1Z2QA 4R8PK 5TDRA 1WILA 5LKZA 4Z0RA 3RPGB 2LN0A 4N4FA 5AITA 3LQJA 2VP7A 2PUYA 2JMDA 4GNEA 2M1RA 2KWNA 1WENA 3KV5A 4GNDA 3FL2A 3N9LA 3PURA 1HYIA 2VJEB 4ZQLA 3U5PA 5JG6A 2P57A 4X3GA 2LGGA 2XP0A 2JMIA 1WEUA 4ZDTA 4ZUXU 3V43A 3N9PA 2VPGA 4GB0A 2ECNA 2CT2A 2YHNA 1G25A 3FANA 2XB1A 3EB5A 1JM7A 2MT5A 4W4UA 4B7YC 4YADA 2MD8C 5D1MB 2QICA 5H1UA 4AUQB 5KH9A 2KGGA 3PHDA 4AP4A 2BAYA 2CRRA 2YVRA 4R7EA 2D8SA 4GNGA 4YC9A 4YBMA 1DCQA 3M63A 1WFKA 5I3LA 3RPGC 3FM8C 2ECVA 3HCTA 2PNXA 3LJUX 1MM3A 2LQ6A 1U6GB 2YSJA 3O70A 1LDJB 2CSYA 3DQVR 2G45A 4B86C 4UP5A 4OGEA 2M13A 5H1VA 2OWAA 4BHWA 1IYMA 5J3XA 4FIPA 4TKPB 4S3OB 4I7CA 4AYCA 2EGPA 4YBSA 3KQIA 2YURA 3HCUA 2KREA 2VPBA 1WESA 2MD7B 3SUBA 4A0CD 3HCSA 2YUCA 3SOUA 1DVPA 2LXHC 2KGIA 2K1JA 4LK9A 2AN6A 2YQMA 3MDBC 2E6SA 3ZYQA 2EGMA 4O64A 5SVIB 4I7DA 2KWKA 3T6RA 5D1KB 2ECGA 1E4UA 4UP0A 4IC3A 2CKLA 3ZPV1 5TRBA 2KYUA 5D1LB 3LRQA 4MSXA 2FSAA 1WEVA 4FK5A 4F1PA 2JRJA 3ZVYA 2CSZA 3O37A 1CHCA 3LQHA 5G05B 1N87A 1X4JA 2RSDA 5DKAA 3C5KA 3SOXA 2VJFA 2H0DA 2Y1MA 2ECIA 3O35A 4WZ0A 2CRWA 2OXQC 2F42A 4S3OC 1WIMA 4AVXA 3LVQE 3KV6A 3O7AA 4O62A 4YBTA 3N9MA 4WZ2A 2DJAA 2CONA 2B0OE 2IQJA 2YW8A 4AYCB 1BORA 2KWOA 2M6MA 2K16A 2E6RA 2DX8A 3SHBA 4LKAA 3LQIA 4P5OB 2YYRA 2JM3A 5C11A 2C2LA 4L58A 5B79A 2KU3A 2XOCA 2L7PA 2Y43A 4C9ZA 5LKTA 4QF2A 2ZETC 2HDPA 4QF3A 2VJEA 3KNVA 2LGLA 4QQ4A 3O47A 5B78A 1X4IA 2FUUA 5SVXA 5G04B 2MIQA 2Y1NA 5AIUA 4LJNA 1WEQA 2UZGA 4FO9A 2XOYA 2VPEA 3FJUB 3HTKC 2MUMA 5B8DA 2L0BA 4Z0OA 2KFTA 2ECJA 3ZPVE 1MBMA 3KDEC 4NN2A 2YREA 5G0FA 4YABA 2QIZA 4YAXA 2VJFB 3IHPA 3MHSA 2H0DB 5LCWB 4PPEA 2LAUA 4A4BA 3FEHA 5B76A 5FB1A 1XWHA 3ZTGA 3GL6A 2KKXA 4PTBA 1JM7B 2L75A 5H1TA 5K3QA 2L5UA 1F62A 3U5NA 2MA5A 3M62A 5FB0A 2EXUA 1WEOA 4CCGX 5DINA 2QJ0A 4GNFA 1V87A 4LLBA 1FP0A 1VD4A 4FJCA 3Q1DA 4YATA 1T1HA 5EYAF 3PUQA 2K17A 5KH3A 3RTRB 3PLWA 2D8UA 4UI9B 2HYED 4F52B 2M3HA 3O33A 4OGCA 5LKUA 1VFYA 1K2FA 5B75A 2KR4A 2I50A 5TDWA 2FUIA 3DWDA 2VPDA 2IDAA 3H7HA 1WEPA 3L1ZB 3ZNIA 2YQLA 1VYXA 2XEUA 3T9KA 2LXPC 3U5MA 1JOCA 3E2DA 1WEWA 1LDKC 2EODA 4R2YA 1HYJA 2LDRA 5FEYA 5KH7A 3U5OA 5SVIA 4A4CA 2MA6A 2MNZA 1RMDA 2CSVA 2YHOA 2DSMA 1WEMA 2G6QA 3EB6A 2RI7A 1WE9A 2KIZA 1FBVA 2LRIC 4IC2A 3M99A 5LKXA 5C13A 2LV9A 4CA1A 2LGKA 5H9MA 2KWJA 2CKLB 2MKEA 4WA6A 3LDYA 2F6NA 3O34A 3C6WA
