2KGIA

Solution structure of jarid1a c-terminal phd finger in complex with h3(1-9)k4me3
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Histone demethylase JARID1A
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 1.14.11.-:
pdb deposition date 2009-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kgiA00
2VNFA 2ECIA 3GV4A 1WFKA 3RTRB 5FERA 4NN2A 1ZBDB 2EODA 3V43A 3ZVYA 4FK5A 5AITA 4GNDA 3LQJA 3O34A 2FSAA 3O36A 4GNEA 3KV6A 2L43A 1IYMA 5EYAF 2L5UA 2YSJA 4L7XA 2LV9A 3SOUA 4W4UA 3HTKC 5B75A 4A0CD 3U5OA 4AUQB 3LQHA 1V87A 1G25A 1WENA 2ECVA 2ECJA 5B8DA 1X4JA 2ZETC 2KR4A 4S3OB 3EB5A 3ASLA 1WEMA 4GB0A 4C9ZA 2BAYA 3O35A 2L80A 3PUQA 3VK6A 5TRBA 2LGVA 2ECWA 4PPEA 2JRJA 3RPGB 4X3GA 2VPGA 1HYJA 2E6RA 3U5MA 5H1TA 4LADB 4YATA 3M62A 5B77A 2KWKA 2YHNA 2LN0A 3SHBA 2EGPA 3IHPA 2CKLB 3ZPV1 4GNFA 1VYXA 1VFYA 3C5KA 2MIQA 2VJEA 1VD4A 2YW8A 4BHWA 5AIUA 3N9QA 1X4UA 2KYUA 3N9PA 3ZVZB 1HYIA 3HCSA 4A4BA 2KWNA 2M6MA 4FJCA 4S3OC 2VJFB 5FEYA 2C2LA 2MNZA 2LRIC 4UI9B 4ZUXU 2AN6A 4AVXA 2F6NA 2CSYA 4QF3A 1E4UA 2MNYA 3U5PA 4FIPA 2H0DB 2L0BA 5H9MA 3ZNIA 4N3WA 3RPGC 4UP0A 1WE9A 2YHOA 2G45A 2QIZA 2MA6A 2YQLA 1MM2A 4N4FA 2LQ6A 2LXHC 1JM7A 5LCWB 2YQMA 2MD7B 4WZ0A 3ZPVE 5FB0A 4A49A 1RMDA 5H1UA 2C2VS 4ZDTA 1FBVA 2MT5A 4YBTA 2YT5A 4CCGX 2HYED 3DQVR 4XI1A 1WILA 2VJFA 2VJEB 5LKZA 2YREA 1Z2QA 3MHSA 2LGLA 2LDRA 2M1RA 1XWHA 2Y1NA 5D1KB 3HCTA 5H1VA 1CHCA 5TBNA 5KH7A 3QZVA 3SOWA 5TDRA 2F42A 2RI7A 5G04B 3HCUA 3U5NA 3SOXA 2F6JA 4Q6FA 4AP4A 4B86C 3GL6A 4BBQA 4LLBA 3EB6A 2E6SA 2IDAA 5B76A 5G0FA 2KIZA 2VP7A 4B7YC 1LDKC 2LGKA 3NG2A 3O7AA 2YYRA 1F62A 2RSDA 2K16A 4YC9A 2MD8C 5C13A 4LK9A 2KE1A 2OXQC 2Y1MA 4F52B 3KV5A 2YURA 4I7CA 1Z6UA 2MUMA 4LJNA 4A4CA 3N9OA 3MHHA 1WEOA 2G6QA 1WEEA 3L11A 1Z60A 4WZ2A 5LKXA 2JMIA 2KFTA 2M3HA 1X4IA 4PTBA 2LGGA 4IC2A 5KH3A 3O70A 3T6RA 4L58A 4WA6A 2D8SA 1K2FA 2KWOA 5JG6A 1N87A 2QICA 3M63A 4O64A 4CA1A 4GNGA 1WEPA 1WEVA 2XEUA 2H0DA 2KWJA 1WIMA 5D1LB 2JMJA 2G43A 1JM7B 5I3LA 5LKTA 2L75A 4YADA 4P5OB 2KREA 5DKAA 2QJ0A 2VPEA 4V3LC 2YU4A 2KGIA 3L1ZB 4LKAA 3KNVA 4R7EA 5D1MB 5TDWA 1WEUA 2JMDA 1FP0A 3ZYQA 2MA5A 4IC3A 2UZGA 4MVTA 2DX8A 4QF2A 1WESA 2FUUA 3N9MA 5B79A 3I2DA 2CT2A 2M85A 4YAXA 2PNXA 2YUCA 3O33A 4I7BA 5KH9A 3N9LA 4YBSA 2ECTA 2K1JA 3KQIA 1JOCA 2NAAA 2EA6A 5B78A 4AYCA 1WEQA 3PURA 4R2YA 2K4DA 5FB1A 2VPBA 4ZQLA 5C11A 5G05B 1LDJB 2LXPC 3M99A 3O37A 2KGGA 2FUIA 1DVPA 4FO9A 2CSZA 1WGMA 2ECNA 4UP5A 4I7DA 3DPLR 1BORA 1T1HA 4YABA 1U6GB 2HDPA 2PUYA 2VPDA 5TABA 5DINA 5LKUA 2K17A 4TKPB 2Y43A 3FL2A 2CKLA 3PHDA 1WEWA 2ECGA 3LRQA 3C6WA 4MSXA 3LQIA 2XB1A 4R8PK 4WZ3B 2YSMA 3N9NA 4V3KC 1MM3A 4AYCB 2KU3A 3T7LA 2I50A 3ZTGA 5J3XA 4YBMA 3L1XA
