2KGIA

Solution structure of jarid1a c-terminal phd finger in complex with h3(1-9)k4me3
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Histone demethylase JARID1A
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 1.14.11.-:
pdb deposition date 2009-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kgiA00
3ASLA 3DQVR 2Y1MA 2RI7A 4LLBA 4GNFA 3L11A 3VK6A 1MM3A 5FERA 1WE9A 2Y1NA 4WZ3B 5G0FA 4Q6FA 3IHPA 2E6RA 2H0DB 4PTBA 5TDWA 2F6JA 1WEMA 5TDRA 2KR4A 4MSXA 2JMDA 4AP4A 2DX8A 1VFYA 2VJFA 3M99A 5LKXA 5TRBA 2IDAA 3N9OA 1WENA 4TKPB 2C2LA 2LRIC 1MM2A 4LK9A 4V3LC 4YADA 2YQMA 1T1HA 3KV6A 1WGMA 3MHHA 3SOWA 2YHNA 5B77A 5H1TA 4V3KC 3L1XA 1N87A 3C5KA 2K17A 2KGGA 4WA6A 5D1MB 4A0CD 2JMIA 2HDPA 2LV9A 1Z2QA 3SHBA 3I2DA 5EYAF 5D1LB 5C13A 3ZVZB 4YATA 2LN0A 3ZPVE 1WEUA 3MHSA 5C11A 3N9PA 5FEYA 3HCUA 2YURA 3RPGC 2C2VS 2RSDA 1JM7A 4B86C 5KH7A 2PNXA 3SOXA 1WIMA 5H1UA 3LQIA 3V43A 1RMDA 2FUUA 4I7CA 3U5OA 3PUQA 4LKAA 4R7EA 2YUCA 3O7AA 3HCSA 4IC2A 2KYUA 5D1KB 4NN2A 2KU3A 5AIUA 1XWHA 2PUYA 4CA1A 2K16A 3GV4A 2YT5A 2ECIA 3C6WA 1ZBDB 1E4UA 4A4CA 4GNGA 4PPEA 2YU4A 4N4FA 2LGVA 3RPGB 5LKZA 3ZNIA 2YSMA 2ECJA 4YBMA 4IC3A 2G43A 2YHOA 2E6SA 5H1VA 2KWKA 2KWOA 2MA5A 1VYXA 4QF3A 2FSAA 2D8SA 5JG6A 4WZ0A 4R8PK 4S3OC 2K1JA 2QJ0A 2Y43A 2CT2A 1HYIA 1X4UA 5TABA 4S3OB 2M85A 2EODA 1JOCA 2L43A 2XEUA 4MVTA 2VJFB 4YBTA 5KH9A 3M63A 3ZYQA 2VNFA 2MNZA 3N9NA 5LCWB 1BORA 3EB5A 1U6GB 3RTRB 4L58A 2QICA 1Z6UA 1HYJA 2LXHC 4I7BA 3O35A 3O33A 5B8DA 1Z60A 2F42A 5AITA 3SOUA 3L1ZB 2KE1A 2F6NA 2K4DA 4FIPA 4ZUXU 4BBQA 2I50A 3HTKC 4W4UA 2G45A 1F62A 3N9QA 2NAAA 2YSJA 4QF2A 2VPBA 1WEVA 4B7YC 3ZPV1 2KWNA 1WEOA 5DKAA 1K2FA 2MNYA 2FUIA 1WILA 5G05B 3ZVYA 2YQLA 2M3HA 1WFKA 1X4JA 4BHWA 5DINA 2MD8C 3U5NA 2MT5A 2KFTA 2ZETC 4XI1A 3PURA 5LKTA 5B79A 1WEEA 2MA6A 2CKLB 2EGPA 4AUQB 4P5OB 4WZ2A 3QZVA 4AYCB 4YABA 1LDJB 5H9MA 3U5MA 2QIZA 2CSZA 2VJEB 2LQ6A 2VPGA 2YREA 4GNDA 3O37A 3N9LA 4UP0A 2OXQC 4FO9A 4UP5A 2LGKA 4N3WA 3KNVA 2VP7A 5J3XA 4YBSA 4UI9B 2EA6A 5B75A 2YYRA 4AYCA 2KIZA 2VJEA 2CKLA 3ZTGA 2H0DA 2JMJA 4FJCA 2ECWA 5I3LA 1WEWA 2ECTA 2KGIA 3O34A 1X4IA 3LQJA 4I7DA 1WEQA 5FB1A 4A4BA 2L80A 2MIQA 4FK5A 3KQIA 5FB0A 1WESA 4A49A 2G6QA 2M6MA 4F52B 2AN6A 3EB6A 4C9ZA 1V87A 2KWJA 4LADB 3M62A 2LDRA 5TBNA 4R2YA 2L5UA 3N9MA 4ZQLA 4ZDTA 2LGLA 1DVPA 2LXPC 2CSYA 3LRQA 3O70A 4GNEA 5B78A 2M1RA 3LQHA 4GB0A 5LKUA 4AVXA 2ECNA 3KV5A 1JM7B 4X3GA 3O36A 4CCGX 1CHCA 1FP0A 4YAXA 5G04B 4LJNA 1LDKC 2L75A 4L7XA 2BAYA 5KH3A 3FL2A 1IYMA 3DPLR 3HCTA 2KREA 4O64A 2L0BA 2VPEA 1G25A 2ECGA 2YW8A 5B76A 1WEPA 3T7LA 2MUMA 2JRJA 2LGGA 2MD7B 3NG2A 3PHDA 1VD4A 2UZGA 3T6RA 1FBVA 3U5PA 2ECVA 2HYED 4YC9A 3GL6A 2XB1A 2VPDA