chains in the Genus database with same CATH topology
2M85A 1Z60A 3DPLR 2VNFA 3QZVA 2G43A 3I2DA 2L80A 1X4UA 4LADB 3VK6A 1WGMA 2JMJA 4I7BA 2LGVA 3ZVZB 2F6JA 3MHHA 2ECWA 5FERA 4BBQA 3GV4A 4A49A 4V3LC 1ZBDB 3SOWA 2YU4A 3N9OA 3L11A 2NAAA 4N3WA 3ASLA 3N9QA 4WZ3B 3T7LA 5B77A 1MM2A 2C2VS 5TBNA 4MVTA 4Q6FA 5TABA 2L43A 4V3KC 1Z6UA 1WEEA 4L7XA 2EA6A 3O36A 3N9NA 2KE1A 3NG2A 2ECTA 3L1XA 2YSMA 2K4DA 2YT5A 4XI1A 2MNYA 1Z2QA 4R8PK 5TDRA 1WILA 5LKZA 3RPGB 2LN0A 4N4FA 5AITA 3LQJA 2VP7A 2PUYA 2JMDA 4GNEA 2M1RA 2KWNA 1WENA 3KV5A 4GNDA 3FL2A 3N9LA 3PURA 1HYIA 2VJEB 4ZQLA 3U5PA 5JG6A 4X3GA 2LGGA 2JMIA 1WEUA 4ZDTA 4ZUXU 3V43A 3N9PA 2VPGA 4GB0A 2ECNA 2CT2A 2YHNA 1G25A 2XB1A 3EB5A 1JM7A 2MT5A 4W4UA 4B7YC 4YADA 2MD8C 5D1MB 2QICA 5H1UA 4AUQB 5KH9A 2KGGA 3PHDA 4AP4A 2BAYA 4R7EA 2D8SA 4GNGA 4YC9A 4YBMA 3M63A 1WFKA 5I3LA 3RPGC 2ECVA 3HCTA 2PNXA 1MM3A 2LQ6A 1U6GB 2YSJA 3O70A 1LDJB 2CSYA 3DQVR 2G45A 4B86C 4UP5A 5H1VA 4BHWA 1IYMA 5J3XA 4FIPA 4TKPB 4S3OB 4I7CA 4AYCA 2EGPA 4YBSA 3KQIA 2YURA 3HCUA 2KREA 2VPBA 1WESA 2MD7B 4A0CD 3HCSA 2YUCA 3SOUA 1DVPA 2LXHC 2KGIA 2K1JA 4LK9A 2AN6A 2YQMA 2E6SA 3ZYQA 4O64A 4I7DA 2KWKA 3T6RA 5D1KB 2ECGA 1E4UA 4UP0A 4IC3A 2CKLA 3ZPV1 5TRBA 2KYUA 5D1LB 3LRQA 4MSXA 2FSAA 1WEVA 4FK5A 2JRJA 3ZVYA 2CSZA 3O37A 1CHCA 3LQHA 5G05B 1N87A 1X4JA 2RSDA 5DKAA 3C5KA 3SOXA 2VJFA 2H0DA 2Y1MA 2ECIA 3O35A 4WZ0A 2OXQC 2F42A 4S3OC 1WIMA 4AVXA 3KV6A 3O7AA 4YBTA 3N9MA 4WZ2A 2YW8A 4AYCB 1BORA 2KWOA 2M6MA 2K16A 2E6RA 2DX8A 3SHBA 4LKAA 3LQIA 4P5OB 2YYRA 5C11A 2C2LA 4L58A 5B79A 2KU3A 2Y43A 4C9ZA 5LKTA 4QF2A 2ZETC 2HDPA 4QF3A 2VJEA 3KNVA 2LGLA 5B78A 1X4IA 2FUUA 5G04B 2MIQA 2Y1NA 5AIUA 4LJNA 1WEQA 2UZGA 4FO9A 2VPEA 3HTKC 2MUMA 5B8DA 2L0BA 2KFTA 