2MNZA

Nmr structure of kdm5b phd1 finger in complex with h3k4me0(1-10aa)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
55
structure length
55
Chain Sequence
AVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 5B
publication title The PHD1 finger of KDM5B recognizes unmodified H3K4 during the demethylation of histone H3K4me2/3 by KDM5B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 6
structure length 55
sequence length 55
ec nomenclature ec 1.14.11.-:
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2mnzA00
3M63A 1VD4A 3M62A 4B7YC 2ECVA 2LGVA 2FUUA 4R2YA 5LKZA 5H9MA 4P5OB 2JMDA 5DINA 2KR4A 5LKUA 4CA1A 4O64A 3EB5A 3N9QA 4MVTA 3EB6A 3O7AA 1E4UA 4UP5A 2KWKA 1RMDA 3LRQA 5JG6A 1MM3A 3C6WA 2MIQA 2F6JA 2PNXA 1VYXA 5AIUA 5H1UA 2YSMA 4WZ3B 4YC9A 1HYJA 5FEYA 5C11A 2EODA 4LJNA 3PUQA 2CKLB 2UZGA 4W4UA 4YAXA 4QF3A 4R8PK 5G0FA 2HDPA 3N9LA 2LN0A 3O36A 4FK5A 4BBQA 1WEVA 2L80A 3SHBA 5B79A 2XB1A 3L1XA 1WEUA 3FL2A 1HYIA 2L43A 2ECWA 3LQIA 2VNFA 4GNFA 3U5NA 3L1ZB 2FUIA 2YU4A 3N9NA 2RSDA 3I2DA 3U5OA 2ECJA 2VJFA 3SOUA 4N4FA 2M1RA 3MHHA 2YHOA 2YSJA 1F62A 1JM7B 2VJEB 1X4JA 2KREA 2I50A 3N9MA 2QIZA 5KH3A 3KNVA 3V43A 2LXHC 4LADB 4YATA 4QF2A 3ASLA 2K17A 2KU3A 4GB0A 5DKAA 4AP4A 2KWOA 1CHCA 2E6RA 1BORA 4FIPA 5G04B 4A49A 2KWJA 5B75A 2LGLA 5TDRA 1X4IA 2YQLA 2QICA 4L7XA 2ECNA 4LK9A 5FB0A 4ZQLA 1WGMA 5D1MB 2KE1A 1WILA 2MUMA 2JMIA 3DQVR 4UP0A 1WIMA 4A0CD 4AVXA 2LV9A 4N3WA 4ZUXU 2YHNA 2M3HA 3ZPV1 2L0BA 4LKAA 2LXPC 4GNDA 3MHSA 2IDAA 3LQJA 5LKXA 2EA6A 2YT5A 2G43A 2CT2A 5KH9A 2OXQC 1LDKC 1T1HA 3VK6A 4FJCA 3T6RA 2LQ6A 2CKLA 5TRBA 1WEPA 1DVPA 1ZBDB 1WEQA 3M99A 1WESA 4S3OB 2MNZA 3NG2A 4YBTA 2ECIA 3O35A 4A4BA 1Z60A 2FSAA 2YURA 5H1TA 1U6GB 2K1JA 2VPBA 4GNEA 1FBVA 4R7EA 2M85A 4UI9B 3ZTGA 3ZVYA 2YREA 1WEMA 5I3LA 4X3GA 5D1LB 2MNYA 5G05B 4FO9A 4GNGA 1JM7A 3KQIA 2VJEA 2KGGA 3HCTA 3QZVA 3GL6A 2HYED 3PURA 2MA6A 3T7LA 3SOXA 4ZDTA 2ECGA 2ZETC 5B76A 4Q6FA 5AITA 1JOCA 2MA5A 4A4CA 