2KGIA

Solution structure of jarid1a c-terminal phd finger in complex with h3(1-9)k4me3
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Histone demethylase JARID1A
publication title Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 1.14.11.-:
pdb deposition date 2009-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kgiA00
2L43A 2VP7A 2L5UA 2KE1A 2AN6A 4I7DA 5DKAA 4YBMA 2YU4A 5H9MA 2KWNA 4PTBA 3N9LA 1U6GB 2M3HA 3M63A 1K2FA 3KV5A 2OXQC 2DX8A 3O35A 4B86C 2VJEB 1JM7B 3T6RA 2UZGA 1G25A 3LQJA 4GB0A 4YABA 2CKLA 3PUQA 4R8PK 3RPGC 3KV6A 4N4FA 4AVXA 4FO9A 4LK9A 2LQ6A 2LGLA 1WIMA 2KGGA 3N9MA 3N9NA 2H0DB 2VPDA 4TKPB 5C11A 2MA5A 4ZDTA 3O70A 1XWHA 2HDPA 1WENA 3U5PA 2LV9A 3DQVR 3ZPV1 4S3OC 1LDKC 4YATA 3QZVA 4GNFA 2L80A 2KREA 4R2YA 2LRIC 1DVPA 2ZETC 5LKZA 4IC3A 5KH7A 2QICA 5FB0A 2MUMA 1RMDA 3V43A 2RI7A 3LQHA 3M99A 5G0FA 4X3GA 5I3LA 2XEUA 5TBNA 3HCSA 1FBVA 2YSMA 1IYMA 2JMJA 2VJEA 2G43A 2VJFB 2VPBA 4CCGX 1WGMA 1WILA 2ECJA 2LN0A 2PNXA 4S3OB 4YBTA 4C9ZA 5FB1A 4GNGA 2YW8A 2M6MA 2EGPA 2VPGA 4FIPA 2H0DA 5EYAF 2EA6A 2XB1A 2KFTA 3N9PA 3HCTA 5AITA 4QF3A 3HCUA 3M62A 2YHNA 2MIQA 3O37A 3SHBA 1X4UA 4YAXA 2LXPC 2E6RA 4YC9A 3IHPA 4YBSA 4BBQA 1MM3A 5H1VA 1VYXA 1ZBDB 2ECTA 3ZVZB 3DPLR 4A0CD 4WA6A 3KQIA 3HTKC 3O34A 4R7EA 3N9QA 1WEPA 2IDAA 2ECWA 5B8DA 1BORA 2KR4A 1CHCA 2Y1NA 4AYCB 4LADB 2CT2A 3ZVYA 4ZUXU 2JMDA 2VJFA 2LDRA 1Z2QA 3T7LA 5DINA 3FL2A 1VD4A 1WEQA 2LGKA 2MT5A 2ECVA 2LGGA 2LXHC 4UP5A 3C5KA 4A4BA 2D8SA 4GNDA 4WZ0A 4BHWA 4MSXA 2KGIA 3ZYQA 4LLBA 3RTRB 5LCWB 5H1UA 3RPGB 2MA6A 2VNFA 2F6NA 2JMIA 1X4JA 5LKUA 5D1MB 2YHOA 3O33A 4YADA 1F62A 5B77A 4LJNA 4ZQLA 5TABA 4P5OB 5C13A 2E6SA 2F42A 1WE9A 1WESA 4V3LC 1WFKA 4PPEA 1WEOA 1WEUA 1JOCA 1FP0A 4B7YC 5JG6A 3MHSA 4MVTA 2G45A 2YUCA 4WZ3B 2FUIA 4AYCA 5FEYA 5G04B 4NN2A 4A49A 1T1HA 3SOWA 3L1ZB 2PUYA 5H1TA 2MNYA 3U5NA 4GNEA 1Z60A 4V3KC 2KYUA 5J3XA 2YT5A 2JRJA 3EB6A 1MM2A 4I7CA 2ECGA 5D1KB 4FJCA 5B78A 4F52B 3KNVA 2KWJA 3O36A 4AP4A 2ECIA 3VK6A 2YURA 4LKAA 2KIZA 2LGVA 1N87A 3L11A 2BAYA 1WEMA 2MD8C 2KWKA 3L1XA 5LKXA 4AUQB 2HYED 3PURA 2CSYA 1LDJB 4O64A 4IC2A 2K1JA 2FUUA 2NAAA 2I50A 2QJ0A 2Y1MA 3NG2A 1V87A 2MD7B 4FK5A 1E4UA 3C6WA 2K17A 5TDRA 2K4DA 4L7XA 4UI9B 4Q6FA 1X4IA 5D1LB 3SOXA 3ZPVE 2YQLA 2F6JA 3LRQA 4L58A 2KWOA 1Z6UA 2L0BA 4W4UA 2ECNA 3N9OA 5KH9A 2L75A 2YYRA 2Y43A 3PHDA 1HYIA 2MNZA 2C2VS 4CA1A 4I7BA 2VPEA 2EODA 3ZNIA 3MHHA 5TDWA 2CKLB 2QIZA 2YREA 3LQIA 2YQMA 1WEWA 1WEVA 3ASLA 2CSZA 5LKTA 3U5OA 3O7AA 4A4CA 1JM7A 5G05B 5B79A 5B75A 5KH3A 4XI1A 3I2DA 1HYJA 1VFYA 2C2LA 4WZ2A 2M1RA 3U5MA 3SOUA 1WEEA 3GL6A 5AIUA 2YSJA 2KU3A 3EB5A 3GV4A 5TRBA 5FERA 5B76A 2FSAA 2M85A 2G6QA 2K16A 2RSDA 4UP0A 4N3WA 3ZTGA 4QF2A
