2KGIA

Solution structure of jarid1a c-terminal phd finger in complex with h3(1-9)k4me3
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone demethylase JARID1A
publication title Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 1.14.11.-:
pdb deposition date 2009-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kgiA00
2F6JA 2VPEA 3ZPVE 5FB0A 2BAYA 1LDJB 4GNDA 2CKLA 4LKAA 5AITA 4YATA 2YYRA 5B79A 2RSDA 2YW8A 2KFTA 2KIZA 4PPEA 2MD8C 4A4BA 4S3OB 2MT5A 1WEEA 3MHHA 1WEOA 2LXPC 2KWNA 2CT2A 2YSJA 4F52B 5H1UA 2H0DB 1X4UA 2K16A 5H9MA 1MM2A 3SHBA 4LLBA 4V3KC 5TABA 3O36A 2ECVA 3SOXA 2LGGA 4PTBA 3RPGB 2H0DA 4FJCA 2Y1MA 3N9NA 2YQMA 2M6MA 3ZPV1 5LKXA 3VK6A 3GV4A 2YU4A 1WEUA 2LGLA 5B76A 1WIMA 4FIPA 3HCTA 2VP7A 3I2DA 4YBTA 4NN2A 2G6QA 1RMDA 1V87A 5J3XA 2JMJA 5FERA 2ECNA 3LQHA 5KH3A 5C11A 2K1JA 3LQIA 4V3LC 4CA1A 4CCGX 5G0FA 4GB0A 2ECWA 2KE1A 4MVTA 3O34A 4YAXA 1Z6UA 5TBNA 2YHNA 2JRJA 4S3OC 3QZVA 5B75A 2F6NA 3O70A 3IHPA 2VJFA 2E6SA 2MA5A 1WFKA 4YBSA 2KGGA 2XB1A 3SOUA 4I7DA 4AP4A 4TKPB 4P5OB 2YT5A 2Y43A 3KNVA 3L1ZB 5LKTA 1JM7B 4LADB 2M1RA 3EB5A 4WZ2A 4IC3A 3C6WA 1F62A 5G05B 2YQLA 3KQIA 3T7LA 1U6GB 2D8SA 4ZUXU 4W4UA 2NAAA 4QF3A 2LGKA 1E4UA 4YBMA 1JM7A 2K17A 4GNFA 1Z60A 4AUQB 2JMIA 1VFYA 3HCUA 4L7XA 3M99A 3O7AA 2L0BA 3MHSA 2YURA 1LDKC 3N9LA 4R7EA 4N3WA 5B8DA 3LQJA 4YADA 3T6RA 4X3GA 2LQ6A 2C2VS 4IC2A 3U5MA 1WEMA 1VD4A 2EA6A 2YSMA 2VNFA 3ASLA 2C2LA 5DINA 3FL2A 3KV5A 2I50A 1WENA 1FBVA 5TDRA 5LKZA 2M3HA 2ECGA 2E6RA 5B78A 3L11A 2PUYA 4A0CD 1Z2QA 2LDRA 2MUMA 2IDAA 3RTRB 4WZ3B 4I7BA 3SOWA 2VJFB 4XI1A 2MD7B 2QIZA 5LKUA 2CSZA 3U5NA 1CHCA 1G25A 2KR4A 4N4FA 4LJNA 1BORA 2KU3A 1WEPA 4LK9A 3V43A 1VYXA 4GNEA 4C9ZA 3ZYQA 4QF2A 2KGIA 2KWKA 4O64A 2KWJA 4UP0A 3N9MA 2L5UA 2HDPA 1FP0A 2L75A 2ZETC 4B7YC 3EB6A 3RPGC 1IYMA 3C5KA 2YUCA 5FB1A 3PURA 2EGPA 2AN6A 4R2YA 5LCWB 4UI9B 5DKAA 2G43A 2PNXA 4A49A 5JG6A 4WA6A 3ZVZB 4ZQLA 4AVXA 2LXHC 1HYIA 1WEQA 2YREA 2VPGA 3O37A 3U5OA 1WEWA 1WEVA 3ZVYA 5TDWA 1WILA 5D1KB 2K4DA 3N9QA 2L43A 3HCSA 5D1MB 2MA6A 2Y1NA 3M62A 2LGVA 2F42A 2MNYA 3DQVR 5FEYA 3N9OA 5AIUA 4YC9A 4MSXA 5G04B 4L58A 4I7CA 2YHOA 5B77A 5KH9A 3LRQA 3HTKC 1X4JA 4UP5A 3KV6A 2QICA 3GL6A 3PUQA 4R8PK 1WE9A 1MM3A 1T1HA 1WGMA 2LRIC 2FUUA 2DX8A 5D1LB 5H1TA 2KYUA 4AYCB 3PHDA 4WZ0A 3L1XA 1X4IA 2CSYA 1WESA 4BBQA 2G45A 2KREA 2ECJA 3O35A 2KWOA 2L80A 1HYJA 3NG2A 2EODA 2ECTA 2FUIA 4AYCA 1N87A 3U5PA 4A4CA 4GNGA 2HYED 5C13A 2LV9A 4BHWA 2ECIA 5EYAF 4FO9A 2OXQC 2VJEB 4FK5A 5I3LA 2LN0A 4ZDTA 3ZNIA 2UZGA 2VPBA 2MNZA 3O33A 5H1VA 3DPLR 2MIQA 1DVPA 3N9PA 2VJEA 3M63A 4B86C 2JMDA 2RI7A 4Q6FA 4YABA 2CKLB 2M85A 2FSAA 3ZTGA 1XWHA 2XEUA 5TRBA 1ZBDB 1JOCA 5KH7A 1K2FA 2QJ0A 2VPDA