chains in the Genus database with same CATH superfamily
3ASLA 3DQVR 2Y1MA 2RI7A 3MDBC 4GNFA 3L11A 4LLBA 3VK6A 1MM3A 5FERA 1WE9A 2Y1NA 3JUEA 4WZ3B 4OGEA 5G0FA 3DDTA 4Q6FA 3IHPA 2E6RA 2H0DB 4PTBA 2JUNA 2IQJA 5TDWA 2F6JA 1WEMA 5TDRA 2KR4A 4MSXA 2JMDA 4AP4A 2DX8A 1VFYA 3H7HA 2VJFA 3M99A 3PLWA 5LKXA 5TRBA 3LDYA 2IDAA 3N9OA 1WENA 4TKPB 3LVQE 5SVIA 2C2LA 2LRIC 1MM2A 4LK9A 4V3LC 4YADA 2YQMA 1T1HA 3KV6A 1WGMA 3MHHA 3SOWA 2YHNA 5B77A 5H1TA 4V3KC 3L1XA 1N87A 3C5KA 2K17A 2KGGA 4WA6A 2YVRA 5D1MB 4A0CD 2JMIA 2HDPA 2LV9A 1Z2QA 3SHBA 3I2DA 5EYAF 5D1LB 5C13A 3ZVZB 4YATA 2LN0A 3ZPVE 1WEUA 3MHSA 5C11A 3N9PA 5FEYA 3HCUA 2YURA 3RPGC 2C2VS 2RSDA 1JM7A 4B86C 3KDEC 5KH7A 3FM8C 2PNXA 3SOXA 1WIMA 5H1UA 3LQIA 3SUBA 3V43A 1RMDA 2FUUA 4I7CA 3U5OA 2P57A 2XOCA 3PUQA 4LKAA 4R7EA 2YUCA 3FEHA 3O7AA 3HCSA 4IC2A 2KYUA 5D1KB 4NN2A 2KU3A 5AIUA 4OGCA 2EGMA 1XWHA 2PUYA 4CA1A 2K16A 2DSMA 3GV4A 2YT5A 2ECIA 3C6WA 1ZBDB 1E4UA 4A4CA 4GNGA 4PPEA 2YU4A 4N4FA 2LGVA 3RPGB 5LKZA 3ZNIA 2YSMA 2DJAA 2ECJA 4YBMA 4IC3A 2G43A 2YHOA 2E6SA 5H1VA 1DCQA 2KWKA 4Z0RA 2KWOA 2MA5A 1VYXA 4QF3A 2FSAA 2D8SA 5JG6A 4WZ0A 4R8PK 5SVYA 2RR4A 4S3OC 3LVRE 2K1JA 2QJ0A 2Y43A 2CT2A 1HYIA 2XP0A 1X4UA 5TABA 4S3OB 2M85A 2EODA 1JOCA 2L43A 2XEUA 3GL6A 2L7PA 2VJFB 4MVTA 4QQ4A 4YBTA 2CSVA 5KH9A 3M63A 3ZYQA 2VNFA 2KKXA 2MNZA 3N9NA 5LCWB 1BORA 3EB5A 5SVXA 1U6GB 3RTRB 4L58A 2QICA 1Z6UA 3T9KA 1HYJA 2LXHC 4I7BA 3O35A 3O33A 5B8DA 1Z60A 5K3QA 2F42A 5AITA 3SOUA 3L1ZB 2KE1A 2F6NA 2K4DA 4FIPA 4ZUXU 4BBQA 2I50A 2E61A 2EXUA 3HTKC 4W4UA 2G45A 1F62A 3N9QA 2NAAA 2YSJA 4QF2A 2VPBA 2LAUA 1WEVA 4B7YC 3M7KA 3ZPV1 2KWNA 1WEOA 5DKAA 1K2FA 2MNYA 2FUIA 1WILA 5G05B 3LJUX 4H9DA 3ZVYA 2YQLA 2M3HA 1WFKA 1X4JA 3E2DA 4BHWA 5DINA 2MD8C 3U5NA 2MT5A 2CONA 2KFTA 3FANA 2ZETC 4XI1A 3PURA 5LKTA 5B79A 1WEEA 2MA6A 2CKLB 2EGPA 4AUQB 4P5OB 4WZ2A 3QZVA 4AYCB 4YABA 1LDJB 5H9MA 3U5MA 2B0OE 2FD4A 2QIZA 2CSZA 2VJEB 2LQ6A 2VPGA 2YREA 4GNDA 3O37A 3N9LA 4UP0A 2OXQC 2MKEA 4FO9A 4UP5A 2KKYA 2LGKA 4N3WA 3KNVA 2VP7A 2JM3A 5J3XA 4YBSA 4UI9B 2EA6A 5B75A 2YYRA 4AYCA 2KIZA 2VJEA 3O47A 2CKLA 3ZTGA 2H0DA 2JMJA 4FJCA 2ECWA 2M13A 1WEWA 2ECTA 5I3LA 