chains in the Genus database with same CATH superfamily
2L43A 2VP7A 2L5UA 2KE1A 2AN6A 4I7DA 5DKAA 3LVRE 2YU4A 4YBMA 5H9MA 2KWNA 4PTBA 3N9LA 1U6GB 2M3HA 3M63A 1K2FA 3KV5A 2OXQC 2DX8A 3O35A 4B86C 2VJEB 3LJUX 1JM7B 3T6RA 2UZGA 1G25A 3E2DA 4GB0A 3LQJA 4YABA 2CKLA 3FM8C 3PUQA 4R8PK 3RPGC 3KV6A 4N4FA 4AVXA 2RR4A 4FO9A 4LK9A 2LQ6A 4O62A 2LGLA 1WIMA 2KGGA 3FAOA 3N9MA 3M7KA 3N9NA 2H0DB 2VPDA 4TKPB 5C11A 2MA5A 4ZDTA 2P57A 3O70A 1XWHA 1WENA 2HDPA 3U5PA 2LV9A 2XOCA 3DQVR 3ZPV1 4S3OC 1LDKC 4YATA 3QZVA 2CRRA 4GNFA 2L80A 2M13A 2KREA 4R2YA 2LRIC 1DVPA 2ZETC 5LKZA 4IC3A 5KH7A 2QICA 5FB0A 2MUMA 1RMDA 3V43A 2RI7A 3LQHA 3M99A 5G0FA 4X3GA 5I3LA 2XEUA 3JUEA 3DDTA 5TBNA 3HCSA 2XOZA 2IQJA 1FBVA 2YSMA 1IYMA 2JMJA 2VJEA 2G43A 2VJFB 5SVXA 3LDYA 2VPBA 3MDBC 4CCGX 1WGMA 1WILA 2ECJA 2LN0A 2PNXA 2CONA 4S3OB 4YBTA 4F1PA 4C9ZA 3DWDA 5FB1A 4GNGA 1DCQA 2YW8A 2M6MA 2EGPA 2VPGA 4FIPA 2H0DA 5EYAF 2EA6A 2XB1A 2KFTA 3N9PA 3HCTA 5AITA 2OWAA 4QF3A 3HCUA 3M62A 2YHNA 2MIQA 3O37A 3SHBA 1X4UA 4YAXA 2LXPC 2E6RA 4YC9A 3IHPA 4YBSA 4BBQA 1MM3A 5H1VA 1VYXA 1ZBDB 3H7HA 2MKEA 5SVYA 2ECTA 3ZVZB 3DPLR 4A0CD 4WA6A 3KQIA 3HTKC 3O34A 4R7EA 3N9QA 1WEPA 2IDAA 2ECWA 5B8DA 1BORA 2KR4A 1CHCA 2Y1NA 4AYCB 4LADB 2CT2A 3ZVYA 4ZUXU 2JMDA 2VJFA 2LDRA 1Z2QA 3T7LA 5DINA 3Q1DA 3FL2A 1VD4A 1WEQA 2LGKA 2MT5A 2ECVA 2LGGA 2LXHC 4UP5A 2D8UA 3PLWA 3C5KA 4OGCA 4A4BA 2D8SA 4GNDA 4WZ0A 4BHWA 4MSXA 2KGIA 3ZYQA 4LLBA 3RTRB 5LCWB 5H1UA 3RPGB 2MA6A 4H9DA 4Z0OA 3SUBA 2VNFA 2F6NA 2JMIA 1X4JA 5LKUA 5D1MB 2YHOA 3O33A 2DJAA 4YADA 1F62A 5B77A 4LJNA 4ZQLA 5TABA 4P5OB 5C13A 2E6SA 2F42A 1WE9A 1WESA 4V3LC 1WFKA 4PPEA 1WEOA 1WEUA 1JOCA 1FP0A 4B7YC 5JG6A 3MHSA 4MVTA 2G45A 2YUCA 4WZ3B 2FUIA 4AYCA 5FEYA 5G04B 3FEHA 2JM3A 4NN2A 4OGEA 4A49A 2FFWA 1T1HA 3SOWA 3L1ZB 2PUYA 2YVRA 5H1TA 2MNYA 3U5NA 4GNEA 1Z60A 4V3KC 2KYUA 2FD4A 2YT5A 5J3XA 2JRJA 3EB6A 1MM2A 4I7CA 2ECGA 5D1KB 4FJCA 5B78A 4F52B 3KNVA 2KWJA 3O47A 2LAUA 3O36A 4AP4A 2ECIA 3VK6A 2YURA 4LKAA 2KIZA 2LGVA 1N87A 3L11A 4Z0RA 2BAYA 1WEMA 3T9KA 2MD8C 2KWKA 3L1XA 5LKXA 4AUQB 2HYED 2KKYA 2L7PA 3PURA 2XOYA 3KDEC 2CSYA 1LDJB 4O64A 4IC2A 2K1JA 