4BHWA 4AYCB 3RPGB 4V3KC 2ECTA 2YW8A 4I7DA 2JRJA 4MSXA 3KV5A 4LLBA 3ZNIA 2LDRA 2NAAA 1X4UA 3HTKC 1G25A 4B86C 4PTBA 5H1VA 1FP0A 2H0DB 2Y1NA 2F42A 2LRIC 2PUYA 4WZ2A 3DPLR 2E6SA 5B78A 4F52B 3N9PA 3O34A 2MD8C 5TDWA 3HCSA 4YADA 2Y43A 4YBMA 2KYUA 2VPGA 3HCUA 5B77A 2LGGA 1VFYA 5C13A 2KWNA 2DX8A 2M6MA 4YBSA 4TKPB 5TABA 3U5PA 2YQMA 2F6NA 2YUCA 3ZVZB 1K2FA 2L5UA 3LQHA 5TBNA 2G6QA 4IC3A 4XI1A 3O33A 3IHPA 3RPGC 4CCGX 2D8SA 5FERA 5KH7A 2CSZA 2KGIA 2XEUA 3U5MA 2RI7A 2VPEA 5D1KB 2K4DA 2BAYA 1V87A 4YABA 2KFTA 1N87A 2G45A 2QJ0A 1WEWA 1IYMA 3SOWA 3PHDA 3ZYQA 2CSYA 2L75A 4IC2A 4WZ0A 2VPDA 4AUQB 3GV4A 2MT5A 1WFKA 5FB1A 3RTRB 3KV6A 5EYAF 2JMJA 2C2LA 4AYCA 3O37A 3O70A 1WEEA 2YYRA 3L11A 3C5KA 3N9OA 1WE9A 4I7BA 2VJFB 2LGKA 1Z6UA 2K16A 3ZPVE 2VP7A 5LCWB 4S3OC 2H0DA 4NN2A 5LKTA 1WENA 1XWHA 1WEOA 4L58A 4C9ZA 2KIZA 2MD7B 4PPEA 1LDJB 2EGPA 2Y1MA 4WA6A 4I7CA 5J3XA 5B8DA 1MM2A 1Z2QA 2C2VS 4V3LC 2AN6A
chains in the Genus database with same CATH superfamily
3M63A 1VD4A 3M62A 4B7YC 2ECVA 3E2DA 2LGVA 2FUUA 2YVRA 4R2YA 5LKZA 5H9MA 4P5OB 2JMDA 5DINA 2KR4A 5LKUA 4CA1A 4O64A 3EB5A 3N9QA 4MVTA 3EB6A 3O7AA 1E4UA 4UP5A 2KWKA 1RMDA 3LRQA 5JG6A 1MM3A 3C6WA 2MIQA 2F6JA 2PNXA 1VYXA 2MKEA 2CONA 5AIUA 5H1UA 2YSMA 4WZ3B 4YC9A 1HYJA 5FEYA 5C11A 2EODA 4LJNA 3PUQA 2CKLB 2UZGA 4W4UA 3H7HA 4YAXA 4QF3A 4R8PK 3M7KA 5G0FA 2HDPA 3N9LA 2LN0A 3O36A 4FK5A 4BBQA 1WEVA 2L80A 3SHBA 5B79A 2XB1A 3L1XA 1WEUA 3FL2A 1HYIA 2M13A 2L43A 2ECWA 3LQIA 2VNFA 4GNFA 3U5NA 3L1ZB 2FUIA 2YU4A 3N9NA 2RSDA 3I2DA 3U5OA 2ECJA 3FM8C 2VJFA 3SOUA 4N4FA 2DJAA 2M1RA 5SVXA 3MHHA 2YHOA 2YSJA 3FAOA 1F62A 1JM7B 2VJEB 1X4JA 2KREA 2EXUA 2I50A 3FEHA 2KKYA 2JM3A 4F1PA 3N9MA 5K3QA 2QIZA 5KH3A 3KNVA 3V43A 2LXHC 4LADB 4YATA 4QF2A 3ASLA 2K17A 2KU3A 4GB0A 5DKAA 4AP4A 2KWOA 1CHCA 1MBMA 2E6RA 1BORA 3JUEA 4FIPA 5SVYA 3LDYA 5G04B 4A49A 2KWJA 5B75A 2LGLA 5TDRA 1X4IA 2YQLA 2QICA 4L7XA 2ECNA 4LK9A 5FB0A 4ZQLA 1WGMA 2JUNA 5D1MB 2KE1A 1WILA 2MUMA 2JMIA 3DQVR 