2KGIA

Solution structure of jarid1a c-terminal phd finger in complex with h3(1-9)k4me3
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone demethylase JARID1A
publication title Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 1.14.11.-:
pdb deposition date 2009-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kgiA00
2YQLA 2FSAA 3GV4A 3MHSA 5LKXA 4R2YA 4YBSA 3U5OA 2XB1A 1U6GB 4YADA 3KQIA 4C9ZA 1VFYA 4LKAA 2K16A 3ZNIA 4UP0A 3O37A 2FUIA 3KV6A 1X4UA 2YUCA 1G25A 3L1ZB 4AP4A 2CSYA 2G45A 1T1HA 2L43A 2VPEA 1Z60A 5TRBA 2HYED 4FJCA 1DVPA 5FB1A 2MIQA 2KWOA 3V43A 5AITA 5JG6A 1WEOA 4X3GA 3I2DA 2KGGA 4B86C 4W4UA 3O7AA 5H1TA 2YURA 4QF3A 1N87A 3T6RA 1X4JA 2MNZA 5FEYA 2KR4A 2VNFA 4YATA 2YHNA 4XI1A 4ZUXU 3DPLR 1JOCA 3SOUA 5KH9A 4I7BA 2MA6A 2M3HA 4N3WA 1WEQA 2MNYA 2VP7A 3HCTA 3DQVR 1WILA 2VPBA 1CHCA 3QZVA 2K1JA 4V3LC 1IYMA 2PNXA 4AYCA 1WIMA 3O34A 2VJFB 2K17A 2KYUA 4YBMA 2ECNA 4MSXA 3PHDA 2CKLA 3L11A 2LQ6A 2M6MA 2FUUA 3SHBA 3SOWA 2KREA 2ECIA 1E4UA 4PPEA 2K4DA 2YQMA 1WEPA 4ZDTA 2E6SA 3FL2A 2XEUA 2KGIA 4CCGX 3O36A 3M63A 4AYCB 1Z6UA 2YREA 2QICA 3N9MA 1JM7B 5H1VA 3ZVYA 1FP0A 3C6WA 2MT5A 3M62A 3LQJA 1ZBDB 5G0FA 2E6RA 2VJEB 2F6JA 4IC3A 3PUQA 5D1KB 4CA1A 5B78A 1XWHA 3ZTGA 2LV9A 4YABA 3RTRB 5TDRA 2L75A 4IC2A 4Q6FA 5G05B 4A4BA 3LRQA 1WE9A 2C2VS 2RSDA 2LRIC 4YC9A 3L1XA 3ZYQA 3ZVZB 1K2FA 3PURA 2QIZA 2PUYA 5EYAF 2BAYA 2F42A 4TKPB 2UZGA 3VK6A 3O33A 4GNGA 1LDKC 3LQHA 4GNFA 4WZ0A 4FIPA 2H0DB 5AIUA 5LKZA 1MM2A 5TBNA 2L80A 2OXQC 3U5NA 3MHHA 2KWJA 5KH7A 2VJFA 4MVTA 5DINA 1X4IA 2MD7B 2YW8A 1VYXA 5LCWB 2VPDA 2L5UA 3RPGB 3RPGC 4A0CD 4ZQLA 3ASLA 5B77A 2D8SA 3GL6A 2Y1MA 5B76A 4LADB 2JMDA 3EB6A 4O64A 3O70A 2Y43A 4UP5A 1BORA 5C13A 5H9MA 1JM7A 2QJ0A 5B75A 2ECVA 3HCSA 4P5OB 2I50A 5D1MB 3N9OA 4WZ3B 3M99A 4YAXA 1WEUA 2VJEA 5I3LA 3KV5A 1WENA 5LKTA 1FBVA 2EA6A 2LGVA 4GNDA 4AVXA 2YSMA 4B7YC 3ZPV1 3C5KA 4FK5A 3SOXA 4L58A 2ECTA 2G43A 3N9QA 2EGPA 4N4FA 4L7XA 5LKUA 2YSJA 5G04B 2JMJA 5J3XA 2CT2A 2LDRA 1HYJA 2H0DA 3ZPVE 2MUMA 4A4CA 5D1LB 4PTBA 2LXHC 3LQIA 1WEEA 4WA6A 1HYIA 3N9LA 5KH3A 2LXPC 3HCUA 4UI9B 5TABA 4BBQA 2ZETC 2F6NA 2YT5A 2CSZA 2YYRA 2MD8C 2IDAA 2L0BA 3HTKC 3U5MA 4A49A 2AN6A 3IHPA 1RMDA 4I7CA 2M1RA 3N9NA 3EB5A 2VPGA 3NG2A 5B8DA 2MA5A 2HDPA 2YHOA 2LGKA 3T7LA 4BHWA 4GB0A 1V87A 2JMIA 4LK9A 2ECGA 4F52B 4V3KC 1WGMA 2LGLA 1VD4A 5DKAA 2KWNA 2M85A 3U5PA 3O35A 1WEWA 4R7EA 2C2LA 2KFTA 4LLBA 4YBTA 2ECJA 5H1UA 4FO9A 1MM3A 2LN0A 4LJNA 2EODA 5B79A 4AUQB 5C11A 2ECWA 2KWKA 2Y1NA 1WESA 2YU4A 1LDJB 1WEVA 2RI7A 1WEMA 1Z2QA 4S3OB 2DX8A 4S3OC 4GNEA 4NN2A 4R8PK 1WFKA 2NAAA 2G6QA 1F62A 3N9PA 4WZ2A 3KNVA 5FB0A 4I7DA 2LGGA 2KIZA 2KU3A 2KE1A 4QF2A 5FERA 2JRJA 5TDWA 2CKLB