2FUUA 2NAAA 2CRWA 2I50A 2QJ0A 2Y1MA 3NG2A 2JUNA 1V87A 4QQ4A 2MD7B 4FK5A 3FJUB 1E4UA 3LVQE 3C6WA 2K17A 5TDRA 2K4DA 4L7XA 4UI9B 4Q6FA 5SVIB 1X4IA 5D1LB 3SOXA 3ZPVE 2YQLA 2F6JA 3LRQA 2E61A 4L58A 5K3QA 2KWOA 1Z6UA 2L0BA 2EXUA 4W4UA 2ECNA 3N9OA 5KH9A 2L75A 2YYRA 1MBMA 2Y43A 3PHDA 1HYIA 2MNZA 2C2VS 4CA1A 2B0OE 4I7BA 2VPEA 2EODA 3ZNIA 3MHHA 5TDWA 2EGMA 2CKLB 2CSVA 2QIZA 2YREA 3LQIA 2YQMA 1WEWA 1WEVA 3ASLA 2CSZA 5LKTA 3U5OA 3O7AA 4A4CA 1JM7A 5G05B 5B79A 2DSMA 5B75A 5KH3A 4XI1A 3I2DA 1HYJA 1VFYA 2C2LA 4WZ2A 2M1RA 3U5MA 2XP0A 3SOUA 1WEEA 3GL6A 5AIUA 2YSJA 2KU3A 3EB5A 3GV4A 5TRBA 5FERA 5B76A 2FSAA 3FANA 5SVIA 2M85A 2G6QA 2K16A 2RSDA 4UP0A 4N3WA 3ZTGA 4QF2A 2KKXA
chains in the Genus database with same CATH topology
2L43A 2VP7A 2L5UA 2KE1A 2AN6A 4I7DA 5DKAA 4YBMA 2YU4A 5H9MA 2KWNA 4PTBA 3N9LA 1U6GB 2M3HA 3M63A 1K2FA 3KV5A 2OXQC 2DX8A 3O35A 4B86C 2VJEB 1JM7B 3T6RA 2UZGA 1G25A 3LQJA 4GB0A 4YABA 2CKLA 3PUQA 4R8PK 3RPGC 3KV6A 4N4FA 4AVXA 4FO9A 4LK9A 2LQ6A 2LGLA 1WIMA 2KGGA 3N9MA 3N9NA 2H0DB 2VPDA 4TKPB 5C11A 2MA5A 4ZDTA 3O70A 1XWHA 2HDPA 1WENA 3U5PA 2LV9A 3DQVR 3ZPV1 4S3OC 1LDKC 4YATA 3QZVA 4GNFA 2L80A 2KREA 4R2YA 2LRIC 1DVPA 2ZETC 5LKZA 4IC3A 5KH7A 2QICA 5FB0A 2MUMA 1RMDA 3V43A 2RI7A 3LQHA 3M99A 5G0FA 4X3GA 5I3LA 2XEUA 5TBNA 3HCSA 1FBVA 2YSMA 1IYMA 2JMJA 2VJEA 2G43A 2VJFB 2VPBA 4CCGX 1WGMA 1WILA 2ECJA 2LN0A 2PNXA 4S3OB 4YBTA 4C9ZA 5FB1A 4GNGA 2YW8A 2M6MA 2EGPA 2VPGA 4FIPA 2H0DA 5EYAF 2EA6A 2XB1A 2KFTA 3N9PA 3HCTA 5AITA 4QF3A 3HCUA 3M62A 2YHNA 2MIQA 3O37A 3SHBA 1X4UA 4YAXA 2LXPC 2E6RA 4YC9A 3IHPA 4YBSA 4BBQA 1MM3A 5H1VA 1VYXA 1ZBDB 2ECTA 3ZVZB 3DPLR 4A0CD 4WA6A 3KQIA 3HTKC 3O34A 4R7EA 3N9QA 1WEPA 2IDAA 2ECWA 5B8DA 1BORA 2KR4A 1CHCA 2Y1NA 4AYCB 4LADB 2CT2A 3ZVYA 4ZUXU 2JMDA 2VJFA 2LDRA 1Z2QA 3T7LA 5DINA 3FL2A 1VD4A 1WEQA 2LGKA 2MT5A 2ECVA 2LGGA 2LXHC 4UP5A 3C5KA 4A4BA 2D8SA 4GNDA 4WZ0A 4BHWA 4MSXA 2KGIA 3ZYQA 4LLBA 3RTRB 5LCWB 5H1UA 3RPGB 2MA6A 2VNFA 2F6NA 2JMIA 1X4JA 5LKUA 5D1MB 2YHOA 3O33A 4YADA 1F62A 5B77A 4LJNA 4ZQLA 5TABA 4P5OB 5C13A 2E6SA 2F42A 1WE9A 1WESA 4V3LC 1WFKA 4PPEA 1WEOA 1WEUA 1JOCA 1FP0A 4B7YC 5JG6A 3MHSA 4MVTA 2G45A 2YUCA 4WZ3B 2FUIA 4AYCA 5FEYA 5G04B 4NN2A 4A49A 1T1HA 3SOWA 3L1ZB 2PUYA 5H1TA 2MNYA 3U5NA 4GNEA 1Z60A 4V3KC 2KYUA 5J3XA 2YT5A 2JRJA 3EB6A 1MM2A 4I7CA 2ECGA 5D1KB 4FJCA 5B78A 4F52B 3KNVA 2KWJA 3O36A 4AP4A 2ECIA 3VK6A 2YURA 4LKAA 2KIZA 2LGVA 1N87A 