4UP0A 1WIMA 4OGEA 4A0CD 4AVXA 2LV9A 4N3WA 4ZUXU 2YHNA 2M3HA 3ZPV1 2L0BA 4LKAA 2LXPC 4GNDA 3MHSA 2IDAA 3LQJA 5LKXA 2EA6A 2YT5A 2G43A 2CT2A 5KH9A 2OXQC 1LDKC 1T1HA 3VK6A 4FJCA 3T6RA 4OGCA 2LQ6A 2CKLA 5TRBA 1WEPA 1DVPA 1ZBDB 1WEQA 3M99A 1WESA 4S3OB 2MNZA 3NG2A 4YBTA 3DWDA 2ECIA 3O35A 3FANA 4A4BA 1Z60A 2RR4A 2FSAA 2YURA 5H1TA 1U6GB 2K1JA 2VPBA 4GNEA 1FBVA 2LAUA 2M85A 4R7EA 4UI9B 2P57A 3ZTGA 3ZVYA 2YREA 2B0OE 1WEMA 5I3LA 2CRWA 3LJUX 2EGMA 4X3GA 4O62A 2MNYA 5D1LB 5G05B 4FO9A 4GNGA 1JM7A 3KQIA 2VJEA 4Z0RA 2KGGA 3HCTA 3QZVA 3GL6A 2HYED 3PURA 2MA6A 3T7LA 3SOXA 4ZDTA 2ECGA 2ZETC 5B76A 4H9DA 4Q6FA 5AITA 3Q1DA 1JOCA 2MA5A 2XOCA 1DCQA 3KDEC 4A4CA 4BHWA 2FFWA 4AYCB 3RPGB 4V3KC 2ECTA 2E61A 2YW8A 4I7DA 2JRJA 4MSXA 2XOYA 3MDBC 3KV5A 4LLBA 5SVIB 3DDTA 3ZNIA 2LDRA 2FD4A 1X4UA 2NAAA 3FJUB 3HTKC 1G25A 4B86C 2XP0A 4PTBA 5H1VA 1FP0A 2H0DB 2Y1NA 2F42A 2LRIC 2PUYA 4WZ2A 3DPLR 2E6SA 5B78A 4F52B 3N9PA 3PLWA 2CSVA 3LVQE 3O34A 2MD8C 5TDWA 3HCSA 4YADA 2Y43A 4YBMA 2KYUA 2VPGA 3HCUA 5B77A 2LGGA 2XOZA 1VFYA 5C13A 2KWNA 2DX8A 2M6MA 4YBSA 2KKXA 4TKPB 5TABA 3U5PA 2YQMA 2F6NA 2YUCA 3ZVZB 1K2FA 2L5UA 3LQHA 2L7PA 5TBNA 2G6QA 4IC3A 4XI1A 3O33A 3IHPA 3RPGC 4CCGX 2D8SA 5FERA 5KH7A 2CSZA 2KGIA 2XEUA 3U5MA 2RI7A 2VPEA 5D1KB 2K4DA 2BAYA 2IQJA 1V87A 4YABA 2KFTA 1N87A 2G45A 2QJ0A 1WEWA 1IYMA 3SOWA 3PHDA 3ZYQA 2CSYA 2L75A 4IC2A 4WZ0A 2VPDA 3LVRE 4AUQB 3GV4A 2MT5A 1WFKA 5FB1A 3RTRB 2OWAA 3KV6A 5EYAF 2JMJA 2C2LA 4Z0OA 4QQ4A 4AYCA 3O37A 3O70A 1WEEA 2YYRA 3L11A 3C5KA 3N9OA 1WE9A 5SVIA 4I7BA 3O47A 2VJFB 2LGKA 1Z6UA 2K16A 3ZPVE 2VP7A 5LCWB 4S3OC 2H0DA 4NN2A 3T9KA 5LKTA 1WENA 1XWHA 1WEOA 4L58A 3SUBA 2DSMA 4C9ZA 2KIZA 2MD7B 4PPEA 1LDJB 2EGPA 2Y1MA 4WA6A 2D8UA 4I7CA 5J3XA 5B8DA 1MM2A 1Z2QA 2C2VS 4V3LC 2AN6A 2CRRA
chains in the Genus database with same CATH topology
