3DPLR

Structural insights into nedd8 activation of cullin-ring ligases: conformational control of conjugation.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
90
structure length
87
Chain Sequence
KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASAECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cullin-5
publication title Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 13
structure length 87
sequence length 90
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3dplR00
4YADA 4R7EA 5LCWB 3U5PA 4WZ2A 2YURA 4LK9A 2XEUA 2Y1NA 2G43A 1FP0A 2ZETC 2KWJA 5AIUA 2FUIA 5KH3A 3LQIA 2M3HA 4IC2A 4YBTA 4A0CD 3MHSA 2MA6A 3N9LA 3KV5A 2Y1MA 2HDPA 4LLBA 1HYJA 5D1LB 3O33A 2F6JA 2ECJA 5JG6A 2FUUA 3N9MA 3T6RA 1MM3A 2L5UA 2NAAA 3RPGB 4Q6FA 4YBSA 2E6RA 1WEOA 3GL6A 4AUQB 3O35A 2VPGA 4X3GA 5FB0A 4QF3A 3I2DA 1V87A 2KWKA 2KWOA 2YSMA 1VD4A 2ECIA 2F42A 2MUMA 2Y43A 4ZQLA 5H9MA 3C6WA 4ZUXU 2VP7A 2VPEA 1T1HA 3ZYQA 5J3XA 2IDAA 3N9NA 4AVXA 4NN2A 2LN0A 4YAXA 2YQLA 1LDKC 2FSAA 2K1JA 1WGMA 2M85A 2LXPC 3FL2A 5G05B 2YW8A 2C2LA 4GB0A 3PHDA 4C9ZA 3SOWA 2LDRA 5H1VA 3MHHA 4I7DA 5TRBA 1G25A 4V3KC 1RMDA 3ZVYA 5H1TA 2VJEA 1DVPA 5DKAA 4UI9B 1K2FA 1FBVA 4I7BA 3EB6A 4FO9A 3HTKC 5LKZA 4N4FA 1VFYA 2H0DB 5KH9A 3N9OA 5G04B 2CKLA 1WILA 3O70A 2CSZA 3ASLA 4WZ0A 1WEPA 4A4BA 2RI7A 1WEWA 2VJFA 2OXQC 2RSDA 4WA6A 2KIZA 1LDJB 2MNZA 3N9PA 5I3LA 1JM7A 2XB1A 5H1UA 3LRQA 4UP5A 4R2YA 2LQ6A 2LGGA 3M62A 2KWNA 4YABA 4BHWA 2EODA 1HYIA 5B76A 4AP4A 2MA5A 4FJCA 3QZVA 2JMIA 2YSJA 4YC9A 4P5OB 2MD8C 4QF2A 2VPDA 3N9QA 3KQIA 2HYED 5LKTA 4V3LC 1X4UA 3T7LA 1X4JA 4O64A 4A49A 5DINA 2K16A 4GNEA 2L43A 2K17A 5C11A 4XI1A 2YT5A 4LADB 2CSYA 2KGGA 1WEVA 2QIZA 2ECNA 1XWHA 3SOUA 3DPLR 2LV9A 2G45A 2ECWA 4GNFA 3L11A 4WZ3B 1Z6UA 3HCSA 3ZVZB 2KE1A 5B75A 5LKXA 3ZPVE 5TDRA 2C2VS 2JMDA 4YATA 4L58A 2L75A 1ZBDB 1Z60A 2VPBA 2LGLA 4PTBA 2QJ0A 2YHOA 4MSXA 2D8SA 2M6MA 3L1ZB 2KU3A 1WEUA 4AYCA 5FEYA 5AITA 3SHBA 2L80A 1N87A 2AN6A 4GNDA 1WIMA 2YQMA 3O36A 4ZDTA 4B86C 4IC3A 4LJNA 5FERA 2DX8A 3O37A 3U5MA 3VK6A 2VJEB 1WEEA 3EB5A 5LKUA 1VYXA 2QICA 1F62A 1Z2QA 1MM2A 3HCTA 2CKLB 2ECVA 2EGPA 3O34A 1WE9A 2EA6A 2VJFB 3L1XA 2LGKA 5FB1A 2JRJA 2L0BA 4TKPB 4F52B 5TBNA 3ZNIA 2MNYA 1JM7B 4MVTA 2YUCA 5G0FA 3IHPA 2KFTA 5EYAF 3DQVR 4BBQA 2MD7B 2YU4A 3RTRB 4S3OC 4L7XA 2VNFA 5KH7A 1E4UA 4W4UA 5TDWA 4FIPA 2KYUA 3U5NA 4CA1A 4GNGA 2G6QA 2I50A 2ECGA 1WESA 5TABA 1JOCA 3LQJA 2F6NA 2BAYA 