chains in the Genus database with same CATH superfamily
2YQLA 2FSAA 3GV4A 3MHSA 5LKXA 4R2YA 4YBSA 3U5OA 2XB1A 1U6GB 4YADA 3KQIA 4C9ZA 4QQ4A 1VFYA 4LKAA 2K16A 3ZNIA 4UP0A 3O37A 2FUIA 3KV6A 1DCQA 1X4UA 2YUCA 1G25A 3L1ZB 4AP4A 2CSYA 2D8UA 2G45A 3FEHA 1T1HA 2L43A 2VPEA 1Z60A 2E61A 5TRBA 2HYED 3MDBC 4H9DA 4FJCA 1DVPA 5FB1A 2MIQA 2KWOA 3V43A 5AITA 5JG6A 1WEOA 4X3GA 3I2DA 2KGGA 4B86C 4W4UA 3O7AA 5H1TA 3LVRE 2YURA 4QF3A 1N87A 3T6RA 3LDYA 1X4JA 2MNZA 5FEYA 2KR4A 2VNFA 4YATA 2YHNA 4XI1A 4ZUXU 3DPLR 1JOCA 3SOUA 5KH9A 4I7BA 2MA6A 2M3HA 3M7KA 4N3WA 2MKEA 1WEQA 2MNYA 3LJUX 2VP7A 5SVIB 3HCTA 3DQVR 1WILA 2VPBA 1CHCA 3QZVA 2K1JA 4V3LC 1IYMA 2PNXA 4AYCA 1WIMA 3O34A 2VJFB 2K17A 2KYUA 4YBMA 2ECNA 4MSXA 3PHDA 2CKLA 3L11A 5SVYA 2LQ6A 2M6MA 2FUUA 3SHBA 3SOWA 2KREA 2ECIA 2B0OE 2P57A 1E4UA 4PPEA 2K4DA 2YQMA 1WEPA 4ZDTA 2E6SA 3FL2A 2XEUA 2KGIA 4CCGX 3O36A 3M63A 2L7PA 3H7HA 4OGEA 4AYCB 1Z6UA 2YREA 2QICA 3LVQE 3N9MA 3E2DA 1JM7B 5H1VA 2DSMA 3ZVYA 1FP0A 3C6WA 5SVXA 2MT5A 3M62A 3LQJA 1ZBDB 5G0FA 2E6RA 2VJEB 2F6JA 4IC3A 3PUQA 5D1KB 4CA1A 5B78A 1XWHA 3ZTGA 2LV9A 4YABA 3RTRB 5TDRA 2L75A 4IC2A 4OGCA 4Q6FA 5G05B 4A4BA 3LRQA 1WE9A 2C2VS 2RSDA 2LRIC 4YC9A 3L1XA 3ZYQA 3FJUB 3ZVZB 1K2FA 3PURA 2XOCA 4Z0RA 2QIZA 2PUYA 2CRWA 5EYAF 2BAYA 2F42A 4TKPB 2UZGA 3VK6A 3O33A 4GNGA 1LDKC 3LQHA 3FAOA 4GNFA 2KKYA 3T9KA 4WZ0A 3DDTA 4FIPA 2H0DB 5AIUA 3KDEC 5LKZA 5SVIA 1MM2A 5TBNA 2L80A 2JM3A 2OXQC 2FD4A 3U5NA 3MHHA 2KWJA 5KH7A 2VJFA 4MVTA 5DINA 4Z0OA 1X4IA 2MD7B 2YW8A 1VYXA 2FFWA 5LCWB 2VPDA 2L5UA 3RPGB 3RPGC 2IQJA 4A0CD 3O47A 4ZQLA 3ASLA 5B77A 2D8SA 3GL6A 2Y1MA 5B76A 4LADB 2JMDA 3EB6A 3FANA 4O64A 3O70A 2Y43A 4UP5A 1BORA 5C13A 5H9MA 1JM7A 2RR4A 2QJ0A 5B75A 2ECVA 3HCSA 4P5OB 2I50A 5D1MB 3N9OA 4WZ3B 3M99A 4YAXA 1WEUA 2VJEA 5I3LA 3KV5A 1MBMA 1WENA 5LKTA 1FBVA 2LAUA 4O62A 2EA6A 2LGVA 4GNDA 4AVXA 2YSMA 4B7YC 3ZPV1 3C5KA 4FK5A 3SOXA 4L58A 2XOYA 2XP0A 2ECTA 2G43A 2XOZA 3N9QA 2EGPA 4N4FA 4L7XA 5LKUA 2YSJA 5G04B 2JMJA 5J3XA 2CT2A 2CSVA 2LDRA 1HYJA 2KKXA 2H0DA 3ZPVE 2MUMA 4A4CA 5D1LB 4PTBA 2LXHC 3LQIA 1WEEA 4WA6A 1HYIA 3N9LA 3FM8C 5KH3A 2LXPC 3HCUA 4UI9B 5TABA 