2ECJA 3ZPVE 4NN2A 2YREA 5G0FA 4YABA 2QIZA 4YAXA 2VJFB 3IHPA 3MHSA 2H0DB 5LCWB 4PPEA 4A4BA 5B76A 5FB1A 1XWHA 3ZTGA 3GL6A 4PTBA 1JM7B 2L75A 5H1TA 2L5UA 1F62A 3U5NA 2MA5A 3M62A 5FB0A 1WEOA 4CCGX 5DINA 2QJ0A 4GNFA 1V87A 4LLBA 1FP0A 1VD4A 4FJCA 4YATA 1T1HA 5EYAF 3PUQA 2K17A 5KH3A 3RTRB 4UI9B 2HYED 4F52B 2M3HA 3O33A 5LKUA 1VFYA 1K2FA 5B75A 2KR4A 2I50A 5TDWA 2FUIA 2VPDA 2IDAA 1WEPA 3L1ZB 3ZNIA 2YQLA 1VYXA 2XEUA 2LXPC 3U5MA 1JOCA 1WEWA 1LDKC 2EODA 4R2YA 1HYJA 2LDRA 5FEYA 5KH7A 3U5OA 4A4CA 2MA6A 2MNZA 1RMDA 2YHOA 1WEMA 2G6QA 2RI7A 3EB6A 1WE9A 2KIZA 1FBVA 2LRIC 4IC2A 3M99A 5LKXA 5C13A 2LV9A 4CA1A 2LGKA 5H9MA 2KWJA 2CKLB 4WA6A 2F6NA 3O34A 3C6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M85 A;  1Z60 A;  3DPL R;  2VNF A;  3QZV A;  2G43 A;  3I2D A;  2L80 A;  1X4U A;  4LAD B;  3VK6 A;  1WGM A;  2JMJ A;  4I7B A;  2LGV A;  3ZVZ B;  2F6J A;  3MHH A;  2ECW A;  5FER A;  4BBQ A;  3GV4 A;  4A49 A;  4V3L C;  1ZBD B;  3SOW A;  2YU4 A;  3N9O A;  3L11 A;  2NAA A;  4N3W A;  3ASL A;  3N9Q A;  4WZ3 B;  3T7L A;  5B77 A;  1MM2 A;  2C2V S;  5TBN A;  4MVT A;  4Q6F A;  5TAB A;  2L43 A;  4V3K C;  1Z6U A;  1WEE A;  4L7X A;  2EA6 A;  3O36 A;  3N9N A;  2KE1 A;  3NG2 A;  2ECT A;  3L1X A;  2YSM A;  2K4D A;  2YT5 A;  4XI1 A;  2MNY A;  1Z2Q A;  4R8P K;  5TDR A;  1WIL A;  5LKZ A;  3RPG B;  2LN0 A;  4N4F A;  5AIT A;  3LQJ A;  2VP7 A;  2PUY A;  2JMD A;  4GNE A;  2M1R A;  2KWN A;  1WEN A;  3KV5 A;  4GND A;  3FL2 A;  3N9L A;  3PUR A;  1HYI A;  2VJE B;  4ZQL A;  3U5P A;  5JG6 A;  4X3G A;  2LGG A;  2JMI A;  1WEU A;  4ZDT A;  4ZUX U;  3V43 A;  3N9P A;  2VPG A;  4GB0 A;  2ECN A;  2CT2 A;  2YHN A;  1G25 A;  2XB1 A;  3EB5 A;  1JM7 A;  2MT5 A;  4W4U A;  4B7Y C;  4YAD A;  2MD8 C;  5D1M B;  2QIC A;  5H1U A;  4AUQ B;  5KH9 A;  2KGG A;  3PHD A;  4AP4 A;  2BAY A;  4R7E A;  2D8S A;  4GNG A;  4YC9 A;  4YBM A;  3M63 A;  1WFK A;  5I3L A;  3RPG C;  2ECV A;  3HCT A;  2PNX A;  1MM3 A;  2LQ6 A;  1U6G B;  2YSJ A;  3O70 A;  1LDJ B;  2CSY