chains in the Genus database with same CATH superfamily
2F6JA 2VPEA 3ZPVE 3T9KA 5FB0A 2BAYA 1LDJB 4GNDA 2CKLA 4LKAA 5AITA 4YATA 2YYRA 5B79A 2RSDA 2YW8A 2KFTA 2KIZA 4PPEA 2MD8C 4A4BA 4S3OB 2MT5A 1WEEA 3MHHA 1WEOA 2LXPC 2KWNA 2CT2A 2YSJA 2YVRA 4F52B 3DWDA 3Q1DA 5H1UA 2H0DB 4Z0OA 1X4UA 2K16A 5H9MA 1MM2A 3SHBA 4LLBA 4V3KC 5TABA 3O36A 2ECVA 3SOXA 2LGGA 4PTBA 3RPGB 3O47A 2H0DA 4FJCA 2Y1MA 3N9NA 2YQMA 2M6MA 3ZPV1 5LKXA 3VK6A 3GV4A 2YU4A 3LDYA 1WEUA 2LGLA 5B76A 1WIMA 4FIPA 3HCTA 2VP7A 3I2DA 4YBTA 4NN2A 2G6QA 1RMDA 1V87A 5J3XA 2JMJA 5FERA 2ECNA 3LQHA 5KH3A 5C11A 2K1JA 3LQIA 4V3LC 2DJAA 4CA1A 4CCGX 5G0FA 4GB0A 2ECWA 2KE1A 4MVTA 3O34A 4YAXA 1Z6UA 2XP0A 5TBNA 3JUEA 2YHNA 2JRJA 4S3OC 2CRRA 3QZVA 5B75A 2F6NA 3O70A 3IHPA 3FJUB 3H7HA 2VJFA 2EXUA 2E6SA 2MA5A 2XOCA 1WFKA 4YBSA 2KGGA 2XB1A 3SOUA 4I7DA 4AP4A 4TKPB 4P5OB 2YT5A 2Y43A 2CSVA 3KNVA 3L1ZB 5LKTA 1JM7B 4LADB 2M1RA 3EB5A 4WZ2A 4OGCA 4IC3A 2XOZA 3C6WA 1F62A 5G05B 2YQLA 2FD4A 2XOYA 3KQIA 3T7LA 1U6GB 4H9DA 2D8SA 4ZUXU 4W4UA 2NAAA 4QF3A 3SUBA 2LGKA 1E4UA 4YBMA 1JM7A 2K17A 4GNFA 1Z60A 2B0OE 2M13A 4AUQB 2JMIA 1VFYA 3HCUA 4L7XA 3M99A 3O7AA 2L0BA 3MHSA 2YURA 2KKYA 2IQJA 1LDKC 3N9LA 4QQ4A 4R7EA 4N3WA 4OGEA 3LQJA 5B8DA 4YADA 3T6RA 4X3GA 2LQ6A 2C2VS 4IC2A 3U5MA 1WEMA 3MDBC 1VD4A 2EA6A 2YSMA 2VNFA 3ASLA 5K3QA 2C2LA 5DINA 3FL2A 3KV5A 2I50A 1WENA 1FBVA 5TDRA 5LKZA 2M3HA 2ECGA 2E6RA 2CONA 5B78A 2JM3A 3L11A 2PUYA 4A0CD 1Z2QA 2LDRA 2MUMA 2IDAA 3RTRB 4WZ3B 2KKXA 4I7BA 3SOWA 2VJFB 4XI1A 2MD7B 2QIZA 5LKUA 2CSZA 3U5NA 1CHCA 1G25A 2KR4A 4N4FA 4LJNA 1BORA 2KU3A 1WEPA 3LVRE 4LK9A 3V43A 1VYXA 4GNEA 4C9ZA 3ZYQA 4QF2A 2KGIA 2KWKA 4O64A 2KWJA 2EGMA 4UP0A 3N9MA 2L5UA 3E2DA 5SVYA 2HDPA 1FP0A 2L75A 1DCQA 2ZETC 4B7YC 5SVXA 3EB6A 3RPGC 1IYMA 4F1PA 3C5KA 2YUCA 5FB1A 2P57A 3PURA 2EGPA 2AN6A 4R2YA 5LCWB 4UI9B 5DKAA 2G43A 2PNXA 4A49A 5JG6A 4WA6A 3ZVZB 4ZQLA 4AVXA 2LXHC 2DSMA 3KDEC 1HYIA 3LJUX 2RR4A 1WEQA 2YREA 2VPGA 3O37A 3U5OA 3M7KA 1WEWA 1WEVA 2MKEA 3ZVYA 5TDWA 1WILA 5D1KB 2K4DA 3N9QA 2D8UA 2L43A 3HCSA 2MA6A 2Y1NA 3M62A 2LGVA 5D1MB 2F42A 2MNYA 3DQVR 5FEYA 3FM8C 3N9OA 5AIUA 4YC9A 4MSXA 5G04B 