4BBQA 2ZETC 2CONA 2F6NA 2YT5A 2CSZA 2EGMA 2YYRA 2MD8C 2IDAA 2L0BA 3HTKC 3U5MA 4A49A 2AN6A 3IHPA 1RMDA 4I7CA 2M1RA 3N9NA 3EB5A 2VPGA 3NG2A 5B8DA 2MA5A 2HDPA 2YHOA 2LGKA 3T7LA 4BHWA 4GB0A 1V87A 2JMIA 4LK9A 2ECGA 4F52B 3PLWA 4V3KC 1WGMA 2LGLA 1VD4A 5DKAA 2YVRA 2OWAA 2KWNA 2M85A 3U5PA 3O35A 1WEWA 3SUBA 4R7EA 2C2LA 2KFTA 4LLBA 4F1PA 4YBTA 2ECJA 5H1UA 4FO9A 2M13A 2CRRA 1MM3A 2LN0A 4LJNA 2EODA 5B79A 4AUQB 5C11A 2ECWA 2KWKA 2Y1NA 1WESA 3DWDA 2YU4A 1LDJB 1WEVA 2RI7A 1WEMA 1Z2QA 4S3OB 2DX8A 4S3OC 4GNEA 4NN2A 4R8PK 1WFKA 3Q1DA 2NAAA 2G6QA 1F62A 3N9PA 4WZ2A 2EXUA 3KNVA 5FB0A 4I7DA 2LGGA 2KIZA 2JUNA 5K3QA 2KU3A 2KE1A 4QF2A 2DJAA 3JUEA 5FERA 2JRJA 5TDWA 2CKLB
chains in the Genus database with same CATH topology
2YQLA 2FSAA 3GV4A 3MHSA 5LKXA 4R2YA 4YBSA 3U5OA 2XB1A 1U6GB 4YADA 3KQIA 4C9ZA 1VFYA 4LKAA 2K16A 3ZNIA 4UP0A 3O37A 2FUIA 3KV6A 1X4UA 2YUCA 1G25A 3L1ZB 4AP4A 2CSYA 2G45A 1T1HA 2L43A 2VPEA 1Z60A 5TRBA 2HYED 4FJCA 1DVPA 5FB1A 2MIQA 2KWOA 3V43A 5AITA 5JG6A 1WEOA 4X3GA 3I2DA 2KGGA 4B86C 4W4UA 3O7AA 5H1TA 2YURA 4QF3A 1N87A 3T6RA 1X4JA 2MNZA 5FEYA 2KR4A 2VNFA 4YATA 2YHNA 4XI1A 4ZUXU 3DPLR 1JOCA 3SOUA 5KH9A 4I7BA 2MA6A 2M3HA 4N3WA 1WEQA 2MNYA 2VP7A 3HCTA 3DQVR 1WILA 2VPBA 1CHCA 3QZVA 2K1JA 4V3LC 1IYMA 2PNXA 4AYCA 1WIMA 3O34A 2VJFB 2K17A 2KYUA 4YBMA 2ECNA 4MSXA 3PHDA 2CKLA 3L11A 2LQ6A 2M6MA 2FUUA 3SHBA 3SOWA 2KREA 2ECIA 1E4UA 4PPEA 2K4DA 2YQMA 1WEPA 4ZDTA 2E6SA 3FL2A 2XEUA 2KGIA 4CCGX 3O36A 3M63A 4AYCB 1Z6UA 2YREA 2QICA 3N9MA 1JM7B 5H1VA 3ZVYA 1FP0A 3C6WA 2MT5A 3M62A 3LQJA 1ZBDB 5G0FA 2E6RA 2VJEB 2F6JA 4IC3A 3PUQA 5D1KB 4CA1A 5B78A 1XWHA 3ZTGA 2LV9A 4YABA 3RTRB 5TDRA 2L75A 4IC2A 4Q6FA 5G05B 4A4BA 3LRQA 1WE9A 2C2VS 2RSDA 2LRIC 4YC9A 3L1XA 3ZYQA 3ZVZB 1K2FA 3PURA 2QIZA 2PUYA 5EYAF 2BAYA 2F42A 4TKPB 2UZGA 3VK6A 3O33A 4GNGA 1LDKC 3LQHA 4GNFA 4WZ0A 4FIPA 2H0DB 5AIUA 5LKZA 1MM2A 5TBNA 2L80A 2OXQC 3U5NA 3MHHA 2KWJA 5KH7A 2VJFA 4MVTA 5DINA 1X4IA 2MD7B 2YW8A 1VYXA 5LCWB 2VPDA 2L5UA 3RPGB 3RPGC 4A0CD 4ZQLA 3ASLA 5B77A 2D8SA 3GL6A 2Y1MA 5B76A 4LADB 2JMDA 3EB6A 4O64A 3O70A 2Y43A 4UP5A 1BORA 5C13A 5H9MA 1JM7A 2QJ0A 5B75A 2ECVA 3HCSA 4P5OB 2I50A 5D1MB 3N9OA 4WZ3B 3M99A 4YAXA 1WEUA 2VJEA 5I3LA 3KV5A 1WENA 5LKTA 1FBVA 2EA6A 2LGVA 4GNDA 4AVXA 2YSMA 4B7YC 3ZPV1 3C5KA 4FK5A 3SOXA 4L58A 2ECTA 2G43A 3N9QA 2EGPA 4N4FA 4L7XA 5LKUA 2YSJA 5G04B 2JMJA 5J3XA 2CT2A 2LDRA 1HYJA 2H0DA 3ZPVE 2MUMA 