A;  3DQV R;  2G45 A;  4B86 C;  4UP5 A;  5H1V A;  4BHW A;  1IYM A;  5J3X A;  4FIP A;  4TKP B;  4S3O B;  4I7C A;  4AYC A;  2EGP A;  4YBS A;  3KQI A;  2YUR A;  3HCU A;  2KRE A;  2VPB A;  1WES A;  2MD7 B;  4A0C D;  3HCS A;  2YUC A;  3SOU A;  1DVP A;  2LXH C;  2KGI A;  2K1J A;  4LK9 A;  2AN6 A;  2YQM A;  2E6S A;  3ZYQ A;  4O64 A;  4I7D A;  2KWK A;  3T6R A;  5D1K B;  2ECG A;  1E4U A;  4UP0 A;  4IC3 A;  2CKL A;  3ZPV 1;  5TRB A;  2KYU A;  5D1L B;  3LRQ A;  4MSX A;  2FSA A;  1WEV A;  4FK5 A;  2JRJ A;  3ZVY A;  2CSZ A;  3O37 A;  1CHC A;  3LQH A;  5G05 B;  1N87 A;  1X4J A;  2RSD A;  5DKA A;  3C5K A;  3SOX A;  2VJF A;  2H0D A;  2Y1M A;  2ECI A;  3O35 A;  4WZ0 A;  2OXQ C;  2F42 A;  4S3O C;  1WIM A;  4AVX A;  3KV6 A;  3O7A A;  4YBT A;  3N9M A;  4WZ2 A;  2YW8 A;  4AYC B;  1BOR A;  2KWO A;  2M6M A;  2K16 A;  2E6R A;  2DX8 A;  3SHB A;  4LKA A;  3LQI A;  4P5O B;  2YYR A;  5C11 A;  2C2L A;  4L58 A;  5B79 A;  2KU3 A;  2Y43 A;  4C9Z A;  5LKT A;  4QF2 A;  2ZET C;  2HDP A;  4QF3 A;  2VJE A;  3KNV A;  2LGL A;  5B78 A;  1X4I A;  2FUU A;  5G04 B;  2MIQ A;  2Y1N A;  5AIU A;  4LJN A;  1WEQ A;  2UZG A;  4FO9 A;  2VPE A;  3HTK C;  2MUM A;  5B8D A;  2L0B A;  2KFT A;  2ECJ A;  3ZPV E;  4NN2 A;  2YRE A;  5G0F A;  4YAB A;  2QIZ A;  4YAX A;  2VJF B;  3IHP A;  3MHS A;  2H0D B;  5LCW B;  4PPE A;  4A4B A;  5B76 A;  5FB1 A;  1XWH A;  3ZTG A;  3GL6 A;  4PTB A;  1JM7 B;  2L75 A;  5H1T A;  2L5U A;  1F62 A;  3U5N A;  2MA5 A;  3M62 A;  5FB0 A;  1WEO A;  4CCG X;  5DIN A;  2QJ0 A;  4GNF A;  1V87 A;  4LLB A;  1FP0 A;  1VD4 A;  4FJC A;  4YAT A;  1T1H A;  5EYA F;  3PUQ A;  2K17 A;  5KH3 A;  3RTR B;  4UI9 B;  2HYE D;  4F52 B;  2M3H A;  3O33 A;  5LKU A;  1VFY A;  1K2F A;  5B75 A;  2KR4 A;  2I50 A;  5TDW A;  2FUI A;  2VPD A;  2IDA A;  1WEP A;  3L1Z B;  3ZNI A;  2YQL A;  1VYX A;  2XEU A;  2LXP C;  3U5M A;  1JOC A;  1WEW A;  1LDK C;  2EOD A;  4R2Y A;  1HYJ A;  2LDR A;  5FEY A;  5KH7 A;  3U5O A;  4A4C A;  2MA6 A;  2MNZ A;  1RMD A;  2YHO A;  1WEM A;  2G6Q A;  2RI7 A;  3EB6 A;  1WE9 A;  2KIZ A;  1FBV A;  2LRI C;  4IC2 A;  3M99 A;  5LKX A;  5C13 A;  2LV9 A;  4CA1 A;  2LGK A;  5H9M A;  2KWJ A;  2CKL B;  4WA6 A;  2F6N A;  3O34 A;  3C6W A; 