3M63A 1VD4A 3M62A 4B7YC 2ECVA 2LGVA 2FUUA 4R2YA 5LKZA 5H9MA 4P5OB 2JMDA 5DINA 2KR4A 5LKUA 4CA1A 4O64A 3EB5A 3N9QA 4MVTA 3EB6A 3O7AA 1E4UA 4UP5A 2KWKA 1RMDA 3LRQA 5JG6A 1MM3A 3C6WA 2MIQA 2F6JA 2PNXA 1VYXA 5AIUA 5H1UA 2YSMA 4WZ3B 4YC9A 1HYJA 5FEYA 5C11A 2EODA 4LJNA 3PUQA 2CKLB 2UZGA 4W4UA 4YAXA 4QF3A 4R8PK 5G0FA 2HDPA 3N9LA 2LN0A 3O36A 4FK5A 4BBQA 1WEVA 2L80A 3SHBA 5B79A 2XB1A 3L1XA 1WEUA 3FL2A 1HYIA 2L43A 2ECWA 3LQIA 2VNFA 4GNFA 3U5NA 3L1ZB 2FUIA 2YU4A 3N9NA 2RSDA 3I2DA 3U5OA 2ECJA 2VJFA 3SOUA 4N4FA 2M1RA 3MHHA 2YHOA 2YSJA 1F62A 1JM7B 2VJEB 1X4JA 2KREA 2I50A 3N9MA 2QIZA 5KH3A 3KNVA 3V43A 2LXHC 4LADB 4YATA 4QF2A 3ASLA 2K17A 2KU3A 4GB0A 5DKAA 4AP4A 2KWOA 1CHCA 2E6RA 1BORA 4FIPA 5G04B 4A49A 2KWJA 5B75A 2LGLA 5TDRA 1X4IA 2YQLA 2QICA 4L7XA 2ECNA 4LK9A 5FB0A 4ZQLA 1WGMA 5D1MB 2KE1A 1WILA 2MUMA 2JMIA 3DQVR 4UP0A 1WIMA 4A0CD 4AVXA 2LV9A 4N3WA 4ZUXU 2YHNA 2M3HA 3ZPV1 2L0BA 4LKAA 2LXPC 4GNDA 3MHSA 2IDAA 3LQJA 5LKXA 2EA6A 2YT5A 2G43A 2CT2A 5KH9A 2OXQC 1LDKC 1T1HA 3VK6A 4FJCA 3T6RA 2LQ6A 2CKLA 5TRBA 1WEPA 1DVPA 1ZBDB 1WEQA 3M99A 1WESA 4S3OB 2MNZA 3NG2A 4YBTA 2ECIA 3O35A 4A4BA 1Z60A 2FSAA 2YURA 5H1TA 1U6GB 2K1JA 2VPBA 4GNEA 1FBVA 4R7EA 2M85A 4UI9B 3ZTGA 3ZVYA 2YREA 1WEMA 5I3LA 4X3GA 5D1LB 2MNYA 5G05B 4FO9A 4GNGA 1JM7A 3KQIA 2VJEA 2KGGA 3HCTA 3QZVA 3GL6A 2HYED 3PURA 2MA6A 3T7LA 3SOXA 4ZDTA 2ECGA 2ZETC 5B76A 4Q6FA 5AITA 1JOCA 2MA5A 4A4CA 4BHWA 4AYCB 3RPGB 4V3KC 2ECTA 2YW8A 4I7DA 2JRJA 4MSXA 3KV5A 4LLBA 3ZNIA 2LDRA 2NAAA 1X4UA 3HTKC 1G25A 4B86C 4PTBA 5H1VA 1FP0A 2H0DB 2Y1NA 2F42A 2LRIC 2PUYA 4WZ2A 3DPLR 2E6SA 5B78A 4F52B 3N9PA 3O34A 2MD8C 5TDWA 3HCSA 4YADA 2Y43A 4YBMA 2KYUA 2VPGA 3HCUA 5B77A 2LGGA 1VFYA 5C13A 2KWNA 2DX8A 2M6MA 4YBSA 4TKPB 5TABA 3U5PA 2YQMA 2F6NA 2YUCA 3ZVZB 1K2FA 2L5UA 3LQHA 5TBNA 2G6QA 4IC3A 4XI1A 3O33A 3IHPA 3RPGC 4CCGX 2D8SA 5FERA 5KH7A 2CSZA 2KGIA 2XEUA 3U5MA 2RI7A 2VPEA 5D1KB 2K4DA 2BAYA 1V87A 4YABA 2KFTA 1N87A 2G45A 2QJ0A 1WEWA 1IYMA 3SOWA 3PHDA 3ZYQA 2CSYA 2L75A 4IC2A 4WZ0A 2VPDA 4AUQB 3GV4A 2MT5A 1WFKA 5FB1A 3RTRB 3KV6A 5EYAF 2JMJA 2C2LA 4AYCA 3O37A 3O70A 1WEEA 2YYRA 3L11A 3C5KA 