4A4CA 5D1LB 4PTBA 2LXHC 3LQIA 1WEEA 4WA6A 1HYIA 3N9LA 5KH3A 2LXPC 3HCUA 4UI9B 5TABA 4BBQA 2ZETC 2F6NA 2YT5A 2CSZA 2YYRA 2MD8C 2IDAA 2L0BA 3HTKC 3U5MA 4A49A 2AN6A 3IHPA 1RMDA 4I7CA 2M1RA 3N9NA 3EB5A 2VPGA 3NG2A 5B8DA 2MA5A 2HDPA 2YHOA 2LGKA 3T7LA 4BHWA 4GB0A 1V87A 2JMIA 4LK9A 2ECGA 4F52B 4V3KC 1WGMA 2LGLA 1VD4A 5DKAA 2KWNA 2M85A 3U5PA 3O35A 1WEWA 4R7EA 2C2LA 2KFTA 4LLBA 4YBTA 2ECJA 5H1UA 4FO9A 1MM3A 2LN0A 4LJNA 2EODA 5B79A 4AUQB 5C11A 2ECWA 2KWKA 2Y1NA 1WESA 2YU4A 1LDJB 1WEVA 2RI7A 1WEMA 1Z2QA 4S3OB 2DX8A 4S3OC 4GNEA 4NN2A 4R8PK 1WFKA 2NAAA 2G6QA 1F62A 3N9PA 4WZ2A 3KNVA 5FB0A 4I7DA 2LGGA 2KIZA 2KU3A 2KE1A 4QF2A 5FERA 2JRJA 5TDWA 2CKLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQL A;  2FSA A;  3GV4 A;  3MHS A;  5LKX A;  4R2Y A;  4YBS A;  3U5O A;  2XB1 A;  1U6G B;  4YAD A;  3KQI A;  4C9Z A;  1VFY A;  4LKA A;  2K16 A;  3ZNI A;  4UP0 A;  3O37 A;  2FUI A;  3KV6 A;  1X4U A;  2YUC A;  1G25 A;  3L1Z B;  4AP4 A;  2CSY A;  2G45 A;  1T1H A;  2L43 A;  2VPE A;  1Z60 A;  5TRB A;  2HYE D;  4FJC A;  1DVP A;  5FB1 A;  2MIQ A;  2KWO A;  3V43 A;  5AIT A;  5JG6 A;  1WEO A;  4X3G A;  3I2D A;  2KGG A;  4B86 C;  4W4U A;  3O7A A;  5H1T A;  2YUR A;  4QF3 A;  1N87 A;  3T6R A;  1X4J A;  2MNZ A;  5FEY A;  2KR4 A;  2VNF A;  4YAT A;  2YHN A;  4XI1 A;  4ZUX U;  3DPL R;  1JOC A;  3SOU A;  5KH9 A;  4I7B A;  2MA6 A;  2M3H A;  4N3W A;  1WEQ A;  2MNY A;  2VP7 A;  3HCT A;  3DQV R;  1WIL A;  2VPB A;  1CHC A;  3QZV A;  2K1J A;  4V3L C;  1IYM A;  2PNX A;  4AYC A;  1WIM A;  3O34 A;  2VJF B;  2K17 A;  2KYU A;  4YBM A;  2ECN A;  4MSX A;  3PHD A;  2CKL A;  3L11 A;  2LQ6 A;  2M6M A;  2FUU A;  3SHB A;  3SOW A;  2KRE A;  2ECI A;  1E4U A;  4PPE A;  2K4D A;  2YQM A;  1WEP A;  4ZDT A;  2E6S A;  3FL2 A;  2XEU A;  2KGI A;  4CCG X;  3O36 A;  3M63 A;  4AYC B;  1Z6U A;  2YRE A;  2QIC A;  3N9M A;  1JM7 B;  5H1V A;  3ZVY A;  1FP0 A;  3C6W A;  2MT5 A;  3M62 A;  3LQJ A;  1ZBD B;  5G0F A;  2E6R A;  2VJE B;  2F6J A;  4IC3 A;  3PUQ A;  5D1K B;  4CA1 A;  5B78 A;  1XWH A;  3ZTG A;  2LV9 A;  4YAB A;  3RTR B;  5TDR A;  2L75 A;  4IC2 A;  4Q6F A;  5G05 B;  4A4B A;  3LRQ A;  1WE9 A;  2C2V S;  2RSD A;  2LRI C;  4YC9 A;  3L1X A;  3ZYQ A;  3ZVZ B;  1K2F A;  3PUR A;  2QIZ A;  2PUY A;  5EYA F;  2BAY A;  2F42 A;  4TKP B;  2UZG A;  3VK6 A;  3O33 A;  4GNG A;  1LDK C;  3LQH A;  4GNF A;  4WZ0 A;  4FIP A;  2H0D B;  5AIU A;  5LKZ A;  1MM2 A;  5TBN A;  2L80 A;  2OXQ C;  3U5N A;  3MHH A;  2KWJ A;  5KH7 A;  2VJF A;  4MVT A;  5DIN A;  1X4I A;  2MD7 B;  2YW8 A;  1VYX A;  5LCW B;  2VPD A;  2L5U A;  3RPG B;  3RPG C;  4A0C D;  4ZQL A;  3ASL A;  5B77 A;  2D8S A;  3GL6 A;  2Y1M A;  5B76 A;  4LAD B;  2JMD A;  3EB6 A;  4O64 A;  3O70 A;  2Y43 A;  4UP5 A;  1BOR A;  5C13 A;  5H9M A;  1JM7 A;  2QJ0 A;  5B75 A;  2ECV A;  3HCS A;  4P5O B;  2I50 A;  5D1M B;  3N9O A;  4WZ3 B;  3M99 A;  4YAX A;  1WEU A;  2VJE A;  5I3L A;  3KV5 A;  1WEN A;  5LKT A;  1FBV A;  2EA6 A;  2LGV A;  4GND A;  4AVX A;  2YSM A;  4B7Y C;  3ZPV 1;  3C5K A;  4FK5 A;  3SOX A;  4L58 A;  2ECT A;  2G43 A;  3N9Q A;  2EGP A;  4N4F A;  4L7X A;  5LKU A;  2YSJ A;  5G04 B;  2JMJ A;  5J3X A;  2CT2 A;  2LDR A;  1HYJ A;  2H0D A;  3ZPV E;  2MUM A;  4A4C A;  5D1L B;  4PTB A;  2LXH C;  3LQI A;  1WEE A;  4WA6 A;  1HYI A;  3N9L A;  5KH3 A;  2LXP C;  3HCU A;  4UI9 B;  5TAB A;  4BBQ A;  2ZET C;  2F6N A;  2YT5 A;  2CSZ A;  2YYR A;  2MD8 C;  2IDA A;  2L0B A;  3HTK C;  3U5M A;  4A49 A;  2AN6 A;  3IHP A;  1RMD A;  4I7C A;  2M1R A;  3N9N A;  3EB5 A;  2VPG A;  3NG2 A;  5B8D A;  2MA5 A;  2HDP A;  2YHO A;  2LGK A;  3T7L A;  4BHW A;  4GB0 A;  1V87 A;  2JMI A;  4LK9 A;  2ECG A;  4F52 B;  4V3K C;  1WGM A;  2LGL A;  1VD4 A;  5DKA A;  2KWN A;  2M85 A;  3U5P A;  3O35 A;  1WEW A;  4R7E A;  2C2L A;  2KFT A;  4LLB A;  4YBT A;  2ECJ A;  5H1U A;  4FO9 A;  1MM3 A;  2LN0 A;  4LJN A;  2EOD A;  5B79 A;  4AUQ B;  5C11 A;  2ECW A;  2KWK A;  2Y1N A;  1WES A;  2YU4 A;  1LDJ B;  1WEV A;  2RI7 A;  1WEM A;  1Z2Q A;  4S3O B;  2DX8 A;  4S3O C;  4GNE A;  4NN2 A;  4R8P K;  1WFK A;  2NAA A;  2G6Q A;  1F62 A;  3N9P A;  4WZ2 A;  3KNV A;  5FB0 A;  4I7D A;  2LGG A;  2KIZ A;  2KU3 A;  2KE1 A;  4QF2 A;  5FER A;  2JRJ A;  5TDW A;  2CKL B; 
#chains in the Genus database with same CATH topology
 2YQL A;  2FSA A;  3GV4 A;  3MHS A;  5LKX A;  4R2Y A;  4YBS A;  3U5O A;  2XB1 A;  1U6G B;  4YAD A;  3KQI A;  4C9Z A;  4QQ4 A;  1VFY A;  4LKA A;  2K16 A;  3ZNI A;  4UP0 A;  3O37 A;  2FUI A;  3KV6 A;  1DCQ A;  1X4U A;  2YUC A;  1G25 A;  3L1Z B;  4AP4 A;  2CSY A;  2D8U A;  2G45 A;  3FEH A;  1T1H A;  2L43 A;  2VPE A;  1Z60 A;  2E61 A;  5TRB A;  2HYE D;  3MDB C;  4H9D A;  4FJC A;  1DVP A;  5FB1 A;  2MIQ A;  2KWO A;  3V43 A;  5AIT A;  5JG6 A;  1WEO A;  4X3G A;  3I2D A;  2KGG A;  4B86 C;  4W4U A;  3O7A A;  