#chains in the Genus database with same CATH topology
 2M85 A;  1Z60 A;  3DPL R;  2VNF A;  3QZV A;  2G43 A;  3I2D A;  2L80 A;  1X4U A;  3M7K A;  4LAD B;  3VK6 A;  3FAO A;  1WGM A;  2JMJ A;  3JUE A;  4I7B A;  2LGV A;  3DDT A;  3ZVZ B;  2JUN A;  2F6J A;  5SVY A;  2XOZ A;  4H9D A;  3MHH A;  2ECW A;  5FER A;  4BBQ A;  3GV4 A;  4A49 A;  2FD4 A;  3LVR E;  4V3L C;  2KKY A;  2FFW A;  1ZBD B;  3SOW A;  2YU4 A;  3N9O A;  3L11 A;  2NAA A;  2RR4 A;  4N3W A;  3ASL A;  3N9Q A;  4WZ3 B;  3T7L A;  5B77 A;  1MM2 A;  2C2V S;  5TBN A;  4MVT A;  4Q6F A;  2E61 A;  5TAB A;  2L43 A;  4V3K C;  1Z6U A;  1WEE A;  4L7X A;  2EA6 A;  3O36 A;  3N9N A;  2KE1 A;  3NG2 A;  2ECT A;  3L1X A;  2YSM A;  2K4D A;  2YT5 A;  4XI1 A;  2MNY A;  1Z2Q A;  4R8P K;  5TDR A;  1WIL A;  5LKZ A;  4Z0R A;  3RPG B;  2LN0 A;  4N4F A;  5AIT A;  3LQJ A;  2VP7 A;  2PUY A;  2JMD A;  4GNE A;  2M1R A;  2KWN A;  1WEN A;  3KV5 A;  4GND A;  3FL2 A;  3N9L A;  3PUR A;  1HYI A;  2VJE B;  4ZQL A;  3U5P A;  5JG6 A;  2P57 A;  4X3G A;  2LGG A;  2XP0 A;  2JMI A;  1WEU A;  4ZDT A;  4ZUX U;  3V43 A;  3N9P A;  2VPG A;  4GB0 A;  2ECN A;  2CT2 A;  2YHN A;  1G25 A;  3FAN A;  2XB1 A;  3EB5 A;  1JM7 A;  2MT5 A;  4W4U A;  4B7Y C;  4YAD A;  2MD8 C;  5D1M B;  2QIC A;  5H1U A;  4AUQ B;  5KH9 A;  2KGG A;  3PHD A;  4AP4 A;  2BAY A;  2CRR A;  2YVR A;  4R7E A;  2D8S A;  4GNG A;  4YC9 A;  4YBM A;  1DCQ A;  3M63 A;  1WFK A;  5I3L A;  3RPG C;  3FM8 C;  2ECV A;  3HCT A;  2PNX A;  3LJU X;  1MM3 A;  2LQ6 A;  1U6G B;  2YSJ A;  3O70 A;  1LDJ B;  2CSY A;  3DQV R;  2G45 A;  4B86 C;  4UP5 A;  4OGE A;  2M13 A;  5H1V A;  2OWA A;  4BHW A;  1IYM A;  5J3X A;  4FIP A;  4TKP B;  4S3O B;  4I7C A;  4AYC A;  2EGP A;  4YBS A;  3KQI A;  2YUR A;  3HCU A;  2KRE A;  2VPB A;  1WES A;  