3N9OA 1WE9A 4I7BA 2VJFB 2LGKA 1Z6UA 2K16A 3ZPVE 2VP7A 5LCWB 4S3OC 2H0DA 4NN2A 5LKTA 1WENA 1XWHA 1WEOA 4L58A 4C9ZA 2KIZA 2MD7B 4PPEA 1LDJB 2EGPA 2Y1MA 4WA6A 4I7CA 5J3XA 5B8DA 1MM2A 1Z2QA 2C2VS 4V3LC 2AN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 A;  1VD4 A;  3M62 A;  4B7Y C;  2ECV A;  2LGV A;  2FUU A;  4R2Y A;  5LKZ A;  5H9M A;  4P5O B;  2JMD A;  5DIN A;  2KR4 A;  5LKU A;  4CA1 A;  4O64 A;  3EB5 A;  3N9Q A;  4MVT A;  3EB6 A;  3O7A A;  1E4U A;  4UP5 A;  2KWK A;  1RMD A;  3LRQ A;  5JG6 A;  1MM3 A;  3C6W A;  2MIQ A;  2F6J A;  2PNX A;  1VYX A;  5AIU A;  5H1U A;  2YSM A;  4WZ3 B;  4YC9 A;  1HYJ A;  5FEY A;  5C11 A;  2EOD A;  4LJN A;  3PUQ A;  2CKL B;  2UZG A;  4W4U A;  4YAX A;  4QF3 A;  4R8P K;  5G0F A;  2HDP A;  3N9L A;  2LN0 A;  3O36 A;  4FK5 A;  4BBQ A;  1WEV A;  2L80 A;  3SHB A;  5B79 A;  2XB1 A;  3L1X A;  1WEU A;  3FL2 A;  1HYI A;  2L43 A;  2ECW A;  3LQI A;  2VNF A;  4GNF A;  3U5N A;  3L1Z B;  2FUI A;  2YU4 A;  3N9N A;  2RSD A;  3I2D A;  3U5O A;  2ECJ A;  2VJF A;  3SOU A;  4N4F A;  2M1R A;  3MHH A;  2YHO A;  2YSJ A;  1F62 A;  1JM7 B;  2VJE B;  1X4J A;  2KRE A;  2I50 A;  3N9M A;  2QIZ A;  5KH3 A;  3KNV A;  3V43 A;  2LXH C;  4LAD B;  4YAT A;  4QF2 A;  3ASL A;  2K17 A;  2KU3 A;  4GB0 A;  5DKA A;  4AP4 A;  2KWO A;  1CHC A;  2E6R A;  1BOR A;  4FIP A;  5G04 B;  4A49 A;  2KWJ A;  5B75 A;  2LGL A;  5TDR A;  1X4I A;  2YQL A;  2QIC A;  4L7X A;  2ECN A;  4LK9 A;  5FB0 A;  4ZQL A;  1WGM A;  5D1M B;  2KE1 A;  1WIL A;  2MUM A;  2JMI A;  3DQV R;  4UP0 A;  1WIM A;  4A0C D;  4AVX A;  2LV9 A;  4N3W A;  4ZUX U;  2YHN A;  2M3H A;  3ZPV 1;  2L0B A;  4LKA A;  2LXP C;  4GND A;  3MHS A;  2IDA A;  3LQJ A;  5LKX A;  2EA6 A;  2YT5 A;  2G43 A;  2CT2 A;  5KH9 A;  2OXQ C;  1LDK C;  1T1H A;  3VK6 A;  4FJC A;  3T6R A;  2LQ6 A;  2CKL A;  5TRB A;  1WEP A;  1DVP A;  1ZBD B;  1WEQ A;  3M99 A;  1WES A;  4S3O B;  2MNZ A;  3NG2 A;  4YBT A;  2ECI A;  3O35 A;  4A4B A;  1Z60 A;  