chains in the Genus database with same CATH superfamily
2VNFA 5SVIB 2ECIA 3GV4A 1WFKA 3RTRB 5FERA 4NN2A 1ZBDB 2EODA 3V43A 3ZVYA 4FK5A 5AITA 4GNDA 3LQJA 3O34A 2FSAA 2XP0A 3O36A 4GNEA 3KV6A 2L43A 1IYMA 5EYAF 2L5UA 3H7HA 2YSJA 4L7XA 2LV9A 3SOUA 4W4UA 3HTKC 5B75A 4A0CD 3U5OA 3DDTA 3DWDA 4AUQB 3LQHA 1V87A 1G25A 1WENA 2ECVA 2ECJA 5B8DA 1X4JA 2ZETC 2RR4A 2KR4A 4S3OB 3EB5A 3ASLA 1WEMA 4GB0A 4C9ZA 2BAYA 3O35A 2L80A 3PUQA 2CONA 3VK6A 5TRBA 2LGVA 2ECWA 4PPEA 2JRJA 3RPGB 4X3GA 2VPGA 4QQ4A 1HYJA 2E6RA 3U5MA 5H1TA 4LADB 4YATA 2DSMA 3M62A 5B77A 2KWKA 2YHNA 2LN0A 3SHBA 2EGPA 3IHPA 2B0OE 2CKLB 3ZPV1 4GNFA 1VYXA 3PLWA 1VFYA 3C5KA 2MIQA 2VJEA 1VD4A 2YW8A 4BHWA 5AIUA 3N9QA 1X4UA 2KYUA 3N9PA 2M13A 3ZVZB 1HYIA 3HCSA 4A4BA 2KWNA 2M6MA 4FJCA 4S3OC 2VJFB 5FEYA 2C2LA 2MNZA 4Z0RA 2D8UA 2LRIC 4UI9B 3O47A 4ZUXU 2AN6A 2OWAA 4AVXA 2JM3A 2F6NA 2CSYA 4QF3A 1E4UA 3MDBC 4H9DA 2MNYA 3U5PA 4FIPA 2H0DB 2L0BA 5H9MA 3ZNIA 4N3WA 3RPGC 4UP0A 1WE9A 2YHOA 2G45A 2QIZA 2MA6A 2YQLA 1MM2A 4N4FA 3LVRE 2LQ6A 2LXHC 1JM7A 5LCWB 2YQMA 2EGMA 2MD7B 4WZ0A 3ZPVE 5FB0A 4A49A 2CSVA 2MKEA 1RMDA 5H1UA 2C2VS 4ZDTA 1FBVA 2MT5A 4YBTA 2YT5A 4CCGX 2HYED 3DQVR 4XI1A 1WILA 3FANA 2VJFA 2VJEB 2DJAA 5LKZA 2YREA 1Z2QA 3MHSA 2LGLA 2LDRA 2M1RA 1XWHA 2Y1NA 5D1KB 3HCTA 5H1VA 1CHCA 5TBNA 5KH7A 3QZVA 3T9KA 3SOWA 5TDRA 2F42A 2RI7A 5G04B 3HCUA 3U5NA 3SOXA 2F6JA 2KKXA 4Q6FA 4AP4A 4B86C 3GL6A 3FAOA 4LLBA 4BBQA 3EB6A 2E6SA 2FD4A 2IDAA 5B76A 5G0FA 2KIZA 2VP7A 4B7YC 1LDKC 2LGKA 3NG2A 3O7AA 2YYRA 1F62A 2RSDA 2K16A 4YC9A 2MD8C 5C13A 4LK9A 2KE1A 2OXQC 2Y1MA 1DCQA 4F52B 2CRRA 3KV5A 2YURA 4I7CA 1Z6UA 2MUMA 4LJNA 3FM8C 4A4CA 3JUEA 3N9OA 3MHHA 1WEOA 2G6QA 2JUNA 1WEEA 3L11A 1Z60A 4WZ2A 5LKXA 2JMIA 2KFTA 2M3HA 1X4IA 4PTBA 2LGGA 4IC2A 5KH3A 3O70A 3T6RA 4L58A 4WA6A 2D8SA 4F1PA 1K2FA 2KWOA 5JG6A 1N87A 2QICA 3Q1DA 3M63A 4O64A 3E2DA 4CA1A 4GNGA 1WEPA 1WEVA 2XEUA 2H0DA 2KWJA 3LVQE 1WIMA 5D1LB 2XOYA 2JMJA 2G43A 4Z0OA 1JM7B 5I3LA 5LKTA 2L75A 4YADA 4P5OB 2KREA 5DKAA 2QJ0A 2VPEA 4V3LC 2YU4A 2KGIA 3L1ZB 4LKAA 3KNVA 2P57A 4R7EA 2XOZA 5D1MB 5TDWA 1WEUA 2JMDA 1FP0A 2FFWA 2MA5A 3ZYQA 4IC3A 2UZGA 4MVTA 2DX8A 4QF2A 