2MD7 B;  3SUB A;  4A0C D;  3HCS A;  2YUC A;  3SOU A;  1DVP A;  2LXH C;  2KGI A;  2K1J A;  4LK9 A;  2AN6 A;  2YQM A;  3MDB C;  2E6S A;  3ZYQ A;  2EGM A;  4O64 A;  5SVI B;  4I7D A;  2KWK A;  3T6R A;  5D1K B;  2ECG A;  1E4U A;  4UP0 A;  4IC3 A;  2CKL A;  3ZPV 1;  5TRB A;  2KYU A;  5D1L B;  3LRQ A;  4MSX A;  2FSA A;  1WEV A;  4FK5 A;  4F1P A;  2JRJ A;  3ZVY A;  2CSZ A;  3O37 A;  1CHC A;  3LQH A;  5G05 B;  1N87 A;  1X4J A;  2RSD A;  5DKA A;  3C5K A;  3SOX A;  2VJF A;  2H0D A;  2Y1M A;  2ECI A;  3O35 A;  4WZ0 A;  2CRW A;  2OXQ C;  2F42 A;  4S3O C;  1WIM A;  4AVX A;  3LVQ E;  3KV6 A;  3O7A A;  4O62 A;  4YBT A;  3N9M A;  4WZ2 A;  2DJA A;  2CON A;  2B0O E;  2IQJ A;  2YW8 A;  4AYC B;  1BOR A;  2KWO A;  2M6M A;  2K16 A;  2E6R A;  2DX8 A;  3SHB A;  4LKA A;  3LQI A;  4P5O B;  2YYR A;  2JM3 A;  5C11 A;  2C2L A;  4L58 A;  5B79 A;  2KU3 A;  2XOC A;  2L7P A;  2Y43 A;  4C9Z A;  5LKT A;  4QF2 A;  2ZET C;  2HDP A;  4QF3 A;  2VJE A;  3KNV A;  2LGL A;  4QQ4 A;  3O47 A;  5B78 A;  1X4I A;  2FUU A;  5SVX A;  5G04 B;  2MIQ A;  2Y1N A;  5AIU A;  4LJN A;  1WEQ A;  2UZG A;  4FO9 A;  2XOY A;  2VPE A;  3FJU B;  3HTK C;  2MUM A;  5B8D A;  2L0B A;  4Z0O A;  2KFT A;  2ECJ A;  3ZPV E;  1MBM A;  3KDE C;  4NN2 A;  2YRE A;  5G0F A;  4YAB A;  2QIZ A;  4YAX A;  2VJF B;  3IHP A;  3MHS A;  2H0D B;  5LCW B;  4PPE A;  2LAU A;  4A4B A;  3FEH A;  5B76 A;  5FB1 A;  1XWH A;  3ZTG A;  3GL6 A;  2KKX A;  4PTB A;  1JM7 B;  2L75 A;  5H1T A;  5K3Q A;  2L5U A;  1F62 A;  3U5N A;  2MA5 A;  3M62 A;  5FB0 A;  2EXU A;  1WEO A;  4CCG X;  5DIN A;  2QJ0 A;  4GNF A;  1V87 A;  4LLB A;  1FP0 A;  1VD4 A;  4FJC A;  3Q1D A;  4YAT A;  1T1H A;  5EYA F;  3PUQ A;  2K17 A;  5KH3 A;  3RTR B;  3PLW A;  2D8U A;  4UI9 B;  2HYE D;  4F52 B;  2M3H A;  3O33 A;  4OGC A;  5LKU A;  1VFY A;  1K2F A;  5B75 A;  2KR4 A;  2I50 A;  5TDW A;  2FUI A;  3DWD A;  2VPD A;  2IDA A;  3H7H A;  1WEP A;  3L1Z B;  3ZNI A;  2YQL A;  1VYX A;  2XEU A;  3T9K A;  2LXP C;  3U5M A;  1JOC