3FANA 5SVIB 4L58A 4I7CA 2YHOA 1MBMA 5B77A 5KH9A 3LRQA 3HTKC 1X4JA 4UP5A 3KV6A 2QICA 3GL6A 3PUQA 4R8PK 1WE9A 1MM3A 1T1HA 1WGMA 5SVIA 2LRIC 2FUUA 2DX8A 5D1LB 2OWAA 5H1TA 2KYUA 4AYCB 3PHDA 4WZ0A 3L1XA 1X4IA 2CSYA 1WESA 4BBQA 2G45A 2KREA 2L7PA 2ECJA 3O35A 2KWOA 2L80A 1HYJA 3FEHA 3NG2A 2EODA 2ECTA 2FUIA 4AYCA 3FAOA 1N87A 3U5PA 4A4CA 4GNGA 2HYED 2FFWA 5C13A 2LV9A 4BHWA 2ECIA 5EYAF 4FO9A 2OXQC 2VJEB 4FK5A 5I3LA 2LN0A 4ZDTA 3ZNIA 2CRWA 2UZGA 2VPBA 3DDTA 2MNZA 3O33A 5H1VA 3DPLR 2MIQA 1DVPA 3N9PA 2LAUA 2VJEA 3M63A 4B86C 2JMDA 4O62A 2RI7A 4Q6FA 4YABA 2CKLB 2M85A 2FSAA 3ZTGA 1XWHA 2JUNA 2XEUA 5TRBA 1ZBDB 1JOCA 2E61A 5KH7A 3LVQE 1K2FA 4Z0RA 2QJ0A 2VPDA 3PLWA
chains in the Genus database with same CATH topology
2F6JA 2VPEA 3ZPVE 5FB0A 2BAYA 1LDJB 4GNDA 2CKLA 4LKAA 5AITA 4YATA 2YYRA 5B79A 2RSDA 2YW8A 2KFTA 2KIZA 4PPEA 2MD8C 4A4BA 4S3OB 2MT5A 1WEEA 3MHHA 1WEOA 2LXPC 2KWNA 2CT2A 2YSJA 4F52B 5H1UA 2H0DB 1X4UA 2K16A 5H9MA 1MM2A 3SHBA 4LLBA 4V3KC 5TABA 3O36A 2ECVA 3SOXA 2LGGA 4PTBA 3RPGB 2H0DA 4FJCA 2Y1MA 3N9NA 2YQMA 2M6MA 3ZPV1 5LKXA 3VK6A 3GV4A 2YU4A 1WEUA 2LGLA 5B76A 1WIMA 4FIPA 3HCTA 2VP7A 3I2DA 4YBTA 4NN2A 2G6QA 1RMDA 1V87A 5J3XA 2JMJA 5FERA 2ECNA 3LQHA 5KH3A 5C11A 2K1JA 3LQIA 4V3LC 4CA1A 4CCGX 5G0FA 4GB0A 2ECWA 2KE1A 4MVTA 3O34A 4YAXA 1Z6UA 5TBNA 2YHNA 2JRJA 4S3OC 3QZVA 5B75A 2F6NA 3O70A 3IHPA 2VJFA 2E6SA 2MA5A 1WFKA 4YBSA 2KGGA 2XB1A 3SOUA 4I7DA 4AP4A 4TKPB 4P5OB 2YT5A 2Y43A 3KNVA 3L1ZB 5LKTA 1JM7B 4LADB 2M1RA 3EB5A 4WZ2A 4IC3A 3C6WA 1F62A 5G05B 2YQLA 3KQIA 3T7LA 1U6GB 2D8SA 4ZUXU 4W4UA 2NAAA 4QF3A 2LGKA 1E4UA 4YBMA 1JM7A 2K17A 4GNFA 1Z60A 4AUQB 2JMIA 1VFYA 3HCUA 4L7XA 3M99A 3O7AA 2L0BA 3MHSA 2YURA 1LDKC 3N9LA 4R7EA 4N3WA 5B8DA 3LQJA 4YADA 3T6RA 4X3GA 2LQ6A 2C2VS 4IC2A 3U5MA 1WEMA 1VD4A 2EA6A 2YSMA 2VNFA 3ASLA 2C2LA 5DINA 3FL2A 3KV5A 2I50A 1WENA 1FBVA 5TDRA 5LKZA 2M3HA 2ECGA 2E6RA 5B78A 3L11A 2PUYA 4A0CD 1Z2QA 2LDRA 2MUMA 2IDAA 3RTRB 4WZ3B 4I7BA 3SOWA 2VJFB 4XI1A 2MD7B 2QIZA 5LKUA 2CSZA 3U5NA 1CHCA 1G25A 2KR4A 4N4FA 4LJNA 1BORA 2KU3A 1WEPA 4LK9A 3V43A 1VYXA 4GNEA 4C9ZA 3ZYQA 4QF2A 2KGIA 2KWKA 4O64A 2KWJA 4UP0A 3N9MA 2L5UA 2HDPA 1FP0A 2L75A 2ZETC 4B7YC 3EB6A 3RPGC 1IYMA 3C5KA 2YUCA 5FB1A 3PURA 2EGPA 2AN6A 4R2YA 5LCWB 4UI9B 5DKAA 2G43A 2PNXA 4A49A 5JG6A 4WA6A 3ZVZB 4ZQLA 4AVXA 2LXHC 1HYIA 1WEQA 2YREA 2VPGA 3O37A 3U5OA 1WEWA 1WEVA 3ZVYA 5TDWA 1WILA 5D1KB 2K4DA 3N9QA 