3L11A 2BAYA 1WEMA 2MD8C 2KWKA 3L1XA 5LKXA 4AUQB 2HYED 3PURA 2CSYA 1LDJB 4O64A 4IC2A 2K1JA 2FUUA 2NAAA 2I50A 2QJ0A 2Y1MA 3NG2A 1V87A 2MD7B 4FK5A 1E4UA 3C6WA 2K17A 5TDRA 2K4DA 4L7XA 4UI9B 4Q6FA 1X4IA 5D1LB 3SOXA 3ZPVE 2YQLA 2F6JA 3LRQA 4L58A 2KWOA 1Z6UA 2L0BA 4W4UA 2ECNA 3N9OA 5KH9A 2L75A 2YYRA 2Y43A 3PHDA 1HYIA 2MNZA 2C2VS 4CA1A 4I7BA 2VPEA 2EODA 3ZNIA 3MHHA 5TDWA 2CKLB 2QIZA 2YREA 3LQIA 2YQMA 1WEWA 1WEVA 3ASLA 2CSZA 5LKTA 3U5OA 3O7AA 4A4CA 1JM7A 5G05B 5B79A 5B75A 5KH3A 4XI1A 3I2DA 1HYJA 1VFYA 2C2LA 4WZ2A 2M1RA 3U5MA 3SOUA 1WEEA 3GL6A 5AIUA 2YSJA 2KU3A 3EB5A 3GV4A 5TRBA 5FERA 5B76A 2FSAA 2M85A 2G6QA 2K16A 2RSDA 4UP0A 4N3WA 3ZTGA 4QF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L43 A;  2VP7 A;  2L5U A;  2KE1 A;  2AN6 A;  4I7D A;  5DKA A;  4YBM A;  2YU4 A;  5H9M A;  2KWN A;  4PTB A;  3N9L A;  1U6G B;  2M3H A;  3M63 A;  1K2F A;  3KV5 A;  2OXQ C;  2DX8 A;  3O35 A;  4B86 C;  2VJE B;  1JM7 B;  3T6R A;  2UZG A;  1G25 A;  3LQJ A;  4GB0 A;  4YAB A;  2CKL A;  3PUQ A;  4R8P K;  3RPG C;  3KV6 A;  4N4F A;  4AVX A;  4FO9 A;  4LK9 A;  2LQ6 A;  2LGL A;  1WIM A;  2KGG A;  3N9M A;  3N9N A;  2H0D B;  2VPD A;  4TKP B;  5C11 A;  2MA5 A;  4ZDT A;  3O70 A;  1XWH A;  2HDP A;  1WEN A;  3U5P A;  2LV9 A;  3DQV R;  3ZPV 1;  4S3O C;  1LDK C;  4YAT A;  3QZV A;  4GNF A;  2L80 A;  2KRE A;  4R2Y A;  2LRI C;  1DVP A;  2ZET C;  5LKZ A;  4IC3 A;  5KH7 A;  2QIC A;  5FB0 A;  2MUM A;  1RMD A;  3V43 A;  2RI7 A;  3LQH A;  3M99 A;  5G0F A;  4X3G A;  5I3L A;  2XEU A;  5TBN A;  3HCS A;  1FBV A;  2YSM A;  1IYM A;  2JMJ A;  2VJE A;  2G43 A;  2VJF B;  2VPB A;  4CCG X;  1WGM A;  1WIL A;  2ECJ A;  2LN0 A;  2PNX A;  4S3O B;  4YBT A;  4C9Z A;  5FB1 A;  4GNG A;  2YW8 A;  2M6M A;  2EGP A;  2VPG A;  4FIP A;  2H0D A;  5EYA F;  2EA6 A;  2XB1 A;  2KFT A;  3N9P A;  3HCT A;  5AIT A;  4QF3 A;  3HCU A;  3M62 A;  2YHN A;  2MIQ A;  3O37 A;  3SHB A;  1X4U A;  4YAX A;  2LXP C;  2E6R A;  4YC9 A;  3IHP A;  4YBS A;  4BBQ A;  1MM3 A;  5H1V A;  1VYX A;  1ZBD B;  2ECT A;  3ZVZ B;  3DPL R;  4A0C D;  4WA6 A;  3KQI A;  3HTK C;  3O34 A;  4R7E A;  3N9Q A;  1WEP A;  2IDA A;  2ECW A;  5B8D A;  1BOR A;  2KR4 A;  1CHC A;  2Y1N A;  4AYC B;  4LAD B;  2CT2 A;  3ZVY A;  4ZUX U;  2JMD A;  2VJF A;  2LDR A;  1Z2Q A;  3T7L A;  5DIN A;  3FL2 A;  1VD4 A;  1WEQ A;  2LGK A;  2MT5 A;  2ECV A;  2LGG A;  2LXH C;  4UP5 A;  3C5K A;  4A4B A;  