2KGIA 3O34A 1X4IA 3LQJA 4I7DA 1WEQA 2D8UA 5FB1A 2L80A 2CRRA 4A4BA 2MIQA 4FK5A 3KQIA 5FB0A 1WESA 4A49A 2FFWA 2G6QA 2M6MA 4F52B 2AN6A 3EB6A 1MBMA 4C9ZA 1V87A 2KWJA 4LADB 2XOYA 3M62A 2LDRA 5TBNA 2CRWA 4R2YA 2L5UA 3N9MA 4ZQLA 4Z0OA 4ZDTA 3FJUB 2LGLA 3Q1DA 1DVPA 2LXPC 2CSYA 3LRQA 3O70A 4GNEA 5B78A 2M1RA 3LQHA 4GB0A 5LKUA 4AVXA 3FAOA 2ECNA 3KV5A 1JM7B 4X3GA 4O62A 3O36A 3DWDA 4CCGX 4F1PA 1CHCA 1FP0A 4YAXA 5G04B 4LJNA 2L75A 4L7XA 2BAYA 5KH3A 3FL2A 1IYMA 3DPLR 3HCTA 2OWAA 2KREA 4O64A 2L0BA 2VPEA 1G25A 2ECGA 2YW8A 5B76A 1WEPA 3T7LA 2MUMA 2JRJA 2LGGA 2MD7B 3NG2A 3PHDA 1VD4A 2UZGA 3T6RA 1FBVA 2XOZA 3U5PA 2ECVA 2HYED 4YC9A 1LDKC 2XB1A 2VPDA 5SVIB
chains in the Genus database with same CATH topology
3ASLA 3DQVR 2Y1MA 2RI7A 4LLBA 4GNFA 3L11A 3VK6A 1MM3A 5FERA 1WE9A 2Y1NA 4WZ3B 5G0FA 4Q6FA 3IHPA 2E6RA 2H0DB 4PTBA 5TDWA 2F6JA 1WEMA 5TDRA 2KR4A 4MSXA 2JMDA 4AP4A 2DX8A 1VFYA 2VJFA 3M99A 5LKXA 5TRBA 2IDAA 3N9OA 1WENA 4TKPB 2C2LA 2LRIC 1MM2A 4LK9A 4V3LC 4YADA 2YQMA 1T1HA 3KV6A 1WGMA 3MHHA 3SOWA 2YHNA 5B77A 5H1TA 4V3KC 3L1XA 1N87A 3C5KA 2K17A 2KGGA 4WA6A 5D1MB 4A0CD 2JMIA 2HDPA 2LV9A 1Z2QA 3SHBA 3I2DA 5EYAF 5D1LB 5C13A 3ZVZB 4YATA 2LN0A 3ZPVE 1WEUA 3MHSA 5C11A 3N9PA 5FEYA 3HCUA 2YURA 3RPGC 2C2VS 2RSDA 1JM7A 4B86C 5KH7A 2PNXA 3SOXA 1WIMA 5H1UA 3LQIA 3V43A 1RMDA 2FUUA 4I7CA 3U5OA 3PUQA 4LKAA 4R7EA 2YUCA 3O7AA 3HCSA 4IC2A 2KYUA 5D1KB 4NN2A 2KU3A 5AIUA 1XWHA 2PUYA 4CA1A 2K16A 3GV4A 2YT5A 2ECIA 3C6WA 1ZBDB 1E4UA 4A4CA 4GNGA 4PPEA 2YU4A 4N4FA 2LGVA 3RPGB 5LKZA 3ZNIA 2YSMA 2ECJA 4YBMA 4IC3A 2G43A 2YHOA 2E6SA 5H1VA 2KWKA 2KWOA 2MA5A 1VYXA 4QF3A 2FSAA 2D8SA 5JG6A 4WZ0A 4R8PK 4S3OC 2K1JA 2QJ0A 2Y43A 2CT2A 1HYIA 1X4UA 5TABA 4S3OB 2M85A 2EODA 1JOCA 2L43A 2XEUA 4MVTA 2VJFB 4YBTA 5KH9A 3M63A 3ZYQA 2VNFA 2MNZA 3N9NA 5LCWB 1BORA 3EB5A 1U6GB 3RTRB 4L58A 2QICA 1Z6UA 1HYJA 2LXHC 4I7BA 3O35A 3O33A 5B8DA 1Z60A 2F42A 5AITA 3SOUA 3L1ZB 2KE1A 2F6NA 2K4DA 4FIPA 4ZUXU 4BBQA 2I50A 3HTKC 4W4UA 2G45A 1F62A 3N9QA 2NAAA 2YSJA 4QF2A 2VPBA 1WEVA 4B7YC 3ZPV1 2KWNA 1WEOA 5DKAA 1K2FA 2MNYA 2FUIA 1WILA 5G05B 3ZVYA 2YQLA 2M3HA 1WFKA 1X4JA 4BHWA 5DINA 2MD8C 3U5NA 2MT5A 2KFTA 2ZETC 4XI1A 3PURA 5LKTA 5B79A 1WEEA 2MA6A 2CKLB 2EGPA 4AUQB 4P5OB 4WZ2A 3QZVA 4AYCB 4YABA 1LDJB 5H9MA 3U5MA 2QIZA 2CSZA 2VJEB 2LQ6A 2VPGA 2YREA 4GNDA 3O37A 3N9LA 4UP0A 2OXQC 4FO9A 4UP5A 2LGKA 4N3WA 3KNVA 2VP7A 5J3XA 4YBSA 4UI9B 2EA6A 5B75A 