2L43A 3HCSA 5D1MB 2MA6A 2Y1NA 3M62A 2LGVA 2F42A 2MNYA 3DQVR 5FEYA 3N9OA 5AIUA 4YC9A 4MSXA 5G04B 4L58A 4I7CA 2YHOA 5B77A 5KH9A 3LRQA 3HTKC 1X4JA 4UP5A 3KV6A 2QICA 3GL6A 3PUQA 4R8PK 1WE9A 1MM3A 1T1HA 1WGMA 2LRIC 2FUUA 2DX8A 5D1LB 5H1TA 2KYUA 4AYCB 3PHDA 4WZ0A 3L1XA 1X4IA 2CSYA 1WESA 4BBQA 2G45A 2KREA 2ECJA 3O35A 2KWOA 2L80A 1HYJA 3NG2A 2EODA 2ECTA 2FUIA 4AYCA 1N87A 3U5PA 4A4CA 4GNGA 2HYED 5C13A 2LV9A 4BHWA 2ECIA 5EYAF 4FO9A 2OXQC 2VJEB 4FK5A 5I3LA 2LN0A 4ZDTA 3ZNIA 2UZGA 2VPBA 2MNZA 3O33A 5H1VA 3DPLR 2MIQA 1DVPA 3N9PA 2VJEA 3M63A 4B86C 2JMDA 2RI7A 4Q6FA 4YABA 2CKLB 2M85A 2FSAA 3ZTGA 1XWHA 2XEUA 5TRBA 1ZBDB 1JOCA 5KH7A 1K2FA 2QJ0A 2VPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F6J A;  2VPE A;  3ZPV E;  5FB0 A;  2BAY A;  1LDJ B;  4GND A;  2CKL A;  4LKA A;  5AIT A;  4YAT A;  2YYR A;  5B79 A;  2RSD A;  2YW8 A;  2KFT A;  2KIZ A;  4PPE A;  2MD8 C;  4A4B A;  4S3O B;  2MT5 A;  1WEE A;  3MHH A;  1WEO A;  2LXP C;  2KWN A;  2CT2 A;  2YSJ A;  4F52 B;  5H1U A;  2H0D B;  1X4U A;  2K16 A;  5H9M A;  1MM2 A;  3SHB A;  4LLB A;  4V3K C;  5TAB A;  3O36 A;  2ECV A;  3SOX A;  2LGG A;  4PTB A;  3RPG B;  2H0D A;  4FJC A;  2Y1M A;  3N9N A;  2YQM A;  2M6M A;  3ZPV 1;  5LKX A;  3VK6 A;  3GV4 A;  2YU4 A;  1WEU A;  2LGL A;  5B76 A;  1WIM A;  4FIP A;  3HCT A;  2VP7 A;  3I2D A;  4YBT A;  4NN2 A;  2G6Q A;  1RMD A;  1V87 A;  5J3X A;  2JMJ A;  5FER A;  2ECN A;  3LQH A;  5KH3 A;  5C11 A;  2K1J A;  3LQI A;  4V3L C;  4CA1 A;  4CCG X;  5G0F A;  4GB0 A;  2ECW A;  2KE1 A;  4MVT A;  3O34 A;  4YAX A;  1Z6U A;  5TBN A;  2YHN A;  2JRJ A;  4S3O C;  3QZV A;  5B75 A;  2F6N A;  3O70 A;  3IHP A;  2VJF A;  2E6S A;  2MA5 A;  1WFK A;  4YBS A;  2KGG A;  2XB1 A;  3SOU A;  4I7D A;  4AP4 A;  4TKP B;  4P5O B;  2YT5 A;  2Y43 A;  3KNV A;  3L1Z B;  5LKT A;  1JM7 B;  4LAD B;  2M1R A;  3EB5 A;  4WZ2 A;  4IC3 A;  3C6W A;  1F62 A;  5G05 B;  2YQL A;  3KQI A;  3T7L A;  1U6G B;  2D8S A;  4ZUX U;  4W4U A;  2NAA A;  4QF3 A;  2LGK A;  1E4U A;  4YBM A;  1JM7 A;  2K17 A;  4GNF A;  1Z60 A;  4AUQ B;  2JMI A;  1VFY A;  3HCU A;  4L7X A;  3M99 A;  3O7A A;  2L0B A;  3MHS A;  2YUR A;  1LDK C;  3N9L A;  4R7E A;  4N3W A;  5B8D A;  3LQJ A;  4YAD A;  3T6R A;  4X3G A;  2LQ6 A;  2C2V S;  4IC2 A;  3U5M A;  1WEM A;  1VD4 A;  2EA6 A;  2YSM A;  2VNF A;  3ASL A;  2C2L A;  5DIN A;  3FL2 A;  3KV5 A;  2I50 A;  1WEN A;  1FBV A;  5TDR A;  5LKZ A;  2M3H A;  2ECG A;  2E6R A;  5B78 A;  3L11 A;  2PUY A;  4A0C D;  1Z2Q A;  2LDR A;  2MUM A;  2IDA A;  3RTR B;  4WZ3 B;  4I7B A;  3SOW A;  2VJF B;  4XI1 A;  2MD7 B;  2QIZ A;  5LKU A;  2CSZ A;  3U5N A;  1CHC A;  1G25 A;  2KR4 A;  4N4F A;  4LJN A;  1BOR A;  2KU3 A;  1WEP A;  4LK9 A;  3V43 A;  1VYX A;  4GNE A;  4C9Z A;  3ZYQ A;  4QF2 A;  2KGI A;  2KWK A;  4O64 A;  2KWJ A;  4UP0 A;  3N9M A;  2L5U A;  2HDP A;  1FP0 A;  2L75 A;  2ZET C;  4B7Y C;  3EB6 A;  3RPG C;  1IYM A;  3C5K A;  2YUC A;  5FB1 A;  3PUR A;  2EGP A;  2AN6 A;  4R2Y A;  5LCW B;  4UI9 B;  5DKA A;  2G43 A;  2PNX A;  4A49 A;  5JG6 A;  4WA6 A;  3ZVZ B;  4ZQL A;  4AVX A;  2LXH C;  1HYI A;  1WEQ A;  2YRE A;  2VPG A;  3O37 A;  3U5O A;  1WEW A;  1WEV A;  3ZVY A;  5TDW A;  1WIL A;  5D1K B;  2K4D A;  3N9Q A;  2L43 A;  3HCS A;  5D1M B;  2MA6 A;  2Y1N A;  3M62 A;  2LGV A;  2F42 A;  2MNY A;  3DQV R;  5FEY A;  3N9O A;  5AIU A;  4YC9 A;  4MSX A;  5G04 B;  4L58 A;  4I7C A;  2YHO A;  5B77 A;  5KH9 A;  3LRQ A;  3HTK C;  1X4J A;  4UP5 A;  3KV6 A;  2QIC A;  3GL6 A;  3PUQ A;  4R8P K;  1WE9 A;  1MM3 A;  1T1H A;  1WGM A;  2LRI C;  2FUU A;  2DX8 A;  5D1L B;  5H1T A;  2KYU A;  4AYC B;  3PHD A;  4WZ0 A;  3L1X A;  1X4I A;  2CSY A;  1WES A;  4BBQ A;  2G45 A;  2KRE A;  2ECJ A;  3O35 A;  2KWO A;  2L80 A;  1HYJ A;  3NG2 A;  2EOD A;  2ECT A;  2FUI A;  4AYC A;  1N87 A;  3U5P A;  4A4C A;  4GNG A;  2HYE D;  5C13 A;  2LV9 A;  4BHW A;  2ECI A;  5EYA F;  4FO9 A;  2OXQ C;  2VJE B;  4FK5 A;  5I3L A;  2LN0 A;  4ZDT A;  3ZNI A;  2UZG A;  2VPB A;  2MNZ A;  3O33 A;  5H1V A;  3DPL R;  2MIQ A;  1DVP A;  3N9P A;  2VJE A;  3M63 A;  4B86 C;  2JMD A;  2RI7 A;  4Q6F A;  4YAB A;  2CKL B;  2M85 A;  2FSA A;  3ZTG A;  1XWH A;  2XEU A;  5TRB A;  1ZBD B;  1JOC A;  5KH7 A;  1K2F A;  2QJ0 A;  2VPD A; 
#chains in the Genus database with same CATH topology
 2F6J A;  2VPE A;  3ZPV E;  3T9K A;  5FB0 A;  2BAY A;  1LDJ B;  4GND A;  2CKL A;  4LKA A;  5AIT A;  4YAT A;  2YYR A;  5B79 A;  2RSD A;  2YW8 A;  2KFT A;  2KIZ A;  4PPE A;  2MD8 C;  4A4B A;  4S3O B;  2MT5 A;  1WEE A;  3MHH A;  1WEO A;  2LXP C;  2KWN A;  2CT2 A;  2YSJ A;  2YVR A;  4F52 B;  3DWD A;  3Q1D A;  5H1U A;  2H0D B;  4Z0O A;  1X4U A;  2K16 A;  5H9M A;  1MM2 A;  3SHB A;  4LLB A;  4V3K C;  5TAB A;  3O36 A;  2ECV A;  3SOX A;  2LGG A;  4PTB A;  3RPG B;  3O47 A;  2H0D A;  4FJC A;  2Y1M A;  3N9N A;  