3ZPV1 5D1MB 2PUYA 5D1KB 1U6GB 2KREA 2MT5A 1WENA 3PUQA 3KNVA 2KGIA 2CT2A 2LXHC 4FK5A 2LRIC 2YHNA 1WEMA 1X4IA 2KR4A 4A4CA 4PPEA 2M1RA 3LQHA 3C5KA 3SOXA 5B77A 3NG2A 4N3WA 3ZTGA 2YREA 2MIQA 5B79A 3M63A 2E6SA 1BORA 4S3OB 2ECTA 4CCGX 3M99A 2UZGA 2LGVA 2K4DA 1IYMA 4UP0A 3PURA 5B8DA 2YYRA 3HCUA 2JMJA 3GV4A 2H0DA 4LKAA 4I7CA 4AYCB 1WEQA 5C13A 2PNXA 1WFKA 3O7AA 3V43A 3RPGC 5B78A 1CHCA 3U5OA 3KV6A 4YBMA 4B7YC 4R8PK
chains in the Genus database with same CATH superfamily
2DJAA 4YADA 4R7EA 3H7HA 5LCWB 3U5PA 4WZ2A 2YURA 4LK9A 2XEUA 2Y1NA 2G43A 2DSMA 1FP0A 4Z0RA 2ZETC 3T9KA 2KWJA 5AIUA 2B0OE 2FUIA 5KH3A 3LQIA 2M3HA 4IC2A 4YBTA 4A0CD 5SVXA 3MHSA 2MA6A 2XOZA 3N9LA 3KV5A 2Y1MA 2HDPA 4LLBA 1HYJA 5D1LB 3O33A 2F6JA 2ECJA 5JG6A 2FUUA 3N9MA 3O47A 3T6RA 1MM3A 2L5UA 2NAAA 3RPGB 4Q6FA 4YBSA 2E6RA 1WEOA 3GL6A 4AUQB 3O35A 2VPGA 4X3GA 5FB0A 4QF3A 3I2DA 3M7KA 2CRRA 2L7PA 1V87A 3Q1DA 3E2DA 2KWKA 2KWOA 2YSMA 2EGMA 1VD4A 2ECIA 2F42A 2MUMA 2Y43A 4ZQLA 2CONA 5H9MA 4QQ4A 3C6WA 4ZUXU 2VP7A 2VPEA 1T1HA 3ZYQA 5J3XA 2IDAA 3N9NA 4AVXA 4NN2A 2LN0A 4YAXA 2YQLA 1LDKC 5SVYA 2FSAA 2K1JA 1WGMA 2M85A 2M13A 2LXPC 2LAUA 3FL2A 5G05B 2YW8A 2C2LA 4GB0A 2XOYA 4F1PA 3PHDA 4C9ZA 3SOWA 5K3QA 2LDRA 5H1VA 3MHHA 4I7DA 5TRBA 1G25A 4V3KC 1RMDA 3ZVYA 5H1TA 2VJEA 1DVPA 5DKAA 4UI9B 1K2FA 1FBVA 4I7BA 3EB6A 4FO9A 3HTKC 5LKZA 4N4FA 1VFYA 2H0DB 5KH9A 3N9OA 5G04B 4H9DA 2CKLA 1WILA 3O70A 2CSZA 3ASLA 4WZ0A 4Z0OA 3FM8C 1WEPA 2JM3A 4A4BA 2RI7A 1WEWA 2VJFA 3PLWA 2OXQC 2RSDA 3FEHA 4WA6A 2D8UA 2KIZA 1LDJB 2MNZA 3N9PA 5I3LA 1JM7A 2XB1A 5H1UA 2KKYA 3LRQA 2FFWA 4UP5A 4R2YA 4OGCA 2LQ6A 2LGGA 3M62A 4O62A 2KWNA 2KKXA 4YABA 4BHWA 2EODA 1HYIA 5B76A 4AP4A 1DCQA 2MA5A 4FJCA 3QZVA 2JUNA 2JMIA 2YSJA 3FAOA 4YC9A 4P5OB 2MD8C 4QF2A 2VPDA 3N9QA 3KQIA 2HYED 5LKTA 3MDBC 4V3LC 1X4UA 3T7LA 1X4JA 4O64A 4A49A 5DINA 2K16A 4GNEA 2L43A 2K17A 5C11A 4XI1A 2YT5A 4LADB 2E61A 2CSYA 2KGGA 1WEVA 2QIZA 2ECNA 1XWHA 3SOUA 3DPLR 2OWAA 2LV9A 2G45A 2ECWA 4GNFA 3L11A 4WZ3B 1Z6UA 3HCSA 3ZVZB 2KE1A 5B75A 5LKXA 3ZPVE 5TDRA 2C2VS 2JMDA 4YATA 4L58A 2L75A 3DDTA 1ZBDB 3KDEC 1Z60A 2VPBA 2LGLA 4PTBA 2QJ0A 2YHOA 4MSXA 2D8SA 2M6MA 3L1ZB 2KU3A 1WEUA 4AYCA 5FEYA 5AITA 3SHBA 2L80A 1N87A 2CSVA 2AN6A 4GNDA 1WIMA 2P57A 2YQMA 3O36A 4ZDTA 4B86C 4IC3A 4LJNA 2YVRA 5FERA 2DX8A 3LJUX 3O37A 3U5MA 3VK6A 2VJEB 1WEEA 3EB5A 5LKUA 3JUEA 1VYXA 5SVIA 2QICA 1F62A 1Z2QA 3DWDA 1MM2A 3HCTA 2CKLB 2ECVA 2EGPA 4OGEA 3O34A 