2YYRA 4AYCA 2KIZA 2VJEA 2CKLA 3ZTGA 2H0DA 2JMJA 4FJCA 2ECWA 5I3LA 1WEWA 2ECTA 2KGIA 3O34A 1X4IA 3LQJA 4I7DA 1WEQA 5FB1A 4A4BA 2L80A 2MIQA 4FK5A 3KQIA 5FB0A 1WESA 4A49A 2G6QA 2M6MA 4F52B 2AN6A 3EB6A 4C9ZA 1V87A 2KWJA 4LADB 3M62A 2LDRA 5TBNA 4R2YA 2L5UA 3N9MA 4ZQLA 4ZDTA 2LGLA 1DVPA 2LXPC 2CSYA 3LRQA 3O70A 4GNEA 5B78A 2M1RA 3LQHA 4GB0A 5LKUA 4AVXA 2ECNA 3KV5A 1JM7B 4X3GA 3O36A 4CCGX 1CHCA 1FP0A 4YAXA 5G04B 4LJNA 1LDKC 2L75A 4L7XA 2BAYA 5KH3A 3FL2A 1IYMA 3DPLR 3HCTA 2KREA 4O64A 2L0BA 2VPEA 1G25A 2ECGA 2YW8A 5B76A 1WEPA 3T7LA 2MUMA 2JRJA 2LGGA 2MD7B 3NG2A 3PHDA 1VD4A 2UZGA 3T6RA 1FBVA 3U5PA 2ECVA 2HYED 4YC9A 3GL6A 2XB1A 2VPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASL A;  3DQV R;  2Y1M A;  2RI7 A;  4LLB A;  4GNF A;  3L11 A;  3VK6 A;  1MM3 A;  5FER A;  1WE9 A;  2Y1N A;  4WZ3 B;  5G0F A;  4Q6F A;  3IHP A;  2E6R A;  2H0D B;  4PTB A;  5TDW A;  2F6J A;  1WEM A;  5TDR A;  2KR4 A;  4MSX A;  2JMD A;  4AP4 A;  2DX8 A;  1VFY A;  2VJF A;  3M99 A;  5LKX A;  5TRB A;  2IDA A;  3N9O A;  1WEN A;  4TKP B;  2C2L A;  2LRI C;  1MM2 A;  4LK9 A;  4V3L C;  4YAD A;  2YQM A;  1T1H A;  3KV6 A;  1WGM A;  3MHH A;  3SOW A;  2YHN A;  5B77 A;  5H1T A;  4V3K C;  3L1X A;  1N87 A;  3C5K A;  2K17 A;  2KGG A;  4WA6 A;  5D1M B;  4A0C D;  2JMI A;  2HDP A;  2LV9 A;  1Z2Q A;  3SHB A;  3I2D A;  5EYA F;  5D1L B;  5C13 A;  3ZVZ B;  4YAT A;  2LN0 A;  3ZPV E;  1WEU A;  3MHS A;  5C11 A;  3N9P A;  5FEY A;  3HCU A;  2YUR A;  3RPG C;  2C2V S;  2RSD A;  1JM7 A;  4B86 C;  5KH7 A;  2PNX A;  3SOX A;  1WIM A;  5H1U A;  3LQI A;  3V43 A;  1RMD A;  2FUU A;  4I7C A;  3U5O A;  3PUQ A;  4LKA A;  4R7E A;  2YUC A;  3O7A A;  3HCS A;  4IC2 A;  2KYU A;  5D1K B;  4NN2 A;  2KU3 A;  5AIU A;  1XWH A;  2PUY A;  4CA1 A;  2K16 A;  3GV4 A;  2YT5 A;  2ECI A;  3C6W A;  1ZBD B;  1E4U A;  4A4C A;  4GNG A;  4PPE A;  2YU4 A;  4N4F A;  2LGV A;  3RPG B;  5LKZ A;  3ZNI A;  2YSM A;  2ECJ A;  4YBM A;  4IC3 A;  2G43 A;  2YHO A;  2E6S A;  5H1V A;  2KWK A;  2KWO A;  2MA5 A;  1VYX A;  4QF3 A;  2FSA A;  2D8S A;  5JG6 A;  4WZ0 A;  4R8P K;  4S3O C;  2K1J A;  2QJ0 A;  2Y43 A;  2CT2 A;  1HYI A;  1X4U A;  5TAB A;  4S3O B;  2M85 A;  2EOD A;  1JOC A;  2L43 A;  2XEU A;  4MVT A;  2VJF B;  4YBT A;  5KH9 A;  3M63 A;  3ZYQ A;  2VNF A;  2MNZ A;  3N9N A;  5LCW B;  1BOR A;  3EB5 A;  1U6G B;  3RTR B;  4L58 A;  2QIC A;  1Z6U A;  1HYJ A;  2LXH C;  