2YQM A;  2M6M A;  3ZPV 1;  5LKX A;  3VK6 A;  3GV4 A;  2YU4 A;  3LDY A;  1WEU A;  2LGL A;  5B76 A;  1WIM A;  4FIP A;  3HCT A;  2VP7 A;  3I2D A;  4YBT A;  4NN2 A;  2G6Q A;  1RMD A;  1V87 A;  5J3X A;  2JMJ A;  5FER A;  2ECN A;  3LQH A;  5KH3 A;  5C11 A;  2K1J A;  3LQI A;  4V3L C;  2DJA A;  4CA1 A;  4CCG X;  5G0F A;  4GB0 A;  2ECW A;  2KE1 A;  4MVT A;  3O34 A;  4YAX A;  1Z6U A;  2XP0 A;  5TBN A;  3JUE A;  2YHN A;  2JRJ A;  4S3O C;  2CRR A;  3QZV A;  5B75 A;  2F6N A;  3O70 A;  3IHP A;  3FJU B;  3H7H A;  2VJF A;  2EXU A;  2E6S A;  2MA5 A;  2XOC A;  1WFK A;  4YBS A;  2KGG A;  2XB1 A;  3SOU A;  4I7D A;  4AP4 A;  4TKP B;  4P5O B;  2YT5 A;  2Y43 A;  2CSV A;  3KNV A;  3L1Z B;  5LKT A;  1JM7 B;  4LAD B;  2M1R A;  3EB5 A;  4WZ2 A;  4OGC A;  4IC3 A;  2XOZ A;  3C6W A;  1F62 A;  5G05 B;  2YQL A;  2FD4 A;  2XOY A;  3KQI A;  3T7L A;  1U6G B;  4H9D A;  2D8S A;  4ZUX U;  4W4U A;  2NAA A;  4QF3 A;  3SUB A;  2LGK A;  1E4U A;  4YBM A;  1JM7 A;  2K17 A;  4GNF A;  1Z60 A;  2B0O E;  2M13 A;  4AUQ B;  2JMI A;  1VFY A;  3HCU A;  4L7X A;  3M99 A;  3O7A A;  2L0B A;  3MHS A;  2YUR A;  2KKY A;  2IQJ A;  1LDK C;  3N9L A;  4QQ4 A;  4R7E A;  4N3W A;  4OGE A;  3LQJ A;  5B8D A;  4YAD A;  3T6R A;  4X3G A;  2LQ6 A;  2C2V S;  4IC2 A;  3U5M A;  1WEM A;  3MDB C;  1VD4 A;  2EA6 A;  2YSM A;  2VNF A;  3ASL A;  5K3Q A;  2C2L A;  5DIN A;  3FL2 A;  3KV5 A;  2I50 A;  1WEN A;  1FBV A;  5TDR A;  5LKZ A;  2M3H A;  2ECG A;  2E6R A;  2CON A;  5B78 A;  2JM3 A;  3L11 A;  2PUY A;  4A0C D;  1Z2Q A;  2LDR A;  2MUM A;  2IDA A;  3RTR B;  4WZ3 B;  2KKX A;  4I7B A;  3SOW A;  2VJF B;  4XI1 A;  2MD7 B;  2QIZ A;  5LKU A;  2CSZ A;  3U5N A;  1CHC A;  1G25 A;  2KR4 A;  4N4F A;  4LJN A;  1BOR A;  2KU3 A;  1WEP A;  3LVR E;  4LK9 A;  3V43 A;  1VYX A;  4GNE A;  4C9Z A;  3ZYQ A;  4QF2 A;  2KGI A;  2KWK A;  4O64 A;  2KWJ A;  2EGM A;  4UP0 A;  3N9M A;  2L5U A;  3E2D A;  5SVY A;  2HDP A;  1FP0 A;  2L75 A;  1DCQ A;  2ZET C;  4B7Y C;  5SVX A;  3EB6 A;  3RPG C;  1IYM A;  4F1P A;  3C5K A;  2YUC A;  5FB1 A;  2P57 A;  3PUR A;  2EGP A;  2AN6 A;  4R2Y A;  5LCW B;  4UI9 B;  5DKA A;  2G43 A;  2PNX A;  4A49 A;  5JG6 A;  4WA6 A;  3ZVZ B;  4ZQL A;  4AVX A;  2LXH C;  2DSM A;  3KDE C;  1HYI A;  3LJU X;  2RR4 A;  1WEQ A;  2YRE A;  2VPG A;  3O37 A;  3U5O A;  3M7K A;  1WEW A;  1WEV A;  2MKE A;  3ZVY A;  5TDW A;  1WIL A;  5D1K B;  2K4D A;  3N9Q A;  