1WE9A 2EA6A 2VJFB 3L1XA 2LGKA 5FB1A 2JRJA 5SVIB 2L0BA 4TKPB 4F52B 5TBNA 3ZNIA 2MNYA 2MKEA 1JM7B 4MVTA 2YUCA 5G0FA 3IHPA 2KFTA 5EYAF 2XOCA 3DQVR 4BBQA 2MD7B 2YU4A 3RTRB 4S3OC 4L7XA 2VNFA 5KH7A 1E4UA 3LVRE 4W4UA 5TDWA 3SUBA 4FIPA 2KYUA 3U5NA 4CA1A 2EXUA 4GNGA 2G6QA 2I50A 2ECGA 1WESA 5TABA 1JOCA 3LQJA 2IQJA 2F6NA 2BAYA 3ZPV1 5D1MB 1MBMA 2PUYA 5D1KB 1U6GB 2KREA 2MT5A 1WENA 3PUQA 3KNVA 2KGIA 2CT2A 2LXHC 4FK5A 3FANA 2LRIC 2YHNA 1WEMA 1X4IA 2KR4A 4A4CA 4PPEA 2M1RA 2RR4A 3LQHA 3C5KA 3SOXA 5B77A 3NG2A 4N3WA 3ZTGA 2YREA 2MIQA 5B79A 3M63A 3FJUB 2E6SA 1BORA 4S3OB 2ECTA 4CCGX 3LVQE 3M99A 2CRWA 2UZGA 2LGVA 2K4DA 1IYMA 4UP0A 3PURA 5B8DA 2YYRA 3HCUA 3LDYA 2JMJA 3GV4A 2FD4A 2H0DA 4LKAA 2XP0A 4I7CA 4AYCB 1WEQA 5C13A 2PNXA 1WFKA 3O7AA 3V43A 3RPGC 5B78A 1CHCA 3U5OA 3KV6A 4YBMA 4B7YC 4R8PK
chains in the Genus database with same CATH topology
4YADA 4R7EA 5LCWB 3U5PA 4WZ2A 2YURA 4LK9A 2XEUA 2Y1NA 2G43A 1FP0A 2ZETC 2KWJA 5AIUA 2FUIA 5KH3A 3LQIA 2M3HA 4IC2A 4YBTA 4A0CD 3MHSA 2MA6A 3N9LA 3KV5A 2Y1MA 2HDPA 4LLBA 1HYJA 5D1LB 3O33A 2F6JA 2ECJA 5JG6A 2FUUA 3N9MA 3T6RA 1MM3A 2L5UA 2NAAA 3RPGB 4Q6FA 4YBSA 2E6RA 1WEOA 3GL6A 4AUQB 3O35A 2VPGA 4X3GA 5FB0A 4QF3A 3I2DA 1V87A 2KWKA 2KWOA 2YSMA 1VD4A 2ECIA 2F42A 2MUMA 2Y43A 4ZQLA 5H9MA 3C6WA 4ZUXU 2VP7A 2VPEA 1T1HA 3ZYQA 5J3XA 2IDAA 3N9NA 4AVXA 4NN2A 2LN0A 4YAXA 2YQLA 1LDKC 2FSAA 2K1JA 1WGMA 2M85A 2LXPC 3FL2A 5G05B 2YW8A 2C2LA 4GB0A 3PHDA 4C9ZA 3SOWA 2LDRA 5H1VA 3MHHA 4I7DA 5TRBA 1G25A 4V3KC 1RMDA 3ZVYA 5H1TA 2VJEA 1DVPA 5DKAA 4UI9B 1K2FA 1FBVA 4I7BA 3EB6A 4FO9A 3HTKC 5LKZA 4N4FA 1VFYA 2H0DB 5KH9A 3N9OA 5G04B 2CKLA 1WILA 3O70A 2CSZA 3ASLA 4WZ0A 1WEPA 4A4BA 2RI7A 1WEWA 2VJFA 2OXQC 2RSDA 4WA6A 2KIZA 1LDJB 2MNZA 3N9PA 5I3LA 1JM7A 2XB1A 5H1UA 3LRQA 4UP5A 4R2YA 2LQ6A 2LGGA 3M62A 2KWNA 4YABA 4BHWA 2EODA 1HYIA 5B76A 4AP4A 2MA5A 4FJCA 3QZVA 2JMIA 2YSJA 4YC9A 4P5OB 2MD8C 4QF2A 2VPDA 3N9QA 3KQIA 2HYED 5LKTA 4V3LC 1X4UA 3T7LA 1X4JA 4O64A 4A49A 5DINA 2K16A 4GNEA 2L43A 2K17A 5C11A 4XI1A 2YT5A 4LADB 2CSYA 2KGGA 1WEVA 2QIZA 2ECNA 1XWHA 3SOUA 3DPLR 2LV9A 2G45A 2ECWA 4GNFA 3L11A 4WZ3B 1Z6UA 3HCSA 3ZVZB 2KE1A 5B75A 5LKXA 3ZPVE 5TDRA 2C2VS 2JMDA 4YATA 4L58A 2L75A 1ZBDB 1Z60A 2VPBA 2LGLA 4PTBA 2QJ0A 2YHOA 4MSXA 2D8SA 2M6MA 3L1ZB 2KU3A 1WEUA 4AYCA 5FEYA 5AITA 3SHBA 2L80A 1N87A 2AN6A 4GNDA 1WIMA 2YQMA 3O36A 4ZDTA 4B86C 4IC3A 4LJNA 5FERA 2DX8A 3O37A 3U5MA 3VK6A 2VJEB 1WEEA 3EB5A 5LKUA 1VYXA 2QICA 1F62A 1Z2QA 1MM2A 3HCTA 2CKLB 2ECVA 2EGPA 3O34A 1WE9A 2EA6A 2VJFB 3L1XA 2LGKA 5FB1A 2JRJA 2L0BA 4TKPB 4F52B 5TBNA 3ZNIA 2MNYA 1JM7B 4MVTA 2YUCA 5G0FA 3IHPA 2KFTA 5EYAF 3DQVR 4BBQA 2MD7B 2YU4A 3RTRB 4S3OC 4L7XA 2VNFA 5KH7A 1E4UA 4W4UA 5TDWA 4FIPA 2KYUA 3U5NA 4CA1A 4GNGA 2G6QA 2I50A 2ECGA 1WESA 5TABA 1JOCA 3LQJA 2F6NA 2BAYA 3ZPV1 5D1MB 2PUYA 5D1KB 1U6GB 2KREA 2MT5A 1WENA 3PUQA 3KNVA 2KGIA 2CT2A 2LXHC 4FK5A 2LRIC 2YHNA 1WEMA 1X4IA 2KR4A 4A4CA 4PPEA 2M1RA 3LQHA 3C5KA 3SOXA 5B77A 3NG2A 4N3WA 3ZTGA 2YREA 2MIQA 5B79A 3M63A 2E6SA 1BORA 4S3OB 2ECTA 4CCGX 3M99A 2UZGA 2LGVA 2K4DA 1IYMA 4UP0A 3PURA 5B8DA 2YYRA 3HCUA 2JMJA 3GV4A 2H0DA 4LKAA 4I7CA 4AYCB 1WEQA 5C13A 2PNXA 1WFKA 3O7AA 3V43A 3RPGC 5B78A 1CHCA 3U5OA 3KV6A 4YBMA 4B7YC 4R8PK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAD A;  4R7E A;  5LCW B;  3U5P A;  4WZ2 A;  2YUR A;  4LK9 A;  2XEU A;  2Y1N A;  2G43 A;  1FP0 A;  2ZET C;  2KWJ A;  5AIU A;  2FUI A;  5KH3 A;  3LQI A;  2M3H A;  4IC2 A;  4YBT A;  4A0C D;  3MHS A;  2MA6 A;  3N9L A;  3KV5 A;  2Y1M A;  2HDP A;  4LLB A;  1HYJ A;  5D1L B;  3O33 A;  2F6J A;  2ECJ A;  5JG6 A;  2FUU A;  3N9M A;  3T6R A;  1MM3 A;  2L5U A;  2NAA A;  3RPG B;  4Q6F A;  4YBS A;  2E6R A;  1WEO A;  3GL6 A;  4AUQ B;  3O35 A;  2VPG A;  4X3G A;  5FB0 A;  4QF3 A;  3I2D A;  1V87 A;  2KWK A;  2KWO A;  2YSM A;  1VD4 A;  2ECI A;  2F42 A;  2MUM A;  2Y43 A;  4ZQL A;  5H9M A;  3C6W A;  4ZUX U;  2VP7 A;  2VPE A;  1T1H A;  3ZYQ A;  5J3X A;  2IDA A;  3N9N A;  4AVX A;  4NN2 A;  2LN0 A;  4YAX A;  2YQL A;  1LDK C;  2FSA A;  2K1J A;  1WGM A;  2M85 A;  2LXP C;  3FL2 A;  5G05 B;  2YW8 A;  2C2L A;  4GB0 A;  3PHD A;  4C9Z A;  3SOW A;  2LDR A;  5H1V A;  3MHH A;  4I7D A;  5TRB A;  1G25 A;  4V3K C;  1RMD A;  3ZVY A;  5H1T A;  2VJE A;  1DVP A;  5DKA A;  4UI9 B;  1K2F A;  1FBV A;  4I7B A;  3EB6 A;  4FO9 A;  3HTK C;  5LKZ A;  4N4F A;  1VFY A;  2H0D B;  5KH9 A;  3N9O A;  5G04 B;  2CKL A;  1WIL A;  3O70 A;  2CSZ A;  3ASL A;  4WZ0 A;  1WEP A;  4A4B A;  2RI7 A;  1WEW A;  2VJF A;  2OXQ C;  2RSD A;  4WA6 A;  2KIZ A;  1LDJ B;  2MNZ A;  3N9P A;  5I3L A;  1JM7 A;  2XB1 A;  5H1U A;  3LRQ A;  4UP5 A;  4R2Y A;  2LQ6 A;  2LGG A;  3M62 A;  2KWN A;  4YAB A;  4BHW A;  2EOD A;  1HYI A;  5B76 A;  4AP4 A;  2MA5 A;  4FJC A;  3QZV A;  2JMI A;  2YSJ A;  4YC9 A;  4P5O B;  2MD8 C;  4QF2 A;  2VPD A;  3N9Q A;  3KQI A;  2HYE D;  5LKT A;  4V3L C;  