4I7B A;  3O35 A;  3O33 A;  5B8D A;  1Z60 A;  2F42 A;  5AIT A;  3SOU A;  3L1Z B;  2KE1 A;  2F6N A;  2K4D A;  4FIP A;  4ZUX U;  4BBQ A;  2I50 A;  3HTK C;  4W4U A;  2G45 A;  1F62 A;  3N9Q A;  2NAA A;  2YSJ A;  4QF2 A;  2VPB A;  1WEV A;  4B7Y C;  3ZPV 1;  2KWN A;  1WEO A;  5DKA A;  1K2F A;  2MNY A;  2FUI A;  1WIL A;  5G05 B;  3ZVY A;  2YQL A;  2M3H A;  1WFK A;  1X4J A;  4BHW A;  5DIN A;  2MD8 C;  3U5N A;  2MT5 A;  2KFT A;  2ZET C;  4XI1 A;  3PUR A;  5LKT A;  5B79 A;  1WEE A;  2MA6 A;  2CKL B;  2EGP A;  4AUQ B;  4P5O B;  4WZ2 A;  3QZV A;  4AYC B;  4YAB A;  1LDJ B;  5H9M A;  3U5M A;  2QIZ A;  2CSZ A;  2VJE B;  2LQ6 A;  2VPG A;  2YRE A;  4GND A;  3O37 A;  3N9L A;  4UP0 A;  2OXQ C;  4FO9 A;  4UP5 A;  2LGK A;  4N3W A;  3KNV A;  2VP7 A;  5J3X A;  4YBS A;  4UI9 B;  2EA6 A;  5B75 A;  2YYR A;  4AYC A;  2KIZ A;  2VJE A;  2CKL A;  3ZTG A;  2H0D A;  2JMJ A;  4FJC A;  2ECW A;  5I3L A;  1WEW A;  2ECT A;  2KGI A;  3O34 A;  1X4I A;  3LQJ A;  4I7D A;  1WEQ A;  5FB1 A;  4A4B A;  2L80 A;  2MIQ A;  4FK5 A;  3KQI A;  5FB0 A;  1WES A;  4A49 A;  2G6Q A;  2M6M A;  4F52 B;  2AN6 A;  3EB6 A;  4C9Z A;  1V87 A;  2KWJ A;  4LAD B;  3M62 A;  2LDR A;  5TBN A;  4R2Y A;  2L5U A;  3N9M A;  4ZQL A;  4ZDT A;  2LGL A;  1DVP A;  2LXP C;  2CSY A;  3LRQ A;  3O70 A;  4GNE A;  5B78 A;  2M1R A;  3LQH A;  4GB0 A;  5LKU A;  4AVX A;  2ECN A;  3KV5 A;  1JM7 B;  4X3G A;  3O36 A;  4CCG X;  1CHC A;  1FP0 A;  4YAX A;  5G04 B;  4LJN A;  1LDK C;  2L75 A;  4L7X A;  2BAY A;  5KH3 A;  3FL2 A;  1IYM A;  3DPL R;  3HCT A;  2KRE A;  4O64 A;  2L0B A;  2VPE A;  1G25 A;  2ECG A;  2YW8 A;  5B76 A;  1WEP A;  3T7L A;  2MUM A;  2JRJ A;  2LGG A;  2MD7 B;  3NG2 A;  3PHD A;  1VD4 A;  2UZG A;  3T6R A;  1FBV A;  3U5P A;  2ECV A;  2HYE D;  4YC9 A;  3GL6 A;  2XB1 A;  2VPD A; 
#chains in the Genus database with same CATH topology
 3ASL A;  3DQV R;  2Y1M A;  2RI7 A;  3MDB C;  4GNF A;  3L11 A;  4LLB A;  3VK6 A;  1MM3 A;  5FER A;  1WE9 A;  2Y1N A;  3JUE A;  4WZ3 B;  4OGE A;  5G0F A;  3DDT A;  4Q6F A;  3IHP A;  2E6R A;  2H0D B;  4PTB A;  2JUN A;  2IQJ A;  5TDW A;  2F6J A;  1WEM A;  5TDR A;  2KR4 A;  4MSX A;  2JMD A;  4AP4 A;  2DX8 A;  1VFY A;  3H7H A;  2VJF A;  3M99 A;  3PLW A;  5LKX A;  5TRB A;  3LDY A;  2IDA A;  3N9O A;  1WEN A;  4TKP B;  3LVQ E;  5SVI A;  2C2L A;  2LRI C;  1MM2 A;  4LK9 A;  4V3L C;  4YAD A;  2YQM A;  1T1H A;  3KV6 