2D8U A;  2L43 A;  3HCS A;  2MA6 A;  2Y1N A;  3M62 A;  2LGV A;  5D1M B;  2F42 A;  2MNY A;  3DQV R;  5FEY A;  3FM8 C;  3N9O A;  5AIU A;  4YC9 A;  4MSX A;  5G04 B;  3FAN A;  5SVI B;  4L58 A;  4I7C A;  2YHO A;  1MBM A;  5B77 A;  5KH9 A;  3LRQ A;  3HTK C;  1X4J A;  4UP5 A;  3KV6 A;  2QIC A;  3GL6 A;  3PUQ A;  4R8P K;  1WE9 A;  1MM3 A;  1T1H A;  1WGM A;  5SVI A;  2LRI C;  2FUU A;  2DX8 A;  5D1L B;  2OWA A;  5H1T A;  2KYU A;  4AYC B;  3PHD A;  4WZ0 A;  3L1X A;  1X4I A;  2CSY A;  1WES A;  4BBQ A;  2G45 A;  2KRE A;  2L7P A;  2ECJ A;  3O35 A;  2KWO A;  2L80 A;  1HYJ A;  3FEH A;  3NG2 A;  2EOD A;  2ECT A;  2FUI A;  4AYC A;  3FAO A;  1N87 A;  3U5P A;  4A4C A;  4GNG A;  2HYE D;  2FFW A;  5C13 A;  2LV9 A;  4BHW A;  2ECI A;  5EYA F;  4FO9 A;  2OXQ C;  2VJE B;  4FK5 A;  5I3L A;  2LN0 A;  4ZDT A;  3ZNI A;  2CRW A;  2UZG A;  2VPB A;  3DDT A;  2MNZ A;  3O33 A;  5H1V A;  3DPL R;  2MIQ A;  1DVP A;  3N9P A;  2LAU A;  2VJE A;  3M63 A;  4B86 C;  2JMD A;  4O62 A;  2RI7 A;  4Q6F A;  4YAB A;  2CKL B;  2M85 A;  2FSA A;  3ZTG A;  1XWH A;  2JUN A;  2XEU A;  5TRB A;  1ZBD B;  1JOC A;  2E61 A;  5KH7 A;  3LVQ E;  1K2F A;  4Z0R A;  2QJ0 A;  2VPD A;  3PLW A; 
#chains in the Genus database with same CATH homology
 2F6J A;  2VPE A;  3ZPV E;  5FB0 A;  2BAY A;  1LDJ B;  4GND A;  2CKL A;  4LKA A;  5AIT A;  4YAT A;  2YYR A;  5B79 A;  2RSD A;  2YW8 A;  2KFT A;  2KIZ A;  4PPE A;  2MD8 C;  4A4B A;  4S3O B;  2MT5 A;  1WEE A;  3MHH A;  1WEO A;  2LXP C;  2KWN A;  2CT2 A;  2YSJ A;  4F52 B;  5H1U A;  2H0D B;  1X4U A;  2K16 A;  5H9M A;  1MM2 A;  3SHB A;  4LLB A;  4V3K C;  5TAB A;  3O36 A;  2ECV A;  3SOX A;  2LGG A;  4PTB A;  3RPG B;  2H0D A;  4FJC A;  2Y1M A;  3N9N A;  2YQM A;  2M6M A;  3ZPV 1;  5LKX A;  3VK6 A;  3GV4 A;  2YU4 A;  1WEU A;  2LGL A;  5B76 A;  1WIM A;  4FIP A;  3HCT A;  2VP7 A;  3I2D A;  4YBT A;  4NN2 A;  2G6Q A;  1RMD A;  1V87 A;  5J3X A;  2JMJ A;  5FER A;  2ECN A;  3LQH A;  5KH3 A;  5C11 A;  2K1J A;  3LQI A;  4V3L C;  4CA1 A;  4CCG X;  5G0F A;  4GB0 A;  2ECW A;  2KE1 A;  4MVT A;  3O34 A;  4YAX A;  1Z6U A;  5TBN A;  2YHN A;  2JRJ A;  4S3O C;  3QZV A;  5B75 A;  2F6N A;  3O70 A;  3IHP A;  2VJF A;  2E6S A;  2MA5 A;  1WFK A;  4YBS A;  2KGG A;  2XB1 A;  3SOU A;  4I7D A;  4AP4 A;  4TKP B;  4P5O B;  2YT5 A;  2Y43 A;  3KNV A;  3L1Z B;  5LKT A;  1JM7 B;  4LAD B;  2M1R A;  3EB5 A;  4WZ2 A;  4IC3 