5H1T A;  3LVR E;  2YUR A;  4QF3 A;  1N87 A;  3T6R A;  3LDY A;  1X4J A;  2MNZ A;  5FEY A;  2KR4 A;  2VNF A;  4YAT A;  2YHN A;  4XI1 A;  4ZUX U;  3DPL R;  1JOC A;  3SOU A;  5KH9 A;  4I7B A;  2MA6 A;  2M3H A;  3M7K A;  4N3W A;  2MKE A;  1WEQ A;  2MNY A;  3LJU X;  2VP7 A;  5SVI B;  3HCT A;  3DQV R;  1WIL A;  2VPB A;  1CHC A;  3QZV A;  2K1J A;  4V3L C;  1IYM A;  2PNX A;  4AYC A;  1WIM A;  3O34 A;  2VJF B;  2K17 A;  2KYU A;  4YBM A;  2ECN A;  4MSX A;  3PHD A;  2CKL A;  3L11 A;  5SVY A;  2LQ6 A;  2M6M A;  2FUU A;  3SHB A;  3SOW A;  2KRE A;  2ECI A;  2B0O E;  2P57 A;  1E4U A;  4PPE A;  2K4D A;  2YQM A;  1WEP A;  4ZDT A;  2E6S A;  3FL2 A;  2XEU A;  2KGI A;  4CCG X;  3O36 A;  3M63 A;  2L7P A;  3H7H A;  4OGE A;  4AYC B;  1Z6U A;  2YRE A;  2QIC A;  3LVQ E;  3N9M A;  3E2D A;  1JM7 B;  5H1V A;  2DSM A;  3ZVY A;  1FP0 A;  3C6W A;  5SVX A;  2MT5 A;  3M62 A;  3LQJ A;  1ZBD B;  5G0F A;  2E6R A;  2VJE B;  2F6J A;  4IC3 A;  3PUQ A;  5D1K B;  4CA1 A;  5B78 A;  1XWH A;  3ZTG A;  2LV9 A;  4YAB A;  3RTR B;  5TDR A;  2L75 A;  4IC2 A;  4OGC A;  4Q6F A;  5G05 B;  4A4B A;  3LRQ A;  1WE9 A;  2C2V S;  2RSD A;  2LRI C;  4YC9 A;  3L1X A;  3ZYQ A;  3FJU B;  3ZVZ B;  1K2F A;  3PUR A;  2XOC A;  4Z0R A;  2QIZ A;  2PUY A;  2CRW A;  5EYA F;  2BAY A;  2F42 A;  4TKP B;  2UZG A;  3VK6 A;  3O33 A;  4GNG A;  1LDK C;  3LQH A;  3FAO A;  4GNF A;  2KKY A;  3T9K A;  4WZ0 A;  3DDT A;  4FIP A;  2H0D B;  5AIU A;  3KDE C;  5LKZ A;  5SVI A;  1MM2 A;  5TBN A;  2L80 A;  2JM3 A;  2OXQ C;  2FD4 A;  3U5N A;  3MHH A;  2KWJ A;  5KH7 A;  2VJF A;  4MVT A;  5DIN A;  4Z0O A;  1X4I A;  2MD7 B;  2YW8 A;  1VYX A;  2FFW A;  5LCW B;  2VPD A;  2L5U A;  3RPG B;  3RPG C;  2IQJ A;  4A0C D;  3O47 A;  4ZQL A;  3ASL A;  5B77 A;  2D8S A;  3GL6 A;  2Y1M A;  5B76 A;  4LAD B;  2JMD A;  3EB6 A;  3FAN A;  4O64 A;  3O70 A;  2Y43 A;  4UP5 A;  1BOR A;  5C13 A;  5H9M A;  1JM7 A;  2RR4 A;  2QJ0 A;  5B75 A;  2ECV A;  3HCS A;  4P5O B;  2I50 A;  5D1M B;  3N9O A;  4WZ3 B;  3M99 A;  4YAX A;  1WEU A;  2VJE A;  5I3L A;  3KV5 A;  1MBM A;  1WEN A;  5LKT A;  1FBV A;  2LAU A;  4O62 A;  2EA6 A;  2LGV A;  4GND A;  4AVX A;  2YSM A;  4B7Y C;  3ZPV 1;  3C5K A;  4FK5 A;  3SOX A;  4L58 A;  2XOY A;  2XP0 A;  2ECT A;  2G43 A;  2XOZ A;  3N9Q A;  2EGP A;  4N4F A;  4L7X A;  5LKU A;  2YSJ A;  5G04 B;  2JMJ A;  5J3X A;  2CT2 A;  2CSV A;  2LDR A;  1HYJ A;  2KKX A;  