1WESA 2FUUA 3N9MA 4O62A 5SVIA 5B79A 3I2DA 2CT2A 2M85A 4YAXA 2PNXA 2YUCA 3O33A 4I7BA 5KH9A 3N9LA 4YBSA 2ECTA 2K1JA 3KQIA 1JOCA 2NAAA 2EA6A 5B78A 4AYCA 1WEQA 3PURA 4R2YA 2K4DA 5FB1A 2VPBA 4ZQLA 5C11A 5G05B 2CRWA 1LDJB 2LXPC 2KKYA 3M99A 3O37A 2KGGA 2L7PA 5K3QA 2FUIA 3LDYA 1DVPA 4FO9A 2CSZA 3FJUB 1WGMA 2ECNA 5SVYA 4UP5A 4I7DA 3DPLR 4OGEA 3SUBA 3KDEC 2LAUA 1BORA 2IQJA 3M7KA 1T1HA 4YABA 1U6GB 2HDPA 2PUYA 2VPDA 1MBMA 5TABA 5DINA 5LKUA 2K17A 4TKPB 2Y43A 2YVRA 3FL2A 2CKLA 3PHDA 1WEWA 2ECGA 3LRQA 5SVXA 3C6WA 4MSXA 3LJUX 3LQIA 3FEHA 2XB1A 4R8PK 4WZ3B 2YSMA 3N9NA 2XOCA 4V3KC 1MM3A 4AYCB 2KU3A 3T7LA 2I50A 4OGCA 3ZTGA 2E61A 5J3XA 4YBMA 2EXUA 3L1XA
chains in the Genus database with same CATH topology
2VNFA 2ECIA 3GV4A 1WFKA 3RTRB 5FERA 4NN2A 1ZBDB 2EODA 3V43A 3ZVYA 4FK5A 5AITA 4GNDA 3LQJA 3O34A 2FSAA 3O36A 4GNEA 3KV6A 2L43A 1IYMA 5EYAF 2L5UA 2YSJA 4L7XA 2LV9A 3SOUA 4W4UA 3HTKC 5B75A 4A0CD 3U5OA 4AUQB 3LQHA 1V87A 1G25A 1WENA 2ECVA 2ECJA 5B8DA 1X4JA 2ZETC 2KR4A 4S3OB 3EB5A 3ASLA 1WEMA 4GB0A 4C9ZA 2BAYA 3O35A 2L80A 3PUQA 3VK6A 5TRBA 2LGVA 2ECWA 4PPEA 2JRJA 3RPGB 4X3GA 2VPGA 1HYJA 2E6RA 3U5MA 5H1TA 4LADB 4YATA 3M62A 5B77A 2KWKA 2YHNA 2LN0A 3SHBA 2EGPA 3IHPA 2CKLB 3ZPV1 4GNFA 1VYXA 1VFYA 3C5KA 2MIQA 2VJEA 1VD4A 2YW8A 4BHWA 5AIUA 3N9QA 1X4UA 2KYUA 3N9PA 3ZVZB 1HYIA 3HCSA 4A4BA 2KWNA 2M6MA 4FJCA 4S3OC 2VJFB 5FEYA 2C2LA 2MNZA 2LRIC 4UI9B 4ZUXU 2AN6A 4AVXA 2F6NA 2CSYA 4QF3A 1E4UA 2MNYA 3U5PA 4FIPA 2H0DB 2L0BA 5H9MA 3ZNIA 4N3WA 3RPGC 4UP0A 1WE9A 2YHOA 2G45A 2QIZA 2MA6A 2YQLA 1MM2A 4N4FA 2LQ6A 2LXHC 1JM7A 5LCWB 2YQMA 2MD7B 4WZ0A 3ZPVE 5FB0A 4A49A 1RMDA 5H1UA 2C2VS 4ZDTA 1FBVA 2MT5A 4YBTA 2YT5A 4CCGX 2HYED 3DQVR 4XI1A 1WILA 2VJFA 2VJEB 5LKZA 2YREA 1Z2QA 3MHSA 2LGLA 2LDRA 2M1RA 1XWHA 2Y1NA 5D1KB 3HCTA 5H1VA 1CHCA 5TBNA 5KH7A 3QZVA 3SOWA 5TDRA 2F42A 2RI7A 5G04B 3HCUA 3U5NA 3SOXA 2F6JA 4Q6FA 4AP4A 4B86C 3GL6A 4BBQA 4LLBA 3EB6A 2E6SA 2IDAA 5B76A 5G0FA 2KIZA 2VP7A 4B7YC 1LDKC 2LGKA 3NG2A 3O7AA 2YYRA 1F62A 2RSDA 2K16A 4YC9A 2MD8C 5C13A 4LK9A 2KE1A 2OXQC 2Y1MA 4F52B 3KV5A 2YURA 4I7CA 1Z6UA 2MUMA 4LJNA 4A4CA 3N9OA 3MHHA 1WEOA 2G6QA 1WEEA 3L11A 1Z60A 4WZ2A 5LKXA 2JMIA 2KFTA 2M3HA 1X4IA 4PTBA 2LGGA 4IC2A 5KH3A 3O70A 3T6RA 4L58A 4WA6A 2D8SA 1K2FA 2KWOA 5JG6A 1N87A 2QICA 3M63A 4O64A 4CA1A 4GNGA 1WEPA 1WEVA 2XEUA 2H0DA 2KWJA 1WIMA 5D1LB 2JMJA 2G43A 1JM7B 5I3LA 5LKTA 2L75A 4YADA 4P5OB 2KREA 