1X4U A;  3T7L A;  1X4J A;  4O64 A;  4A49 A;  5DIN A;  2K16 A;  4GNE A;  2L43 A;  2K17 A;  5C11 A;  4XI1 A;  2YT5 A;  4LAD B;  2CSY A;  2KGG A;  1WEV A;  2QIZ A;  2ECN A;  1XWH A;  3SOU A;  3DPL R;  2LV9 A;  2G45 A;  2ECW A;  4GNF A;  3L11 A;  4WZ3 B;  1Z6U A;  3HCS A;  3ZVZ B;  2KE1 A;  5B75 A;  5LKX A;  3ZPV E;  5TDR A;  2C2V S;  2JMD A;  4YAT A;  4L58 A;  2L75 A;  1ZBD B;  1Z60 A;  2VPB A;  2LGL A;  4PTB A;  2QJ0 A;  2YHO A;  4MSX A;  2D8S A;  2M6M A;  3L1Z B;  2KU3 A;  1WEU A;  4AYC A;  5FEY A;  5AIT A;  3SHB A;  2L80 A;  1N87 A;  2AN6 A;  4GND A;  1WIM A;  2YQM A;  3O36 A;  4ZDT A;  4B86 C;  4IC3 A;  4LJN A;  5FER A;  2DX8 A;  3O37 A;  3U5M A;  3VK6 A;  2VJE B;  1WEE A;  3EB5 A;  5LKU A;  1VYX A;  2QIC A;  1F62 A;  1Z2Q A;  1MM2 A;  3HCT A;  2CKL B;  2ECV A;  2EGP A;  3O34 A;  1WE9 A;  2EA6 A;  2VJF B;  3L1X A;  2LGK A;  5FB1 A;  2JRJ A;  2L0B A;  4TKP B;  4F52 B;  5TBN A;  3ZNI A;  2MNY A;  1JM7 B;  4MVT A;  2YUC A;  5G0F A;  3IHP A;  2KFT A;  5EYA F;  3DQV R;  4BBQ A;  2MD7 B;  2YU4 A;  3RTR B;  4S3O C;  4L7X A;  2VNF A;  5KH7 A;  1E4U A;  4W4U A;  5TDW A;  4FIP A;  2KYU A;  3U5N A;  4CA1 A;  4GNG A;  2G6Q A;  2I50 A;  2ECG A;  1WES A;  5TAB A;  1JOC A;  3LQJ A;  2F6N A;  2BAY A;  3ZPV 1;  5D1M B;  2PUY A;  5D1K B;  1U6G B;  2KRE A;  2MT5 A;  1WEN A;  3PUQ A;  3KNV A;  2KGI A;  2CT2 A;  2LXH C;  4FK5 A;  2LRI C;  2YHN A;  1WEM A;  1X4I A;  2KR4 A;  4A4C A;  4PPE A;  2M1R A;  3LQH A;  3C5K A;  3SOX A;  5B77 A;  3NG2 A;  4N3W A;  3ZTG A;  2YRE A;  2MIQ A;  5B79 A;  3M63 A;  2E6S A;  1BOR A;  4S3O B;  2ECT A;  4CCG X;  3M99 A;  2UZG A;  2LGV A;  2K4D A;  1IYM A;  4UP0 A;  3PUR A;  5B8D A;  2YYR A;  3HCU A;  2JMJ A;  3GV4 A;  2H0D A;  4LKA A;  4I7C A;  4AYC B;  1WEQ A;  5C13 A;  2PNX A;  1WFK A;  3O7A A;  3V43 A;  3RPG C;  5B78 A;  1CHC A;  3U5O A;  3KV6 A;  4YBM A;  4B7Y C;  4R8P K; 
#chains in the Genus database with same CATH topology
 2DJA A;  4YAD A;  4R7E A;  3H7H A;  5LCW B;  3U5P A;  4WZ2 A;  2YUR A;  4LK9 A;  2XEU A;  2Y1N A;  2G43 A;  2DSM A;  1FP0 A;  4Z0R A;  2ZET C;  3T9K A;  2KWJ A;  5AIU A;  2B0O E;  2FUI A;  5KH3 A;  3LQI A;  2M3H A;  4IC2 A;  4YBT A;  4A0C D;  5SVX A;  3MHS A;  2MA6 A;  2XOZ A;  3N9L A;  3KV5 A;  2Y1M A;  2HDP A;  4LLB A;  1HYJ A;  5D1L B;  3O33 A;  2F6J A;  2ECJ A;  5JG6 A;  2FUU A;  3N9M A;  3O47 A;  3T6R A;  1MM3 A;  2L5U A;  2NAA A;  3RPG