2D8S A;  4GND A;  4WZ0 A;  4BHW A;  4MSX A;  2KGI A;  3ZYQ A;  4LLB A;  3RTR B;  5LCW B;  5H1U A;  3RPG B;  2MA6 A;  2VNF A;  2F6N A;  2JMI A;  1X4J A;  5LKU A;  5D1M B;  2YHO A;  3O33 A;  4YAD A;  1F62 A;  5B77 A;  4LJN A;  4ZQL A;  5TAB A;  4P5O B;  5C13 A;  2E6S A;  2F42 A;  1WE9 A;  1WES A;  4V3L C;  1WFK A;  4PPE A;  1WEO A;  1WEU A;  1JOC A;  1FP0 A;  4B7Y C;  5JG6 A;  3MHS A;  4MVT A;  2G45 A;  2YUC A;  4WZ3 B;  2FUI A;  4AYC A;  5FEY A;  5G04 B;  4NN2 A;  4A49 A;  1T1H A;  3SOW A;  3L1Z B;  2PUY A;  5H1T A;  2MNY A;  3U5N A;  4GNE A;  1Z60 A;  4V3K C;  2KYU A;  5J3X A;  2YT5 A;  2JRJ A;  3EB6 A;  1MM2 A;  4I7C A;  2ECG A;  5D1K B;  4FJC A;  5B78 A;  4F52 B;  3KNV A;  2KWJ A;  3O36 A;  4AP4 A;  2ECI A;  3VK6 A;  2YUR A;  4LKA A;  2KIZ A;  2LGV A;  1N87 A;  3L11 A;  2BAY A;  1WEM A;  2MD8 C;  2KWK A;  3L1X A;  5LKX A;  4AUQ B;  2HYE D;  3PUR A;  2CSY A;  1LDJ B;  4O64 A;  4IC2 A;  2K1J A;  2FUU A;  2NAA A;  2I50 A;  2QJ0 A;  2Y1M A;  3NG2 A;  1V87 A;  2MD7 B;  4FK5 A;  1E4U A;  3C6W A;  2K17 A;  5TDR A;  2K4D A;  4L7X A;  4UI9 B;  4Q6F A;  1X4I A;  5D1L B;  3SOX A;  3ZPV E;  2YQL A;  2F6J A;  3LRQ A;  4L58 A;  2KWO A;  1Z6U A;  2L0B A;  4W4U A;  2ECN A;  3N9O A;  5KH9 A;  2L75 A;  2YYR A;  2Y43 A;  3PHD A;  1HYI A;  2MNZ A;  2C2V S;  4CA1 A;  4I7B A;  2VPE A;  2EOD A;  3ZNI A;  3MHH A;  5TDW A;  2CKL B;  2QIZ A;  2YRE A;  3LQI A;  2YQM A;  1WEW A;  1WEV A;  3ASL A;  2CSZ A;  5LKT A;  3U5O A;  3O7A A;  4A4C A;  1JM7 A;  5G05 B;  5B79 A;  5B75 A;  5KH3 A;  4XI1 A;  3I2D A;  1HYJ A;  1VFY A;  2C2L A;  4WZ2 A;  2M1R A;  3U5M A;  3SOU A;  1WEE A;  3GL6 A;  5AIU A;  2YSJ A;  2KU3 A;  3EB5 A;  3GV4 A;  5TRB A;  5FER A;  5B76 A;  2FSA A;  2M85 A;  2G6Q A;  2K16 A;  2RSD A;  4UP0 A;  4N3W A;  3ZTG A;  4QF2 A; 
#chains in the Genus database with same CATH topology
 2L43 A;  2VP7 A;  2L5U A;  2KE1 A;  2AN6 A;  4I7D A;  5DKA A;  3LVR E;  2YU4 A;  4YBM A;  5H9M A;  2KWN A;  4PTB A;  3N9L A;  1U6G B;  2M3H A;  3M63 A;  1K2F A;  3KV5 A;  2OXQ C;  2DX8 A;  3O35 A;  4B86 C;  2VJE B;  3LJU X;  1JM7 B;  3T6R A;  2UZG A;  1G25 A;  3E2D A;  4GB0 A;  3LQJ A;  4YAB A;  2CKL A;  3FM8 C;  3PUQ A;  4R8P K;  3RPG C;  3KV6 A;  4N4F A;  4AVX A;  2RR4 A;  4FO9 A;  4LK9 A;  2LQ6 A;  4O62 A;  2LGL A;  1WIM A;  2KGG A;  3FAO A;  3N9M A;  3M7K A;  3N9N A;  2H0D B;  2VPD A;  4TKP B;  