5DKAA 2QJ0A 2VPEA 4V3LC 2YU4A 2KGIA 3L1ZB 4LKAA 3KNVA 4R7EA 5D1MB 5TDWA 1WEUA 2JMDA 1FP0A 3ZYQA 2MA5A 4IC3A 2UZGA 4MVTA 2DX8A 4QF2A 1WESA 2FUUA 3N9MA 5B79A 3I2DA 2CT2A 2M85A 4YAXA 2PNXA 2YUCA 3O33A 4I7BA 5KH9A 3N9LA 4YBSA 2ECTA 2K1JA 3KQIA 1JOCA 2NAAA 2EA6A 5B78A 4AYCA 1WEQA 3PURA 4R2YA 2K4DA 5FB1A 2VPBA 4ZQLA 5C11A 5G05B 1LDJB 2LXPC 3M99A 3O37A 2KGGA 2FUIA 1DVPA 4FO9A 2CSZA 1WGMA 2ECNA 4UP5A 4I7DA 3DPLR 1BORA 1T1HA 4YABA 1U6GB 2HDPA 2PUYA 2VPDA 5TABA 5DINA 5LKUA 2K17A 4TKPB 2Y43A 3FL2A 2CKLA 3PHDA 1WEWA 2ECGA 3LRQA 3C6WA 4MSXA 3LQIA 2XB1A 4R8PK 4WZ3B 2YSMA 3N9NA 4V3KC 1MM3A 4AYCB 2KU3A 3T7LA 2I50A 3ZTGA 5J3XA 4YBMA 3L1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VNF A;  2ECI A;  3GV4 A;  1WFK A;  3RTR B;  5FER A;  4NN2 A;  1ZBD B;  2EOD A;  3V43 A;  3ZVY A;  4FK5 A;  5AIT A;  4GND A;  3LQJ A;  3O34 A;  2FSA A;  3O36 A;  4GNE A;  3KV6 A;  2L43 A;  1IYM A;  5EYA F;  2L5U A;  2YSJ A;  4L7X A;  2LV9 A;  3SOU A;  4W4U A;  3HTK C;  5B75 A;  4A0C D;  3U5O A;  4AUQ B;  3LQH A;  1V87 A;  1G25 A;  1WEN A;  2ECV A;  2ECJ A;  5B8D A;  1X4J A;  2ZET C;  2KR4 A;  4S3O B;  3EB5 A;  3ASL A;  1WEM A;  4GB0 A;  4C9Z A;  2BAY A;  3O35 A;  2L80 A;  3PUQ A;  3VK6 A;  5TRB A;  2LGV A;  2ECW A;  4PPE A;  2JRJ A;  3RPG B;  4X3G A;  2VPG A;  1HYJ A;  2E6R A;  3U5M A;  5H1T A;  4LAD B;  4YAT A;  3M62 A;  5B77 A;  2KWK A;  2YHN A;  2LN0 A;  3SHB A;  2EGP A;  3IHP A;  2CKL B;  3ZPV 1;  4GNF A;  1VYX A;  1VFY A;  3C5K A;  2MIQ A;  2VJE A;  1VD4 A;  2YW8 A;  4BHW A;  5AIU A;  3N9Q A;  1X4U A;  2KYU A;  3N9P A;  3ZVZ B;  1HYI A;  3HCS A;  4A4B A;  2KWN A;  2M6M A;  4FJC A;  4S3O C;  2VJF B;  5FEY A;  2C2L A;  2MNZ A;  2LRI C;  4UI9 B;  4ZUX U;  2AN6 A;  4AVX A;  2F6N A;  2CSY A;  4QF3 A;  1E4U A;  2MNY A;  3U5P A;  4FIP A;  2H0D B;  2L0B A;  5H9M A;  3ZNI A;  4N3W A;  3RPG C;  4UP0 A;  1WE9 A;  2YHO A;  2G45 A;  2QIZ A;  2MA6 A;  2YQL A;  1MM2 A;  4N4F A;  2LQ6 A;  2LXH C;  1JM7 A;  5LCW B;  2YQM A;  2MD7 B;  4WZ0 A;  3ZPV E;  5FB0 A;  4A49 A;  1RMD A;  5H1U A;  2C2V S;  4ZDT A;  1FBV A;  2MT5 A;  4YBT A;  2YT5 A;  4CCG X;  2HYE D;  3DQV R;  4XI1 A;  1WIL A;  2VJF A;  2VJE B;  5LKZ A;  2YRE A;  1Z2Q A;  3MHS A;  2LGL A;  2LDR A;  2M1R A;  1XWH A;  2Y1N A;  5D1K B;  3HCT A;  5H1V A;  1CHC A;  5TBN A;  5KH7 A;  3QZV A;  3SOW A;  5TDR A;  2F42 A;  2RI7 A;  5G04 B;  3HCU A;  3U5N A;  3SOX A;  2F6J A;  4Q6F A;  4AP4 A;  4B86 C;  3GL6 A;  4BBQ A;  4LLB A;  3EB6 A;  2E6S A;  2IDA A;  5B76 A;  5G0F A;  2KIZ A;  2VP7 A;  4B7Y C;  1LDK C;  2LGK A;  3NG2 A;  3O7A A;  2YYR A;  1F62 A;  2RSD A;  2K16 A;  4YC9 A;  2MD8 C;  5C13 A;  4LK9 A;  2KE1 A;  2OXQ C;  2Y1M A;  4F52 B;  3KV5 A;  2YUR A;  4I7C A;  1Z6U A;  2MUM A;  4LJN A;  4A4C A;  3N9O A;  3MHH A;  1WEO A;  2G6Q A;  1WEE A;  3L11 A;  1Z60 A;  4WZ2 A;  5LKX A;  2JMI A;  2KFT A;  2M3H A;  1X4I A;  4PTB A;  2LGG A;  4IC2 A;  5KH3 A;  3O70 A;  3T6R A;  4L58 A;  4WA6 A;  2D8S A;  1K2F A;  2KWO A;  5JG6 A;  1N87 A;  2QIC A;  3M63 A;  4O64 A;  4CA1 A;  4GNG A;  1WEP A;  1WEV A;  2XEU A;  2H0D A;  2KWJ A;  1WIM A;  5D1L B;  2JMJ A;  2G43 A;  1JM7 B;  5I3L A;  5LKT A;  2L75 A;  4YAD A;  4P5O B;  2KRE A;  5DKA A;  2QJ0 A;  2VPE A;  4V3L C;  2YU4 A;  2KGI A;  3L1Z B;  4LKA A;  3KNV A;  4R7E A;  5D1M B;  5TDW A;  1WEU A;  2JMD A;  1FP0 A;  3ZYQ A;  2MA5 A;  4IC3 A;  2UZG A;  4MVT A;  2DX8 A;  4QF2 A;  1WES A;  2FUU A;  3N9M A;  5B79 A;  3I2D A;  2CT2 A;  2M85 A;  4YAX A;  2PNX A;  2YUC A;  3O33 A;  4I7B A;  5KH9 A;  3N9L A;  4YBS A;  2ECT A;  2K1J A;  3KQI A;  1JOC A;  2NAA A;  2EA6 A;  5B78 A;  4AYC A;  1WEQ A;  3PUR A;  4R2Y A;  2K4D A;  5FB1 A;  2VPB A;  4ZQL A;  5C11 A;  5G05 B;  1LDJ B;  2LXP C;  3M99 A;  3O37 A;  2KGG A;  2FUI A;  1DVP A;  4FO9 A;  2CSZ A;  1WGM A;  2ECN A;  4UP5 A;  4I7D A;  3DPL R;  1BOR A;  1T1H A;  4YAB A;  1U6G B;  2HDP A;  2PUY A;  2VPD A;  5TAB A;  5DIN A;  5LKU A;  2K17 A;  4TKP B;  2Y43 A;  3FL2 A;  2CKL A;  3PHD A;  1WEW A;  2ECG A;  3LRQ A;  3C6W A;  4MSX A;  3LQI A;  2XB1 A;  4R8P K;  4WZ3 B;  2YSM A;  3N9N A;  4V3K C;  1MM3 A;  4AYC B;  2KU3 A;  3T7L A;  2I50 A;  3ZTG A;  5J3X A;  4YBM A;  3L1X A; 
#chains in the Genus database with same CATH topology
 2VNF A;  5SVI B;  2ECI A;  3GV4 A;  1WFK A;  3RTR B;  5FER A;  4NN2 A;  1ZBD B;  2EOD A;  3V43 A;  3ZVY A;  4FK5 A;  5AIT A;  4GND A;  3LQJ A;  3O34 A;  2FSA A;  2XP0 A;  3O36 A;  4GNE A;  3KV6 A;  2L43 A;  1IYM A;  5EYA F;  2L5U A;  3H7H A;  2YSJ A;  4L7X A;  2LV9 A;  3SOU A;  4W4U A;  3HTK C;  5B75 A;  4A0C D;  3U5O A;  3DDT A;  3DWD A;  4AUQ B;  3LQH A;  1V87 A;  1G25 A;  1WEN A;  2ECV A;  2ECJ A;  5B8D A;  1X4J A;  2ZET C;  2RR4 A;  2KR4 A;  4S3O B;  3EB5 A;  3ASL A;  1WEM A;  4GB0 A;  4C9Z A;  2BAY