B;  4Q6F A;  4YBS A;  2E6R A;  1WEO A;  3GL6 A;  4AUQ B;  3O35 A;  2VPG A;  4X3G A;  5FB0 A;  4QF3 A;  3I2D A;  3M7K A;  2CRR A;  2L7P A;  1V87 A;  3Q1D A;  3E2D A;  2KWK A;  2KWO A;  2YSM A;  2EGM A;  1VD4 A;  2ECI A;  2F42 A;  2MUM A;  2Y43 A;  4ZQL A;  2CON A;  5H9M A;  4QQ4 A;  3C6W A;  4ZUX U;  2VP7 A;  2VPE A;  1T1H A;  3ZYQ A;  5J3X A;  2IDA A;  3N9N A;  4AVX A;  4NN2 A;  2LN0 A;  4YAX A;  2YQL A;  1LDK C;  5SVY A;  2FSA A;  2K1J A;  1WGM A;  2M85 A;  2M13 A;  2LXP C;  2LAU A;  3FL2 A;  5G05 B;  2YW8 A;  2C2L A;  4GB0 A;  2XOY A;  4F1P A;  3PHD A;  4C9Z A;  3SOW A;  5K3Q A;  2LDR A;  5H1V A;  3MHH A;  4I7D A;  5TRB A;  1G25 A;  4V3K C;  1RMD A;  3ZVY A;  5H1T A;  2VJE A;  1DVP A;  5DKA A;  4UI9 B;  1K2F A;  1FBV A;  4I7B A;  3EB6 A;  4FO9 A;  3HTK C;  5LKZ A;  4N4F A;  1VFY A;  2H0D B;  5KH9 A;  3N9O A;  5G04 B;  4H9D A;  2CKL A;  1WIL A;  3O70 A;  2CSZ A;  3ASL A;  4WZ0 A;  4Z0O A;  3FM8 C;  1WEP A;  2JM3 A;  4A4B A;  2RI7 A;  1WEW A;  2VJF A;  3PLW A;  2OXQ C;  2RSD A;  3FEH A;  4WA6 A;  2D8U A;  2KIZ A;  1LDJ B;  2MNZ A;  3N9P A;  5I3L A;  1JM7 A;  2XB1 A;  5H1U A;  2KKY A;  3LRQ A;  2FFW A;  4UP5 A;  4R2Y A;  4OGC A;  2LQ6 A;  2LGG A;  3M62 A;  4O62 A;  2KWN A;  2KKX A;  4YAB A;  4BHW A;  2EOD A;  1HYI A;  5B76 A;  4AP4 A;  1DCQ A;  2MA5 A;  4FJC A;  3QZV A;  2JUN A;  2JMI A;  2YSJ A;  3FAO A;  4YC9 A;  4P5O B;  2MD8 C;  4QF2 A;  2VPD A;  3N9Q A;  3KQI A;  2HYE D;  5LKT A;  3MDB C;  4V3L C;  1X4U A;  3T7L A;  1X4J A;  4O64 A;  4A49 A;  5DIN A;  2K16 A;  4GNE A;  2L43 A;  2K17 A;  5C11 A;  4XI1 A;  2YT5 A;  4LAD B;  2E61 A;  2CSY A;  2KGG A;  1WEV A;  2QIZ A;  2ECN A;  1XWH A;  3SOU A;  3DPL R;  2OWA A;  2LV9 A;  2G45 A;  2ECW A;  4GNF A;  3L11 A;  4WZ3 B;  1Z6U A;  3HCS A;  3ZVZ B;  2KE1 A;  5B75 A;  5LKX A;  3ZPV E;  5TDR A;  2C2V S;  2JMD A;  4YAT A;  4L58 A;  2L75 A;  3DDT A;  1ZBD B;  3KDE C;  1Z60 A;  2VPB A;  2LGL A;  4PTB A;  2QJ0 A;  2YHO A;  4MSX A;  2D8S A;  2M6M A;  3L1Z B;  2KU3 A;  1WEU A;  4AYC A;  5FEY A;  5AIT A;  3SHB A;  2L80 A;  1N87 A;  2CSV A;  2AN6 A;  4GND A;  1WIM A;  2P57 A;  2YQM A;  3O36 A;  4ZDT A;  4B86 C;  4IC3 A;  4LJN A;  2YVR A;  5FER A;  2DX8 A;  3LJU X;  3O37 A;  3U5M A;  3VK6 A;  2VJE B;  1WEE A;  3EB5 A;  5LKU A;  3JUE A;  1VYX A;  5SVI A;  2QIC A;  1F62 A;  1Z2Q A;  3DWD A;  1MM2 A;  3HCT A;  2CKL B;  2ECV A;  2EGP A;  4OGE