A;  3E2D A;  1WEW A;  1LDK C;  2EOD A;  4R2Y A;  1HYJ A;  2LDR A;  5FEY A;  5KH7 A;  3U5O A;  5SVI A;  4A4C A;  2MA6 A;  2MNZ A;  1RMD A;  2CSV A;  2YHO A;  2DSM A;  1WEM A;  2G6Q A;  3EB6 A;  2RI7 A;  1WE9 A;  2KIZ A;  1FBV A;  2LRI C;  4IC2 A;  3M99 A;  5LKX A;  5C13 A;  2LV9 A;  4CA1 A;  2LGK A;  5H9M A;  2KWJ A;  2CKL B;  2MKE A;  4WA6 A;  3LDY A;  2F6N A;  3O34 A;  3C6W A; 
#chains in the Genus database with same CATH homology
 2M85 A;  1Z60 A;  3DPL R;  2VNF A;  3QZV A;  2G43 A;  3I2D A;  2L80 A;  1X4U A;  4LAD B;  3VK6 A;  1WGM A;  2JMJ A;  4I7B A;  2LGV A;  3ZVZ B;  2F6J A;  3MHH A;  2ECW A;  5FER A;  4BBQ A;  3GV4 A;  4A49 A;  4V3L C;  1ZBD B;  3SOW A;  2YU4 A;  3N9O A;  3L11 A;  2NAA A;  4N3W A;  3ASL A;  3N9Q A;  4WZ3 B;  3T7L A;  5B77 A;  1MM2 A;  2C2V S;  5TBN A;  4MVT A;  4Q6F A;  5TAB A;  2L43 A;  4V3K C;  1Z6U A;  1WEE A;  4L7X A;  2EA6 A;  3O36 A;  3N9N A;  2KE1 A;  3NG2 A;  2ECT A;  3L1X A;  2YSM A;  2K4D A;  2YT5 A;  4XI1 A;  2MNY A;  1Z2Q A;  4R8P K;  5TDR A;  1WIL A;  5LKZ A;  3RPG B;  2LN0 A;  4N4F A;  5AIT A;  3LQJ A;  2VP7 A;  2PUY A;  2JMD A;  4GNE A;  2M1R A;  2KWN A;  1WEN A;  3KV5 A;  4GND A;  3FL2 A;  3N9L A;  3PUR A;  1HYI A;  2VJE B;  4ZQL A;  3U5P A;  5JG6 A;  4X3G A;  2LGG A;  2JMI A;  1WEU A;  4ZDT A;  4ZUX U;  3V43 A;  3N9P A;  2VPG A;  4GB0 A;  2ECN A;  2CT2 A;  2YHN A;  1G25 A;  2XB1 A;  3EB5 A;  1JM7 A;  2MT5 A;  4W4U A;  4B7Y C;  4YAD A;  2MD8 C;  5D1M B;  2QIC A;  5H1U A;  4AUQ B;  5KH9 A;  2KGG A;  3PHD A;  4AP4 A;  2BAY A;  4R7E A;  2D8S A;  4GNG A;  4YC9 A;  4YBM A;  3M63 A;  1WFK A;  5I3L A;  3RPG C;  2ECV A;  3HCT A;  2PNX A;  1MM3 A;  2LQ6 A;  1U6G B;  2YSJ A;  3O70 A;  1LDJ B;  2CSY A;  3DQV R;  2G45 A;  4B86 C;  4UP5 A;  5H1V A;  4BHW A;  1IYM A;  5J3X A;  4FIP A;  4TKP B;  4S3O B;  4I7C A;  4AYC A;  2EGP A;  4YBS A;  3KQI A;  2YUR A;  3HCU A;  2KRE A;  2VPB A;  1WES A;  2MD7 B;  4A0C D;  3HCS A;  2YUC A;  3SOU A;  1DVP A;  2LXH C;  