A;  3O35 A;  2L80 A;  3PUQ A;  2CON A;  3VK6 A;  5TRB A;  2LGV A;  2ECW A;  4PPE A;  2JRJ A;  3RPG B;  4X3G A;  2VPG A;  4QQ4 A;  1HYJ A;  2E6R A;  3U5M A;  5H1T A;  4LAD B;  4YAT A;  2DSM A;  3M62 A;  5B77 A;  2KWK A;  2YHN A;  2LN0 A;  3SHB A;  2EGP A;  3IHP A;  2B0O E;  2CKL B;  3ZPV 1;  4GNF A;  1VYX A;  3PLW A;  1VFY A;  3C5K A;  2MIQ A;  2VJE A;  1VD4 A;  2YW8 A;  4BHW A;  5AIU A;  3N9Q A;  1X4U A;  2KYU A;  3N9P A;  2M13 A;  3ZVZ B;  1HYI A;  3HCS A;  4A4B A;  2KWN A;  2M6M A;  4FJC A;  4S3O C;  2VJF B;  5FEY A;  2C2L A;  2MNZ A;  4Z0R A;  2D8U A;  2LRI C;  4UI9 B;  3O47 A;  4ZUX U;  2AN6 A;  2OWA A;  4AVX A;  2JM3 A;  2F6N A;  2CSY A;  4QF3 A;  1E4U A;  3MDB C;  4H9D A;  2MNY A;  3U5P A;  4FIP A;  2H0D B;  2L0B A;  5H9M A;  3ZNI A;  4N3W A;  3RPG C;  4UP0 A;  1WE9 A;  2YHO A;  2G45 A;  2QIZ A;  2MA6 A;  2YQL A;  1MM2 A;  4N4F A;  3LVR E;  2LQ6 A;  2LXH C;  1JM7 A;  5LCW B;  2YQM A;  2EGM A;  2MD7 B;  4WZ0 A;  3ZPV E;  5FB0 A;  4A49 A;  2CSV A;  2MKE A;  1RMD A;  5H1U A;  2C2V S;  4ZDT A;  1FBV A;  2MT5 A;  4YBT A;  2YT5 A;  4CCG X;  2HYE D;  3DQV R;  4XI1 A;  1WIL A;  3FAN A;  2VJF A;  2VJE B;  2DJA A;  5LKZ A;  2YRE A;  1Z2Q A;  3MHS A;  2LGL A;  2LDR A;  2M1R A;  1XWH A;  2Y1N A;  5D1K B;  3HCT A;  5H1V A;  1CHC A;  5TBN A;  5KH7 A;  3QZV A;  3T9K A;  3SOW A;  5TDR A;  2F42 A;  2RI7 A;  5G04 B;  3HCU A;  3U5N A;  3SOX A;  2F6J A;  2KKX A;  4Q6F A;  4AP4 A;  4B86 C;  3GL6 A;  3FAO A;  4LLB A;  4BBQ A;  3EB6 A;  2E6S A;  2FD4 A;  2IDA A;  5B76 A;  5G0F A;  2KIZ A;  2VP7 A;  4B7Y C;  1LDK C;  2LGK A;  3NG2 A;  3O7A A;  2YYR A;  1F62 A;  2RSD A;  2K16 A;  4YC9 A;  2MD8 C;  5C13 A;  4LK9 A;  2KE1 A;  2OXQ C;  2Y1M A;  1DCQ A;  4F52 B;  2CRR A;  3KV5 A;  2YUR A;  4I7C A;  1Z6U A;  2MUM A;  4LJN A;  3FM8 C;  4A4C A;  3JUE A;  3N9O A;  3MHH A;  1WEO A;  2G6Q A;  2JUN A;  1WEE A;  3L11 A;  1Z60 A;  4WZ2 A;  5LKX A;  2JMI A;  2KFT A;  2M3H A;  1X4I A;  4PTB A;  2LGG A;  4IC2 A;  5KH3 A;  3O70 A;  3T6R A;  4L58 A;  4WA6 A;  2D8S A;  4F1P A;  1K2F A;  2KWO A;  5JG6 A;  1N87 A;  2QIC A;  3Q1D A;  3M63 A;  4O64 A;  3E2D A;  4CA1 A;  4GNG A;  1WEP A;  1WEV A;  2XEU A;  2H0D A;  2KWJ A;  3LVQ E;  1WIM A;  5D1L B;  2XOY A;  2JMJ A;  2G43 A;  4Z0O A;  1JM7 B;  5I3L A;  5LKT A;  2L75 A;  4YAD A;  4P5O B;  2KRE A;  5DKA A;  2QJ0 A;  2VPE A;  4V3L C;  2YU4 A;  2KGI