5C11 A;  2MA5 A;  4ZDT A;  2P57 A;  3O70 A;  1XWH A;  1WEN A;  2HDP A;  3U5P A;  2LV9 A;  2XOC A;  3DQV R;  3ZPV 1;  4S3O C;  1LDK C;  4YAT A;  3QZV A;  2CRR A;  4GNF A;  2L80 A;  2M13 A;  2KRE A;  4R2Y A;  2LRI C;  1DVP A;  2ZET C;  5LKZ A;  4IC3 A;  5KH7 A;  2QIC A;  5FB0 A;  2MUM A;  1RMD A;  3V43 A;  2RI7 A;  3LQH A;  3M99 A;  5G0F A;  4X3G A;  5I3L A;  2XEU A;  3JUE A;  3DDT A;  5TBN A;  3HCS A;  2XOZ A;  2IQJ A;  1FBV A;  2YSM A;  1IYM A;  2JMJ A;  2VJE A;  2G43 A;  2VJF B;  5SVX A;  3LDY A;  2VPB A;  3MDB C;  4CCG X;  1WGM A;  1WIL A;  2ECJ A;  2LN0 A;  2PNX A;  2CON A;  4S3O B;  4YBT A;  4F1P A;  4C9Z A;  3DWD A;  5FB1 A;  4GNG A;  1DCQ A;  2YW8 A;  2M6M A;  2EGP A;  2VPG A;  4FIP A;  2H0D A;  5EYA F;  2EA6 A;  2XB1 A;  2KFT A;  3N9P A;  3HCT A;  5AIT A;  2OWA A;  4QF3 A;  3HCU A;  3M62 A;  2YHN A;  2MIQ A;  3O37 A;  3SHB A;  1X4U A;  4YAX A;  2LXP C;  2E6R A;  4YC9 A;  3IHP A;  4YBS A;  4BBQ A;  1MM3 A;  5H1V A;  1VYX A;  1ZBD B;  3H7H A;  2MKE A;  5SVY A;  2ECT A;  3ZVZ B;  3DPL R;  4A0C D;  4WA6 A;  3KQI A;  3HTK C;  3O34 A;  4R7E A;  3N9Q A;  1WEP A;  2IDA A;  2ECW A;  5B8D A;  1BOR A;  2KR4 A;  1CHC A;  2Y1N A;  4AYC B;  4LAD B;  2CT2 A;  3ZVY A;  4ZUX U;  2JMD A;  2VJF A;  2LDR A;  1Z2Q A;  3T7L A;  5DIN A;  3Q1D A;  3FL2 A;  1VD4 A;  1WEQ A;  2LGK A;  2MT5 A;  2ECV A;  2LGG A;  2LXH C;  4UP5 A;  2D8U A;  3PLW A;  3C5K A;  4OGC A;  4A4B A;  2D8S A;  4GND A;  4WZ0 A;  4BHW A;  4MSX A;  2KGI A;  3ZYQ A;  4LLB A;  3RTR B;  5LCW B;  5H1U A;  3RPG B;  2MA6 A;  4H9D A;  4Z0O A;  3SUB A;  2VNF A;  2F6N A;  2JMI A;  1X4J A;  5LKU A;  5D1M B;  2YHO A;  3O33 A;  2DJA A;  4YAD A;  1F62 A;  5B77 A;  4LJN A;  4ZQL A;  5TAB A;  4P5O B;  5C13 A;  2E6S A;  2F42 A;  1WE9 A;  1WES A;  4V3L C;  1WFK A;  4PPE A;  1WEO A;  1WEU A;  1JOC A;  1FP0 A;  4B7Y C;  5JG6 A;  3MHS A;  4MVT A;  2G45 A;  2YUC A;  4WZ3 B;  2FUI A;  4AYC A;  5FEY A;  5G04 B;  3FEH A;  2JM3 A;  4NN2 A;  4OGE A;  4A49 A;  2FFW A;  1T1H A;  3SOW A;  3L1Z B;  2PUY A;  2YVR A;  5H1T A;  2MNY A;  3U5N A;  4GNE A;  1Z60 A;  4V3K C;  2KYU A;  2FD4 A;  2YT5 A;  5J3X A;  2JRJ A;  3EB6 A;  1MM2 A;  4I7C A;  2ECG A;  5D1K B;  4FJC A;  5B78 A;  4F52 B;  3KNV A;  2KWJ A;  3O47 A;  2LAU A;  3O36 A;  4AP4 A;  2ECI A;  3VK6 A;  2YUR A;  4LKA A;  2KIZ A;  2LGV A;  1N87 A;  3L11 A;  4Z0R A;  2BAY A;  1WEM A;  