2KGI A;  2K1J A;  4LK9 A;  2AN6 A;  2YQM A;  2E6S A;  3ZYQ A;  4O64 A;  4I7D A;  2KWK A;  3T6R A;  5D1K B;  2ECG A;  1E4U A;  4UP0 A;  4IC3 A;  2CKL A;  3ZPV 1;  5TRB A;  2KYU A;  5D1L B;  3LRQ A;  4MSX A;  2FSA A;  1WEV A;  4FK5 A;  2JRJ A;  3ZVY A;  2CSZ A;  3O37 A;  1CHC A;  3LQH A;  5G05 B;  1N87 A;  1X4J A;  2RSD A;  5DKA A;  3C5K A;  3SOX A;  2VJF A;  2H0D A;  2Y1M A;  2ECI A;  3O35 A;  4WZ0 A;  2OXQ C;  2F42 A;  4S3O C;  1WIM A;  4AVX A;  3KV6 A;  3O7A A;  4YBT A;  3N9M A;  4WZ2 A;  2YW8 A;  4AYC B;  1BOR A;  2KWO A;  2M6M A;  2K16 A;  2E6R A;  2DX8 A;  3SHB A;  4LKA A;  3LQI A;  4P5O B;  2YYR A;  5C11 A;  2C2L A;  4L58 A;  5B79 A;  2KU3 A;  2Y43 A;  4C9Z A;  5LKT A;  4QF2 A;  2ZET C;  2HDP A;  4QF3 A;  2VJE A;  3KNV A;  2LGL A;  5B78 A;  1X4I A;  2FUU A;  5G04 B;  2MIQ A;  2Y1N A;  5AIU A;  4LJN A;  1WEQ A;  2UZG A;  4FO9 A;  2VPE A;  3HTK C;  2MUM A;  5B8D A;  2L0B A;  2KFT A;  2ECJ A;  3ZPV E;  4NN2 A;  2YRE A;  5G0F A;  4YAB A;  2QIZ A;  4YAX A;  2VJF B;  3IHP A;  3MHS A;  2H0D B;  5LCW B;  4PPE A;  4A4B A;  5B76 A;  5FB1 A;  1XWH A;  3ZTG A;  3GL6 A;  4PTB A;  1JM7 B;  2L75 A;  5H1T A;  2L5U A;  1F62 A;  3U5N A;  2MA5 A;  3M62 A;  5FB0 A;  1WEO A;  4CCG X;  5DIN A;  2QJ0 A;  4GNF A;  1V87 A;  4LLB A;  1FP0 A;  1VD4 A;  4FJC A;  4YAT A;  1T1H A;  5EYA F;  3PUQ A;  2K17 A;  5KH3 A;  3RTR B;  4UI9 B;  2HYE D;  4F52 B;  2M3H A;  3O33 A;  5LKU A;  1VFY A;  1K2F A;  5B75 A;  2KR4 A;  2I50 A;  5TDW A;  2FUI A;  2VPD A;  2IDA A;  1WEP A;  3L1Z B;  3ZNI A;  2YQL A;  1VYX A;  2XEU A;  2LXP C;  3U5M A;  1JOC A;  1WEW A;  1LDK C;  2EOD A;  4R2Y A;  1HYJ A;  2LDR A;  5FEY A;  5KH7 A;  3U5O A;  4A4C A;  2MA6 A;  2MNZ A;  1RMD A;  2YHO A;  1WEM A;  2G6Q A;  2RI7 A;  3EB6 A;  1WE9 A;  2KIZ A;  1FBV A;  2LRI C;  4IC2 A;  3M99 A;  5LKX A;  5C13 A;  2LV9 A;  4CA1 A;  2LGK A;  5H9M A;  2KWJ A;  2CKL B;  4WA6 A;  2F6N A;  3O34 A;  3C6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...