A;  3L1Z B;  4LKA A;  3KNV A;  2P57 A;  4R7E A;  2XOZ A;  5D1M B;  5TDW A;  1WEU A;  2JMD A;  1FP0 A;  2FFW A;  2MA5 A;  3ZYQ A;  4IC3 A;  2UZG A;  4MVT A;  2DX8 A;  4QF2 A;  1WES A;  2FUU A;  3N9M A;  4O62 A;  5SVI A;  5B79 A;  3I2D A;  2CT2 A;  2M85 A;  4YAX A;  2PNX A;  2YUC A;  3O33 A;  4I7B A;  5KH9 A;  3N9L A;  4YBS A;  2ECT A;  2K1J A;  3KQI A;  1JOC A;  2NAA A;  2EA6 A;  5B78 A;  4AYC A;  1WEQ A;  3PUR A;  4R2Y A;  2K4D A;  5FB1 A;  2VPB A;  4ZQL A;  5C11 A;  5G05 B;  2CRW A;  1LDJ B;  2LXP C;  2KKY A;  3M99 A;  3O37 A;  2KGG A;  2L7P A;  5K3Q A;  2FUI A;  3LDY A;  1DVP A;  4FO9 A;  2CSZ A;  3FJU B;  1WGM A;  2ECN A;  5SVY A;  4UP5 A;  4I7D A;  3DPL R;  4OGE A;  3SUB A;  3KDE C;  2LAU A;  1BOR A;  2IQJ A;  3M7K A;  1T1H A;  4YAB A;  1U6G B;  2HDP A;  2PUY A;  2VPD A;  1MBM A;  5TAB A;  5DIN A;  5LKU A;  2K17 A;  4TKP B;  2Y43 A;  2YVR A;  3FL2 A;  2CKL A;  3PHD A;  1WEW A;  2ECG A;  3LRQ A;  5SVX A;  3C6W A;  4MSX A;  3LJU X;  3LQI A;  3FEH A;  2XB1 A;  4R8P K;  4WZ3 B;  2YSM A;  3N9N A;  2XOC A;  4V3K C;  1MM3 A;  4AYC B;  2KU3 A;  3T7L A;  2I50 A;  4OGC A;  3ZTG A;  2E61 A;  5J3X A;  4YBM A;  2EXU A;  3L1X A; 
#chains in the Genus database with same CATH homology
 2VNF A;  2ECI A;  3GV4 A;  1WFK A;  3RTR B;  5FER A;  4NN2 A;  1ZBD B;  2EOD A;  3V43 A;  3ZVY A;  4FK5 A;  5AIT A;  4GND A;  3LQJ A;  3O34 A;  2FSA A;  3O36 A;  4GNE A;  3KV6 A;  2L43 A;  1IYM A;  5EYA F;  2L5U A;  2YSJ A;  4L7X A;  2LV9 A;  3SOU A;  4W4U A;  3HTK C;  5B75 A;  4A0C D;  3U5O A;  4AUQ B;  3LQH A;  1V87 A;  1G25 A;  1WEN A;  2ECV A;  2ECJ A;  5B8D A;  1X4J A;  2ZET C;  2KR4 A;  4S3O B;  3EB5 A;  3ASL A;  1WEM A;  4GB0 A;  4C9Z A;  2BAY A;  3O35 A;  2L80 A;  3PUQ A;  3VK6 A;  5TRB A;  2LGV A;  2ECW A;  4PPE A;  2JRJ A;  3RPG B;  4X3G A;  2VPG A;  1HYJ A;  2E6R A;  3U5M A;  5H1T A;  4LAD B;  4YAT A;  3M62 A;  5B77 A;  2KWK A;  2YHN A;  2LN0 A;  3SHB A;  2EGP A;  3IHP A;  2CKL B;  3ZPV 1;  4GNF A;  1VYX A;  1VFY A;  3C5K A;  2MIQ A;  2VJE A;  1VD4 A;  2YW8 A;  4BHW A;  5AIU A;  3N9Q A;  1X4U A;  2KYU A;  3N9P A;  3ZVZ B;  1HYI A;  3HCS A;  4A4B A;  2KWN A;  2M6M A;  4FJC A;  4S3O C;  2VJF B;  5FEY A;  2C2L A;  2MNZ A;  2LRI C;  4UI9 B;  4ZUX U;  2AN6 A;  4AVX A;  2F6N A;  2CSY A;  4QF3 A;  1E4U A;  2MNY A;  3U5P A;  4FIP A;  2H0D B;  2L0B A;  5H9M A;  3ZNI A;  4N3W A;  