A;  1WGM A;  3MHH A;  3SOW A;  2YHN A;  5B77 A;  5H1T A;  4V3K C;  3L1X A;  1N87 A;  3C5K A;  2K17 A;  2KGG A;  4WA6 A;  2YVR A;  5D1M B;  4A0C D;  2JMI A;  2HDP A;  2LV9 A;  1Z2Q A;  3SHB A;  3I2D A;  5EYA F;  5D1L B;  5C13 A;  3ZVZ B;  4YAT A;  2LN0 A;  3ZPV E;  1WEU A;  3MHS A;  5C11 A;  3N9P A;  5FEY A;  3HCU A;  2YUR A;  3RPG C;  2C2V S;  2RSD A;  1JM7 A;  4B86 C;  3KDE C;  5KH7 A;  3FM8 C;  2PNX A;  3SOX A;  1WIM A;  5H1U A;  3LQI A;  3SUB A;  3V43 A;  1RMD A;  2FUU A;  4I7C A;  3U5O A;  2P57 A;  2XOC A;  3PUQ A;  4LKA A;  4R7E A;  2YUC A;  3FEH A;  3O7A A;  3HCS A;  4IC2 A;  2KYU A;  5D1K B;  4NN2 A;  2KU3 A;  5AIU A;  4OGC A;  2EGM A;  1XWH A;  2PUY A;  4CA1 A;  2K16 A;  2DSM A;  3GV4 A;  2YT5 A;  2ECI A;  3C6W A;  1ZBD B;  1E4U A;  4A4C A;  4GNG A;  4PPE A;  2YU4 A;  4N4F A;  2LGV A;  3RPG B;  5LKZ A;  3ZNI A;  2YSM A;  2DJA A;  2ECJ A;  4YBM A;  4IC3 A;  2G43 A;  2YHO A;  2E6S A;  5H1V A;  1DCQ A;  2KWK A;  4Z0R A;  2KWO A;  2MA5 A;  1VYX A;  4QF3 A;  2FSA A;  2D8S A;  5JG6 A;  4WZ0 A;  4R8P K;  5SVY A;  2RR4 A;  4S3O C;  3LVR E;  2K1J A;  2QJ0 A;  2Y43 A;  2CT2 A;  1HYI A;  2XP0 A;  1X4U A;  5TAB A;  4S3O B;  2M85 A;  2EOD A;  1JOC A;  2L43 A;  2XEU A;  3GL6 A;  2L7P A;  2VJF B;  4MVT A;  4QQ4 A;  4YBT A;  2CSV A;  5KH9 A;  3M63 A;  3ZYQ A;  2VNF A;  2KKX A;  2MNZ A;  3N9N A;  5LCW B;  1BOR A;  3EB5 A;  5SVX A;  1U6G B;  3RTR B;  4L58 A;  2QIC A;  1Z6U A;  3T9K A;  1HYJ A;  2LXH C;  4I7B A;  3O35 A;  3O33 A;  5B8D A;  1Z60 A;  5K3Q A;  2F42 A;  5AIT A;  3SOU A;  3L1Z B;  2KE1 A;  2F6N A;  2K4D A;  4FIP A;  4ZUX U;  4BBQ A;  2I50 A;  2E61 A;  2EXU A;  3HTK C;  4W4U A;  2G45 A;  1F62 A;  3N9Q A;  2NAA A;  2YSJ A;  4QF2 A;  2VPB A;  2LAU A;  1WEV A;  4B7Y C;  3M7K A;  3ZPV 1;  2KWN A;  1WEO A;  5DKA A;  1K2F A;  2MNY A;  2FUI A;  1WIL A;  5G05 B;  3LJU X;  4H9D A;  3ZVY A;  2YQL A;  2M3H A;  1WFK A;  1X4J A;  3E2D A;  4BHW A;  5DIN A;  2MD8 C;  3U5N A;  2MT5 A;  2CON A;  2KFT A;  3FAN A;  2ZET C;  4XI1 A;  3PUR A;  5LKT A;  5B79 A;  1WEE A;  2MA6 A;  2CKL B;  2EGP A;  4AUQ B;  4P5O B;  4WZ2 A;  3QZV A;  4AYC B;  4YAB A;  1LDJ B;  5H9M A;  3U5M A;  2B0O E;  2FD4 A;  2QIZ A;  2CSZ A;  2VJE B;  2LQ6 A;  2VPG A;  2YRE A;  4GND A;  3O37 A;  3N9L A;  4UP0 A;  2OXQ C;  2MKE A;  4FO9 A;  4UP5 A;  2KKY A;  2LGK A;  4N3W A;  3KNV A;  2VP7 A;  2JM3 A;  5J3X