3T9K A;  2MD8 C;  2KWK A;  3L1X A;  5LKX A;  4AUQ B;  2HYE D;  2KKY A;  2L7P A;  3PUR A;  2XOY A;  3KDE C;  2CSY A;  1LDJ B;  4O64 A;  4IC2 A;  2K1J A;  2FUU A;  2NAA A;  2CRW A;  2I50 A;  2QJ0 A;  2Y1M A;  3NG2 A;  2JUN A;  1V87 A;  4QQ4 A;  2MD7 B;  4FK5 A;  3FJU B;  1E4U A;  3LVQ E;  3C6W A;  2K17 A;  5TDR A;  2K4D A;  4L7X A;  4UI9 B;  4Q6F A;  5SVI B;  1X4I A;  5D1L B;  3SOX A;  3ZPV E;  2YQL A;  2F6J A;  3LRQ A;  2E61 A;  4L58 A;  5K3Q A;  2KWO A;  1Z6U A;  2L0B A;  2EXU A;  4W4U A;  2ECN A;  3N9O A;  5KH9 A;  2L75 A;  2YYR A;  1MBM A;  2Y43 A;  3PHD A;  1HYI A;  2MNZ A;  2C2V S;  4CA1 A;  2B0O E;  4I7B A;  2VPE A;  2EOD A;  3ZNI A;  3MHH A;  5TDW A;  2EGM A;  2CKL B;  2CSV A;  2QIZ A;  2YRE A;  3LQI A;  2YQM A;  1WEW A;  1WEV A;  3ASL A;  2CSZ A;  5LKT A;  3U5O A;  3O7A A;  4A4C A;  1JM7 A;  5G05 B;  5B79 A;  2DSM A;  5B75 A;  5KH3 A;  4XI1 A;  3I2D A;  1HYJ A;  1VFY A;  2C2L A;  4WZ2 A;  2M1R A;  3U5M A;  2XP0 A;  3SOU A;  1WEE A;  3GL6 A;  5AIU A;  2YSJ A;  2KU3 A;  3EB5 A;  3GV4 A;  5TRB A;  5FER A;  5B76 A;  2FSA A;  3FAN A;  5SVI A;  2M85 A;  2G6Q A;  2K16 A;  2RSD A;  4UP0 A;  4N3W A;  3ZTG A;  4QF2 A;  2KKX A; 
#chains in the Genus database with same CATH homology
 2L43 A;  2VP7 A;  2L5U A;  2KE1 A;  2AN6 A;  4I7D A;  5DKA A;  4YBM A;  2YU4 A;  5H9M A;  2KWN A;  4PTB A;  3N9L A;  1U6G B;  2M3H A;  3M63 A;  1K2F A;  3KV5 A;  2OXQ C;  2DX8 A;  3O35 A;  4B86 C;  2VJE B;  1JM7 B;  3T6R A;  2UZG A;  1G25 A;  3LQJ A;  4GB0 A;  4YAB A;  2CKL A;  3PUQ A;  4R8P K;  3RPG C;  3KV6 A;  4N4F A;  4AVX A;  4FO9 A;  4LK9 A;  2LQ6 A;  2LGL A;  1WIM A;  2KGG A;  3N9M A;  3N9N A;  2H0D B;  2VPD A;  4TKP B;  5C11 A;  2MA5 A;  4ZDT A;  3O70 A;  1XWH A;  2HDP A;  1WEN A;  3U5P A;  2LV9 A;  3DQV R;  3ZPV 1;  4S3O C;  1LDK C;  4YAT A;  3QZV A;  4GNF A;  2L80 A;  2KRE A;  4R2Y A;  2LRI C;  1DVP A;  2ZET C;  5LKZ A;  4IC3 A;  5KH7 A;  2QIC A;  5FB0 A;  2MUM A;  1RMD A;  3V43 A;  2RI7 A;  3LQH A;  3M99 A;  5G0F A;  4X3G A;  5I3L A;  2XEU A;  5TBN A;  3HCS A;  1FBV A;  2YSM A;  1IYM A;  2JMJ A;  2VJE A;  2G43 A;  2VJF B;  2VPB A;  4CCG X;  1WGM A;  1WIL A;  2ECJ A;  2LN0 A;  2PNX A;  4S3O B;  4YBT A;  4C9Z A;  5FB1 A;  4GNG A;  2YW8 A;  2M6M A;  2EGP A;  2VPG A;  4FIP A;  2H0D A;  5EYA F;  2EA6 A;  2XB1 A;  2KFT A;  3N9P A;  3HCT A;  5AIT A;  4QF3 A;  3HCU A;  3M62 