A;  3O34 A;  1WE9 A;  2EA6 A;  2VJF B;  3L1X A;  2LGK A;  5FB1 A;  2JRJ A;  5SVI B;  2L0B A;  4TKP B;  4F52 B;  5TBN A;  3ZNI A;  2MNY A;  2MKE A;  1JM7 B;  4MVT A;  2YUC A;  5G0F A;  3IHP A;  2KFT A;  5EYA F;  2XOC A;  3DQV R;  4BBQ A;  2MD7 B;  2YU4 A;  3RTR B;  4S3O C;  4L7X A;  2VNF A;  5KH7 A;  1E4U A;  3LVR E;  4W4U A;  5TDW A;  3SUB A;  4FIP A;  2KYU A;  3U5N A;  4CA1 A;  2EXU A;  4GNG A;  2G6Q A;  2I50 A;  2ECG A;  1WES A;  5TAB A;  1JOC A;  3LQJ A;  2IQJ A;  2F6N A;  2BAY A;  3ZPV 1;  5D1M B;  1MBM A;  2PUY A;  5D1K B;  1U6G B;  2KRE A;  2MT5 A;  1WEN A;  3PUQ A;  3KNV A;  2KGI A;  2CT2 A;  2LXH C;  4FK5 A;  3FAN A;  2LRI C;  2YHN A;  1WEM A;  1X4I A;  2KR4 A;  4A4C A;  4PPE A;  2M1R A;  2RR4 A;  3LQH A;  3C5K A;  3SOX A;  5B77 A;  3NG2 A;  4N3W A;  3ZTG A;  2YRE A;  2MIQ A;  5B79 A;  3M63 A;  3FJU B;  2E6S A;  1BOR A;  4S3O B;  2ECT A;  4CCG X;  3LVQ E;  3M99 A;  2CRW A;  2UZG A;  2LGV A;  2K4D A;  1IYM A;  4UP0 A;  3PUR A;  5B8D A;  2YYR A;  3HCU A;  3LDY A;  2JMJ A;  3GV4 A;  2FD4 A;  2H0D A;  4LKA A;  2XP0 A;  4I7C A;  4AYC B;  1WEQ A;  5C13 A;  2PNX A;  1WFK A;  3O7A A;  3V43 A;  3RPG C;  5B78 A;  1CHC A;  3U5O A;  3KV6 A;  4YBM A;  4B7Y C;  4R8P K; 
#chains in the Genus database with same CATH homology
 4YAD A;  4R7E A;  5LCW B;  3U5P A;  4WZ2 A;  2YUR A;  4LK9 A;  2XEU A;  2Y1N A;  2G43 A;  1FP0 A;  2ZET C;  2KWJ A;  5AIU A;  2FUI A;  5KH3 A;  3LQI A;  2M3H A;  4IC2 A;  4YBT A;  4A0C D;  3MHS A;  2MA6 A;  3N9L A;  3KV5 A;  2Y1M A;  2HDP A;  4LLB A;  1HYJ A;  5D1L B;  3O33 A;  2F6J A;  2ECJ A;  5JG6 A;  2FUU A;  3N9M A;  3T6R A;  1MM3 A;  2L5U A;  2NAA A;  3RPG B;  4Q6F A;  4YBS A;  2E6R A;  1WEO A;  3GL6 A;  4AUQ B;  3O35 A;  2VPG A;  4X3G A;  5FB0 A;  4QF3 A;  3I2D A;  1V87 A;  2KWK A;  2KWO A;  2YSM A;  1VD4 A;  2ECI A;  2F42 A;  2MUM A;  2Y43 A;  4ZQL A;  5H9M A;  3C6W A;  4ZUX U;  2VP7 A;  2VPE A;  1T1H A;  3ZYQ A;  5J3X A;  2IDA A;  3N9N A;  4AVX A;  4NN2 A;  2LN0 A;  4YAX A;  2YQL A;  1LDK C;  2FSA A;  2K1J A;  1WGM A;  2M85 A;  2LXP C;  3FL2 A;  5G05 B;  2YW8 A;  2C2L A;  4GB0 A;  3PHD A;  4C9Z A;  3SOW A;  2LDR A;  5H1V A;  3MHH A;  4I7D A;  5TRB A;  1G25 A;  4V3K C;  1RMD A;  3ZVY A;  5H1T A;  2VJE A;  1DVP A;  5DKA A;  4UI9 B;  1K2F A;  1FBV A;  4I7B A;  3EB6 A;  4FO9 A;  3HTK C;  5LKZ A;  4N4F A;  1VFY A;  2H0D B;  5KH9 A;  3N9O A;  5G04 B;  2CKL