A;  4YBS A;  4UI9 B;  2EA6 A;  5B75 A;  2YYR A;  4AYC A;  2KIZ A;  2VJE A;  3O47 A;  2CKL A;  3ZTG A;  2H0D A;  2JMJ A;  4FJC A;  2ECW A;  2M13 A;  1WEW A;  2ECT A;  5I3L A;  2KGI A;  3O34 A;  1X4I A;  3LQJ A;  4I7D A;  1WEQ A;  2D8U A;  5FB1 A;  2L80 A;  2CRR A;  4A4B A;  2MIQ A;  4FK5 A;  3KQI A;  5FB0 A;  1WES A;  4A49 A;  2FFW A;  2G6Q A;  2M6M A;  4F52 B;  2AN6 A;  3EB6 A;  1MBM A;  4C9Z A;  1V87 A;  2KWJ A;  4LAD B;  2XOY A;  3M62 A;  2LDR A;  5TBN A;  2CRW A;  4R2Y A;  2L5U A;  3N9M A;  4ZQL A;  4Z0O A;  4ZDT A;  3FJU B;  2LGL A;  3Q1D A;  1DVP A;  2LXP C;  2CSY A;  3LRQ A;  3O70 A;  4GNE A;  5B78 A;  2M1R A;  3LQH A;  4GB0 A;  5LKU A;  4AVX A;  3FAO A;  2ECN A;  3KV5 A;  1JM7 B;  4X3G A;  4O62 A;  3O36 A;  3DWD A;  4CCG X;  4F1P A;  1CHC A;  1FP0 A;  4YAX A;  5G04 B;  4LJN A;  2L75 A;  4L7X A;  2BAY A;  5KH3 A;  3FL2 A;  1IYM A;  3DPL R;  3HCT A;  2OWA A;  2KRE A;  4O64 A;  2L0B A;  2VPE A;  1G25 A;  2ECG A;  2YW8 A;  5B76 A;  1WEP A;  3T7L A;  2MUM A;  2JRJ A;  2LGG A;  2MD7 B;  3NG2 A;  3PHD A;  1VD4 A;  2UZG A;  3T6R A;  1FBV A;  2XOZ A;  3U5P A;  2ECV A;  2HYE D;  4YC9 A;  1LDK C;  2XB1 A;  2VPD A;  5SVI B; 
#chains in the Genus database with same CATH homology
 3ASL A;  3DQV R;  2Y1M A;  2RI7 A;  4LLB A;  4GNF A;  3L11 A;  3VK6 A;  1MM3 A;  5FER A;  1WE9 A;  2Y1N A;  4WZ3 B;  5G0F A;  4Q6F A;  3IHP A;  2E6R A;  2H0D B;  4PTB A;  5TDW A;  2F6J A;  1WEM A;  5TDR A;  2KR4 A;  4MSX A;  2JMD A;  4AP4 A;  2DX8 A;  1VFY A;  2VJF A;  3M99 A;  5LKX A;  5TRB A;  2IDA A;  3N9O A;  1WEN A;  4TKP B;  2C2L A;  2LRI C;  1MM2 A;  4LK9 A;  4V3L C;  4YAD A;  2YQM A;  1T1H A;  3KV6 A;  1WGM A;  3MHH A;  3SOW A;  2YHN A;  5B77 A;  5H1T A;  4V3K C;  3L1X A;  1N87 A;  3C5K A;  2K17 A;  2KGG A;  4WA6 A;  5D1M B;  4A0C D;  2JMI A;  2HDP A;  2LV9 A;  1Z2Q A;  3SHB A;  3I2D A;  5EYA F;  5D1L B;  5C13 A;  3ZVZ B;  4YAT A;  2LN0 A;  3ZPV E;  1WEU A;  3MHS A;  5C11 A;  3N9P A;  5FEY A;  3HCU A;  2YUR A;  3RPG C;  2C2V S;  2RSD A;  1JM7 A;  4B86 C;  5KH7 A;  2PNX A;  3SOX A;  1WIM A;  5H1U A;  3LQI A;  3V43 A;  1RMD A;  2FUU A;  4I7C A;  3U5O A;  3PUQ A;  4LKA A;  4R7E A;  2YUC A;  3O7A A;  3HCS A;  4IC2 A;  2KYU A;  5D1K B;  4NN2 A;  2KU3 A;  5AIU A;  1XWH A;  2PUY A;  4CA1 A;  2K16 A;  3GV4 A;  2YT5 A;  2ECI A;  3C6W A;  1ZBD B;  1E4U A;  4A4C A;  4GNG A;  4PPE A;  