A;  2YHN A;  2MIQ A;  3O37 A;  3SHB A;  1X4U A;  4YAX A;  2LXP C;  2E6R A;  4YC9 A;  3IHP A;  4YBS A;  4BBQ A;  1MM3 A;  5H1V A;  1VYX A;  1ZBD B;  2ECT A;  3ZVZ B;  3DPL R;  4A0C D;  4WA6 A;  3KQI A;  3HTK C;  3O34 A;  4R7E A;  3N9Q A;  1WEP A;  2IDA A;  2ECW A;  5B8D A;  1BOR A;  2KR4 A;  1CHC A;  2Y1N A;  4AYC B;  4LAD B;  2CT2 A;  3ZVY A;  4ZUX U;  2JMD A;  2VJF A;  2LDR A;  1Z2Q A;  3T7L A;  5DIN A;  3FL2 A;  1VD4 A;  1WEQ A;  2LGK A;  2MT5 A;  2ECV A;  2LGG A;  2LXH C;  4UP5 A;  3C5K A;  4A4B A;  2D8S A;  4GND A;  4WZ0 A;  4BHW A;  4MSX A;  2KGI A;  3ZYQ A;  4LLB A;  3RTR B;  5LCW B;  5H1U A;  3RPG B;  2MA6 A;  2VNF A;  2F6N A;  2JMI A;  1X4J A;  5LKU A;  5D1M B;  2YHO A;  3O33 A;  4YAD A;  1F62 A;  5B77 A;  4LJN A;  4ZQL A;  5TAB A;  4P5O B;  5C13 A;  2E6S A;  2F42 A;  1WE9 A;  1WES A;  4V3L C;  1WFK A;  4PPE A;  1WEO A;  1WEU A;  1JOC A;  1FP0 A;  4B7Y C;  5JG6 A;  3MHS A;  4MVT A;  2G45 A;  2YUC A;  4WZ3 B;  2FUI A;  4AYC A;  5FEY A;  5G04 B;  4NN2 A;  4A49 A;  1T1H A;  3SOW A;  3L1Z B;  2PUY A;  5H1T A;  2MNY A;  3U5N A;  4GNE A;  1Z60 A;  4V3K C;  2KYU A;  5J3X A;  2YT5 A;  2JRJ A;  3EB6 A;  1MM2 A;  4I7C A;  2ECG A;  5D1K B;  4FJC A;  5B78 A;  4F52 B;  3KNV A;  2KWJ A;  3O36 A;  4AP4 A;  2ECI A;  3VK6 A;  2YUR A;  4LKA A;  2KIZ A;  2LGV A;  1N87 A;  3L11 A;  2BAY A;  1WEM A;  2MD8 C;  2KWK A;  3L1X A;  5LKX A;  4AUQ B;  2HYE D;  3PUR A;  2CSY A;  1LDJ B;  4O64 A;  4IC2 A;  2K1J A;  2FUU A;  2NAA A;  2I50 A;  2QJ0 A;  2Y1M A;  3NG2 A;  1V87 A;  2MD7 B;  4FK5 A;  1E4U A;  3C6W A;  2K17 A;  5TDR A;  2K4D A;  4L7X A;  4UI9 B;  4Q6F A;  1X4I A;  5D1L B;  3SOX A;  3ZPV E;  2YQL A;  2F6J A;  3LRQ A;  4L58 A;  2KWO A;  1Z6U A;  2L0B A;  4W4U A;  2ECN A;  3N9O A;  5KH9 A;  2L75 A;  2YYR A;  2Y43 A;  3PHD A;  1HYI A;  2MNZ A;  2C2V S;  4CA1 A;  4I7B A;  2VPE A;  2EOD A;  3ZNI A;  3MHH A;  5TDW A;  2CKL B;  2QIZ A;  2YRE A;  3LQI A;  2YQM A;  1WEW A;  1WEV A;  3ASL A;  2CSZ A;  5LKT A;  3U5O A;  3O7A A;  4A4C A;  1JM7 A;  5G05 B;  5B79 A;  5B75 A;  5KH3 A;  4XI1 A;  3I2D A;  1HYJ A;  1VFY A;  2C2L A;  4WZ2 A;  2M1R A;  3U5M A;  3SOU A;  1WEE A;  3GL6 A;  5AIU A;  2YSJ A;  2KU3 A;  3EB5 A;  3GV4 A;  5TRB A;  5FER A;  5B76 A;  2FSA A;  2M85 A;  2G6Q A;  2K16 A;  2RSD A;  4UP0 A;  4N3W A;  3ZTG A;  4QF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...