2H0D A;  3ZPV E;  2MUM A;  4A4C A;  5D1L B;  4PTB A;  2LXH C;  3LQI A;  1WEE A;  4WA6 A;  1HYI A;  3N9L A;  3FM8 C;  5KH3 A;  2LXP C;  3HCU A;  4UI9 B;  5TAB A;  4BBQ A;  2ZET C;  2CON A;  2F6N A;  2YT5 A;  2CSZ A;  2EGM A;  2YYR A;  2MD8 C;  2IDA A;  2L0B A;  3HTK C;  3U5M A;  4A49 A;  2AN6 A;  3IHP A;  1RMD A;  4I7C A;  2M1R A;  3N9N A;  3EB5 A;  2VPG A;  3NG2 A;  5B8D A;  2MA5 A;  2HDP A;  2YHO A;  2LGK A;  3T7L A;  4BHW A;  4GB0 A;  1V87 A;  2JMI A;  4LK9 A;  2ECG A;  4F52 B;  3PLW A;  4V3K C;  1WGM A;  2LGL A;  1VD4 A;  5DKA A;  2YVR A;  2OWA A;  2KWN A;  2M85 A;  3U5P A;  3O35 A;  1WEW A;  3SUB A;  4R7E A;  2C2L A;  2KFT A;  4LLB A;  4F1P A;  4YBT A;  2ECJ A;  5H1U A;  4FO9 A;  2M13 A;  2CRR A;  1MM3 A;  2LN0 A;  4LJN A;  2EOD A;  5B79 A;  4AUQ B;  5C11 A;  2ECW A;  2KWK A;  2Y1N A;  1WES A;  3DWD A;  2YU4 A;  1LDJ B;  1WEV A;  2RI7 A;  1WEM A;  1Z2Q A;  4S3O B;  2DX8 A;  4S3O C;  4GNE A;  4NN2 A;  4R8P K;  1WFK A;  3Q1D A;  2NAA A;  2G6Q A;  1F62 A;  3N9P A;  4WZ2 A;  2EXU A;  3KNV A;  5FB0 A;  4I7D A;  2LGG A;  2KIZ A;  2JUN A;  5K3Q A;  2KU3 A;  2KE1 A;  4QF2 A;  2DJA A;  3JUE A;  5FER A;  2JRJ A;  5TDW A;  2CKL B; 
#chains in the Genus database with same CATH homology
 2YQL A;  2FSA A;  3GV4 A;  3MHS A;  5LKX A;  4R2Y A;  4YBS A;  3U5O A;  2XB1 A;  1U6G B;  4YAD A;  3KQI A;  4C9Z A;  1VFY A;  4LKA A;  2K16 A;  3ZNI A;  4UP0 A;  3O37 A;  2FUI A;  3KV6 A;  1X4U A;  2YUC A;  1G25 A;  3L1Z B;  4AP4 A;  2CSY A;  2G45 A;  1T1H A;  2L43 A;  2VPE A;  1Z60 A;  5TRB A;  2HYE D;  4FJC A;  1DVP A;  5FB1 A;  2MIQ A;  2KWO A;  3V43 A;  5AIT A;  5JG6 A;  1WEO A;  4X3G A;  3I2D A;  2KGG A;  4B86 C;  4W4U A;  3O7A A;  5H1T A;  2YUR A;  4QF3 A;  1N87 A;  3T6R A;  1X4J A;  2MNZ A;  5FEY A;  2KR4 A;  2VNF A;  4YAT A;  2YHN A;  4XI1 A;  4ZUX U;  3DPL R;  1JOC A;  3SOU A;  5KH9 A;  4I7B A;  2MA6 A;  2M3H A;  4N3W A;  1WEQ A;  2MNY A;  2VP7 A;  3HCT A;  3DQV R;  1WIL A;  2VPB A;  1CHC A;  3QZV A;  2K1J A;  4V3L C;  1IYM A;  2PNX A;  4AYC A;  1WIM A;  3O34 A;  2VJF B;  2K17 A;  2KYU A;  4YBM A;  2ECN A;  4MSX A;  3PHD A;  2CKL A;  3L11 A;  2LQ6 A;  2M6M A;  2FUU A;  3SHB A;  3SOW A;  2KRE A;  2ECI A;  1E4U A;  4PPE A;  2K4D A;  2YQM A;  1WEP A;  4ZDT A;  2E6S A;  3FL2 A;  2XEU A;  2KGI A;  4CCG X;  3O36 A;  3M63 A;  4AYC B;  1Z6U A;  2YRE A;  2QIC A;  3N9M A;  1JM7 B;  