3RPG C;  4UP0 A;  1WE9 A;  2YHO A;  2G45 A;  2QIZ A;  2MA6 A;  2YQL A;  1MM2 A;  4N4F A;  2LQ6 A;  2LXH C;  1JM7 A;  5LCW B;  2YQM A;  2MD7 B;  4WZ0 A;  3ZPV E;  5FB0 A;  4A49 A;  1RMD A;  5H1U A;  2C2V S;  4ZDT A;  1FBV A;  2MT5 A;  4YBT A;  2YT5 A;  4CCG X;  2HYE D;  3DQV R;  4XI1 A;  1WIL A;  2VJF A;  2VJE B;  5LKZ A;  2YRE A;  1Z2Q A;  3MHS A;  2LGL A;  2LDR A;  2M1R A;  1XWH A;  2Y1N A;  5D1K B;  3HCT A;  5H1V A;  1CHC A;  5TBN A;  5KH7 A;  3QZV A;  3SOW A;  5TDR A;  2F42 A;  2RI7 A;  5G04 B;  3HCU A;  3U5N A;  3SOX A;  2F6J A;  4Q6F A;  4AP4 A;  4B86 C;  3GL6 A;  4BBQ A;  4LLB A;  3EB6 A;  2E6S A;  2IDA A;  5B76 A;  5G0F A;  2KIZ A;  2VP7 A;  4B7Y C;  1LDK C;  2LGK A;  3NG2 A;  3O7A A;  2YYR A;  1F62 A;  2RSD A;  2K16 A;  4YC9 A;  2MD8 C;  5C13 A;  4LK9 A;  2KE1 A;  2OXQ C;  2Y1M A;  4F52 B;  3KV5 A;  2YUR A;  4I7C A;  1Z6U A;  2MUM A;  4LJN A;  4A4C A;  3N9O A;  3MHH A;  1WEO A;  2G6Q A;  1WEE A;  3L11 A;  1Z60 A;  4WZ2 A;  5LKX A;  2JMI A;  2KFT A;  2M3H A;  1X4I A;  4PTB A;  2LGG A;  4IC2 A;  5KH3 A;  3O70 A;  3T6R A;  4L58 A;  4WA6 A;  2D8S A;  1K2F A;  2KWO A;  5JG6 A;  1N87 A;  2QIC A;  3M63 A;  4O64 A;  4CA1 A;  4GNG A;  1WEP A;  1WEV A;  2XEU A;  2H0D A;  2KWJ A;  1WIM A;  5D1L B;  2JMJ A;  2G43 A;  1JM7 B;  5I3L A;  5LKT A;  2L75 A;  4YAD A;  4P5O B;  2KRE A;  5DKA A;  2QJ0 A;  2VPE A;  4V3L C;  2YU4 A;  2KGI A;  3L1Z B;  4LKA A;  3KNV A;  4R7E A;  5D1M B;  5TDW A;  1WEU A;  2JMD A;  1FP0 A;  3ZYQ A;  2MA5 A;  4IC3 A;  2UZG A;  4MVT A;  2DX8 A;  4QF2 A;  1WES A;  2FUU A;  3N9M A;  5B79 A;  3I2D A;  2CT2 A;  2M85 A;  4YAX A;  2PNX A;  2YUC A;  3O33 A;  4I7B A;  5KH9 A;  3N9L A;  4YBS A;  2ECT A;  2K1J A;  3KQI A;  1JOC A;  2NAA A;  2EA6 A;  5B78 A;  4AYC A;  1WEQ A;  3PUR A;  4R2Y A;  2K4D A;  5FB1 A;  2VPB A;  4ZQL A;  5C11 A;  5G05 B;  1LDJ B;  2LXP C;  3M99 A;  3O37 A;  2KGG A;  2FUI A;  1DVP A;  4FO9 A;  2CSZ A;  1WGM A;  2ECN A;  4UP5 A;  4I7D A;  3DPL R;  1BOR A;  1T1H A;  4YAB A;  1U6G B;  2HDP A;  2PUY A;  2VPD A;  5TAB A;  5DIN A;  5LKU A;  2K17 A;  4TKP B;  2Y43 A;  3FL2 A;  2CKL A;  3PHD A;  1WEW A;  2ECG A;  3LRQ A;  3C6W A;  4MSX A;  3LQI A;  2XB1 A;  4R8P K;  4WZ3 B;  2YSM A;  3N9N A;  4V3K C;  1MM3 A;  4AYC B;  2KU3 A;  3T7L A;  2I50 A;  3ZTG A;  5J3X A;  4YBM A;  3L1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...