A;  3C6W A;  1F62 A;  5G05 B;  2YQL A;  3KQI A;  3T7L A;  1U6G B;  2D8S A;  4ZUX U;  4W4U A;  2NAA A;  4QF3 A;  2LGK A;  1E4U A;  4YBM A;  1JM7 A;  2K17 A;  4GNF A;  1Z60 A;  4AUQ B;  2JMI A;  1VFY A;  3HCU A;  4L7X A;  3M99 A;  3O7A A;  2L0B A;  3MHS A;  2YUR A;  1LDK C;  3N9L A;  4R7E A;  4N3W A;  5B8D A;  3LQJ A;  4YAD A;  3T6R A;  4X3G A;  2LQ6 A;  2C2V S;  4IC2 A;  3U5M A;  1WEM A;  1VD4 A;  2EA6 A;  2YSM A;  2VNF A;  3ASL A;  2C2L A;  5DIN A;  3FL2 A;  3KV5 A;  2I50 A;  1WEN A;  1FBV A;  5TDR A;  5LKZ A;  2M3H A;  2ECG A;  2E6R A;  5B78 A;  3L11 A;  2PUY A;  4A0C D;  1Z2Q A;  2LDR A;  2MUM A;  2IDA A;  3RTR B;  4WZ3 B;  4I7B A;  3SOW A;  2VJF B;  4XI1 A;  2MD7 B;  2QIZ A;  5LKU A;  2CSZ A;  3U5N A;  1CHC A;  1G25 A;  2KR4 A;  4N4F A;  4LJN A;  1BOR A;  2KU3 A;  1WEP A;  4LK9 A;  3V43 A;  1VYX A;  4GNE A;  4C9Z A;  3ZYQ A;  4QF2 A;  2KGI A;  2KWK A;  4O64 A;  2KWJ A;  4UP0 A;  3N9M A;  2L5U A;  2HDP A;  1FP0 A;  2L75 A;  2ZET C;  4B7Y C;  3EB6 A;  3RPG C;  1IYM A;  3C5K A;  2YUC A;  5FB1 A;  3PUR A;  2EGP A;  2AN6 A;  4R2Y A;  5LCW B;  4UI9 B;  5DKA A;  2G43 A;  2PNX A;  4A49 A;  5JG6 A;  4WA6 A;  3ZVZ B;  4ZQL A;  4AVX A;  2LXH C;  1HYI A;  1WEQ A;  2YRE A;  2VPG A;  3O37 A;  3U5O A;  1WEW A;  1WEV A;  3ZVY A;  5TDW A;  1WIL A;  5D1K B;  2K4D A;  3N9Q A;  2L43 A;  3HCS A;  5D1M B;  2MA6 A;  2Y1N A;  3M62 A;  2LGV A;  2F42 A;  2MNY A;  3DQV R;  5FEY A;  3N9O A;  5AIU A;  4YC9 A;  4MSX A;  5G04 B;  4L58 A;  4I7C A;  2YHO A;  5B77 A;  5KH9 A;  3LRQ A;  3HTK C;  1X4J A;  4UP5 A;  3KV6 A;  2QIC A;  3GL6 A;  3PUQ A;  4R8P K;  1WE9 A;  1MM3 A;  1T1H A;  1WGM A;  2LRI C;  2FUU A;  2DX8 A;  5D1L B;  5H1T A;  2KYU A;  4AYC B;  3PHD A;  4WZ0 A;  3L1X A;  1X4I A;  2CSY A;  1WES A;  4BBQ A;  2G45 A;  2KRE A;  2ECJ A;  3O35 A;  2KWO A;  2L80 A;  1HYJ A;  3NG2 A;  2EOD A;  2ECT A;  2FUI A;  4AYC A;  1N87 A;  3U5P A;  4A4C A;  4GNG A;  2HYE D;  5C13 A;  2LV9 A;  4BHW A;  2ECI A;  5EYA F;  4FO9 A;  2OXQ C;  2VJE B;  4FK5 A;  5I3L A;  2LN0 A;  4ZDT A;  3ZNI A;  2UZG A;  2VPB A;  2MNZ A;  3O33 A;  5H1V A;  3DPL R;  2MIQ A;  1DVP A;  3N9P A;  2VJE A;  3M63 A;  4B86 C;  2JMD A;  2RI7 A;  4Q6F A;  4YAB A;  2CKL B;  2M85 A;  2FSA A;  3ZTG A;  1XWH A;  2XEU A;  5TRB A;  1ZBD B;  1JOC A;  5KH7 A;  1K2F A;  2QJ0 A;  2VPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...