A;  1WIL A;  3O70 A;  2CSZ A;  3ASL A;  4WZ0 A;  1WEP A;  4A4B A;  2RI7 A;  1WEW A;  2VJF A;  2OXQ C;  2RSD A;  4WA6 A;  2KIZ A;  1LDJ B;  2MNZ A;  3N9P A;  5I3L A;  1JM7 A;  2XB1 A;  5H1U A;  3LRQ A;  4UP5 A;  4R2Y A;  2LQ6 A;  2LGG A;  3M62 A;  2KWN A;  4YAB A;  4BHW A;  2EOD A;  1HYI A;  5B76 A;  4AP4 A;  2MA5 A;  4FJC A;  3QZV A;  2JMI A;  2YSJ A;  4YC9 A;  4P5O B;  2MD8 C;  4QF2 A;  2VPD A;  3N9Q A;  3KQI A;  2HYE D;  5LKT A;  4V3L C;  1X4U A;  3T7L A;  1X4J A;  4O64 A;  4A49 A;  5DIN A;  2K16 A;  4GNE A;  2L43 A;  2K17 A;  5C11 A;  4XI1 A;  2YT5 A;  4LAD B;  2CSY A;  2KGG A;  1WEV A;  2QIZ A;  2ECN A;  1XWH A;  3SOU A;  3DPL R;  2LV9 A;  2G45 A;  2ECW A;  4GNF A;  3L11 A;  4WZ3 B;  1Z6U A;  3HCS A;  3ZVZ B;  2KE1 A;  5B75 A;  5LKX A;  3ZPV E;  5TDR A;  2C2V S;  2JMD A;  4YAT A;  4L58 A;  2L75 A;  1ZBD B;  1Z60 A;  2VPB A;  2LGL A;  4PTB A;  2QJ0 A;  2YHO A;  4MSX A;  2D8S A;  2M6M A;  3L1Z B;  2KU3 A;  1WEU A;  4AYC A;  5FEY A;  5AIT A;  3SHB A;  2L80 A;  1N87 A;  2AN6 A;  4GND A;  1WIM A;  2YQM A;  3O36 A;  4ZDT A;  4B86 C;  4IC3 A;  4LJN A;  5FER A;  2DX8 A;  3O37 A;  3U5M A;  3VK6 A;  2VJE B;  1WEE A;  3EB5 A;  5LKU A;  1VYX A;  2QIC A;  1F62 A;  1Z2Q A;  1MM2 A;  3HCT A;  2CKL B;  2ECV A;  2EGP A;  3O34 A;  1WE9 A;  2EA6 A;  2VJF B;  3L1X A;  2LGK A;  5FB1 A;  2JRJ A;  2L0B A;  4TKP B;  4F52 B;  5TBN A;  3ZNI A;  2MNY A;  1JM7 B;  4MVT A;  2YUC A;  5G0F A;  3IHP A;  2KFT A;  5EYA F;  3DQV R;  4BBQ A;  2MD7 B;  2YU4 A;  3RTR B;  4S3O C;  4L7X A;  2VNF A;  5KH7 A;  1E4U A;  4W4U A;  5TDW A;  4FIP A;  2KYU A;  3U5N A;  4CA1 A;  4GNG A;  2G6Q A;  2I50 A;  2ECG A;  1WES A;  5TAB A;  1JOC A;  3LQJ A;  2F6N A;  2BAY A;  3ZPV 1;  5D1M B;  2PUY A;  5D1K B;  1U6G B;  2KRE A;  2MT5 A;  1WEN A;  3PUQ A;  3KNV A;  2KGI A;  2CT2 A;  2LXH C;  4FK5 A;  2LRI C;  2YHN A;  1WEM A;  1X4I A;  2KR4 A;  4A4C A;  4PPE A;  2M1R A;  3LQH A;  3C5K A;  3SOX A;  5B77 A;  3NG2 A;  4N3W A;  3ZTG A;  2YRE A;  2MIQ A;  5B79 A;  3M63 A;  2E6S A;  1BOR A;  4S3O B;  2ECT A;  4CCG X;  3M99 A;  2UZG A;  2LGV A;  2K4D A;  1IYM A;  4UP0 A;  3PUR A;  5B8D A;  2YYR A;  3HCU A;  2JMJ A;  3GV4 A;  2H0D A;  4LKA A;  4I7C A;  4AYC B;  1WEQ A;  5C13 A;  2PNX A;  1WFK A;  3O7A A;  3V43 A;  3RPG C;  5B78 A;  1CHC A;  3U5O A;  3KV6 A;  4YBM A;  4B7Y C;  4R8P K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...