5H1V A;  3ZVY A;  1FP0 A;  3C6W A;  2MT5 A;  3M62 A;  3LQJ A;  1ZBD B;  5G0F A;  2E6R A;  2VJE B;  2F6J A;  4IC3 A;  3PUQ A;  5D1K B;  4CA1 A;  5B78 A;  1XWH A;  3ZTG A;  2LV9 A;  4YAB A;  3RTR B;  5TDR A;  2L75 A;  4IC2 A;  4Q6F A;  5G05 B;  4A4B A;  3LRQ A;  1WE9 A;  2C2V S;  2RSD A;  2LRI C;  4YC9 A;  3L1X A;  3ZYQ A;  3ZVZ B;  1K2F A;  3PUR A;  2QIZ A;  2PUY A;  5EYA F;  2BAY A;  2F42 A;  4TKP B;  2UZG A;  3VK6 A;  3O33 A;  4GNG A;  1LDK C;  3LQH A;  4GNF A;  4WZ0 A;  4FIP A;  2H0D B;  5AIU A;  5LKZ A;  1MM2 A;  5TBN A;  2L80 A;  2OXQ C;  3U5N A;  3MHH A;  2KWJ A;  5KH7 A;  2VJF A;  4MVT A;  5DIN A;  1X4I A;  2MD7 B;  2YW8 A;  1VYX A;  5LCW B;  2VPD A;  2L5U A;  3RPG B;  3RPG C;  4A0C D;  4ZQL A;  3ASL A;  5B77 A;  2D8S A;  3GL6 A;  2Y1M A;  5B76 A;  4LAD B;  2JMD A;  3EB6 A;  4O64 A;  3O70 A;  2Y43 A;  4UP5 A;  1BOR A;  5C13 A;  5H9M A;  1JM7 A;  2QJ0 A;  5B75 A;  2ECV A;  3HCS A;  4P5O B;  2I50 A;  5D1M B;  3N9O A;  4WZ3 B;  3M99 A;  4YAX A;  1WEU A;  2VJE A;  5I3L A;  3KV5 A;  1WEN A;  5LKT A;  1FBV A;  2EA6 A;  2LGV A;  4GND A;  4AVX A;  2YSM A;  4B7Y C;  3ZPV 1;  3C5K A;  4FK5 A;  3SOX A;  4L58 A;  2ECT A;  2G43 A;  3N9Q A;  2EGP A;  4N4F A;  4L7X A;  5LKU A;  2YSJ A;  5G04 B;  2JMJ A;  5J3X A;  2CT2 A;  2LDR A;  1HYJ A;  2H0D A;  3ZPV E;  2MUM A;  4A4C A;  5D1L B;  4PTB A;  2LXH C;  3LQI A;  1WEE A;  4WA6 A;  1HYI A;  3N9L A;  5KH3 A;  2LXP C;  3HCU A;  4UI9 B;  5TAB A;  4BBQ A;  2ZET C;  2F6N A;  2YT5 A;  2CSZ A;  2YYR A;  2MD8 C;  2IDA A;  2L0B A;  3HTK C;  3U5M A;  4A49 A;  2AN6 A;  3IHP A;  1RMD A;  4I7C A;  2M1R A;  3N9N A;  3EB5 A;  2VPG A;  3NG2 A;  5B8D A;  2MA5 A;  2HDP A;  2YHO A;  2LGK A;  3T7L A;  4BHW A;  4GB0 A;  1V87 A;  2JMI A;  4LK9 A;  2ECG A;  4F52 B;  4V3K C;  1WGM A;  2LGL A;  1VD4 A;  5DKA A;  2KWN A;  2M85 A;  3U5P A;  3O35 A;  1WEW A;  4R7E A;  2C2L A;  2KFT A;  4LLB A;  4YBT A;  2ECJ A;  5H1U A;  4FO9 A;  1MM3 A;  2LN0 A;  4LJN A;  2EOD A;  5B79 A;  4AUQ B;  5C11 A;  2ECW A;  2KWK A;  2Y1N A;  1WES A;  2YU4 A;  1LDJ B;  1WEV A;  2RI7 A;  1WEM A;  1Z2Q A;  4S3O B;  2DX8 A;  4S3O C;  4GNE A;  4NN2 A;  4R8P K;  1WFK A;  2NAA A;  2G6Q A;  1F62 A;  3N9P A;  4WZ2 A;  3KNV A;  5FB0 A;  4I7D A;  2LGG A;  2KIZ A;  2KU3 A;  2KE1 A;  4QF2 A;  5FER A;  2JRJ A;  5TDW A;  2CKL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...