2YU4 A;  4N4F A;  2LGV A;  3RPG B;  5LKZ A;  3ZNI A;  2YSM A;  2ECJ A;  4YBM A;  4IC3 A;  2G43 A;  2YHO A;  2E6S A;  5H1V A;  2KWK A;  2KWO A;  2MA5 A;  1VYX A;  4QF3 A;  2FSA A;  2D8S A;  5JG6 A;  4WZ0 A;  4R8P K;  4S3O C;  2K1J A;  2QJ0 A;  2Y43 A;  2CT2 A;  1HYI A;  1X4U A;  5TAB A;  4S3O B;  2M85 A;  2EOD A;  1JOC A;  2L43 A;  2XEU A;  4MVT A;  2VJF B;  4YBT A;  5KH9 A;  3M63 A;  3ZYQ A;  2VNF A;  2MNZ A;  3N9N A;  5LCW B;  1BOR A;  3EB5 A;  1U6G B;  3RTR B;  4L58 A;  2QIC A;  1Z6U A;  1HYJ A;  2LXH C;  4I7B A;  3O35 A;  3O33 A;  5B8D A;  1Z60 A;  2F42 A;  5AIT A;  3SOU A;  3L1Z B;  2KE1 A;  2F6N A;  2K4D A;  4FIP A;  4ZUX U;  4BBQ A;  2I50 A;  3HTK C;  4W4U A;  2G45 A;  1F62 A;  3N9Q A;  2NAA A;  2YSJ A;  4QF2 A;  2VPB A;  1WEV A;  4B7Y C;  3ZPV 1;  2KWN A;  1WEO A;  5DKA A;  1K2F A;  2MNY A;  2FUI A;  1WIL A;  5G05 B;  3ZVY A;  2YQL A;  2M3H A;  1WFK A;  1X4J A;  4BHW A;  5DIN A;  2MD8 C;  3U5N A;  2MT5 A;  2KFT A;  2ZET C;  4XI1 A;  3PUR A;  5LKT A;  5B79 A;  1WEE A;  2MA6 A;  2CKL B;  2EGP A;  4AUQ B;  4P5O B;  4WZ2 A;  3QZV A;  4AYC B;  4YAB A;  1LDJ B;  5H9M A;  3U5M A;  2QIZ A;  2CSZ A;  2VJE B;  2LQ6 A;  2VPG A;  2YRE A;  4GND A;  3O37 A;  3N9L A;  4UP0 A;  2OXQ C;  4FO9 A;  4UP5 A;  2LGK A;  4N3W A;  3KNV A;  2VP7 A;  5J3X A;  4YBS A;  4UI9 B;  2EA6 A;  5B75 A;  2YYR A;  4AYC A;  2KIZ A;  2VJE A;  2CKL A;  3ZTG A;  2H0D A;  2JMJ A;  4FJC A;  2ECW A;  5I3L A;  1WEW A;  2ECT A;  2KGI A;  3O34 A;  1X4I A;  3LQJ A;  4I7D A;  1WEQ A;  5FB1 A;  4A4B A;  2L80 A;  2MIQ A;  4FK5 A;  3KQI A;  5FB0 A;  1WES A;  4A49 A;  2G6Q A;  2M6M A;  4F52 B;  2AN6 A;  3EB6 A;  4C9Z A;  1V87 A;  2KWJ A;  4LAD B;  3M62 A;  2LDR A;  5TBN A;  4R2Y A;  2L5U A;  3N9M A;  4ZQL A;  4ZDT A;  2LGL A;  1DVP A;  2LXP C;  2CSY A;  3LRQ A;  3O70 A;  4GNE A;  5B78 A;  2M1R A;  3LQH A;  4GB0 A;  5LKU A;  4AVX A;  2ECN A;  3KV5 A;  1JM7 B;  4X3G A;  3O36 A;  4CCG X;  1CHC A;  1FP0 A;  4YAX A;  5G04 B;  4LJN A;  1LDK C;  2L75 A;  4L7X A;  2BAY A;  5KH3 A;  3FL2 A;  1IYM A;  3DPL R;  3HCT A;  2KRE A;  4O64 A;  2L0B A;  2VPE A;  1G25 A;  2ECG A;  2YW8 A;  5B76 A;  1WEP A;  3T7L A;  2MUM A;  2JRJ A;  2LGG A;  2MD7 B;  3NG2 A;  3PHD A;  1VD4 A;  2UZG A;  3T6R A;  1FBV A;  3U5P A;  2ECV A;  2HYE D;  4YC9 A;  3GL6 A;  2XB1 A;  2VPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...