2FSA A;  2YUR A;  5H1T A;  1U6G B;  2K1J A;  2VPB A;  4GNE A;  1FBV A;  4R7E A;  2M85 A;  4UI9 B;  3ZTG A;  3ZVY A;  2YRE A;  1WEM A;  5I3L A;  4X3G A;  5D1L B;  2MNY A;  5G05 B;  4FO9 A;  4GNG A;  1JM7 A;  3KQI A;  2VJE A;  2KGG A;  3HCT A;  3QZV A;  3GL6 A;  2HYE D;  3PUR A;  2MA6 A;  3T7L A;  3SOX A;  4ZDT A;  2ECG A;  2ZET C;  5B76 A;  4Q6F A;  5AIT A;  1JOC A;  2MA5 A;  4A4C A;  4BHW A;  4AYC B;  3RPG B;  4V3K C;  2ECT A;  2YW8 A;  4I7D A;  2JRJ A;  4MSX A;  3KV5 A;  4LLB A;  3ZNI A;  2LDR A;  2NAA A;  1X4U A;  3HTK C;  1G25 A;  4B86 C;  4PTB A;  5H1V A;  1FP0 A;  2H0D B;  2Y1N A;  2F42 A;  2LRI C;  2PUY A;  4WZ2 A;  3DPL R;  2E6S A;  5B78 A;  4F52 B;  3N9P A;  3O34 A;  2MD8 C;  5TDW A;  3HCS A;  4YAD A;  2Y43 A;  4YBM A;  2KYU A;  2VPG A;  3HCU A;  5B77 A;  2LGG A;  1VFY A;  5C13 A;  2KWN A;  2DX8 A;  2M6M A;  4YBS A;  4TKP B;  5TAB A;  3U5P A;  2YQM A;  2F6N A;  2YUC A;  3ZVZ B;  1K2F A;  2L5U A;  3LQH A;  5TBN A;  2G6Q A;  4IC3 A;  4XI1 A;  3O33 A;  3IHP A;  3RPG C;  4CCG X;  2D8S A;  5FER A;  5KH7 A;  2CSZ A;  2KGI A;  2XEU A;  3U5M A;  2RI7 A;  2VPE A;  5D1K B;  2K4D A;  2BAY A;  1V87 A;  4YAB A;  2KFT A;  1N87 A;  2G45 A;  2QJ0 A;  1WEW A;  1IYM A;  3SOW A;  3PHD A;  3ZYQ A;  2CSY A;  2L75 A;  4IC2 A;  4WZ0 A;  2VPD A;  4AUQ B;  3GV4 A;  2MT5 A;  1WFK A;  5FB1 A;  3RTR B;  3KV6 A;  5EYA F;  2JMJ A;  2C2L A;  4AYC A;  3O37 A;  3O70 A;  1WEE A;  2YYR A;  3L11 A;  3C5K A;  3N9O A;  1WE9 A;  4I7B A;  2VJF B;  2LGK A;  1Z6U A;  2K16 A;  3ZPV E;  2VP7 A;  5LCW B;  4S3O C;  2H0D A;  4NN2 A;  5LKT A;  1WEN A;  1XWH A;  1WEO A;  4L58 A;  4C9Z A;  2KIZ A;  2MD7 B;  4PPE A;  1LDJ B;  2EGP A;  2Y1M A;  4WA6 A;  4I7C A;  5J3X A;  5B8D A;  1MM2 A;  1Z2Q A;  2C2V S;  4V3L C;  2AN6 A; 
#chains in the Genus database with same CATH topology
 3M63 A;  1VD4 A;  3M62 A;  4B7Y C;  2ECV A;  3E2D A;  2LGV A;  2FUU A;  2YVR A;  4R2Y A;  5LKZ A;  5H9M A;  4P5O B;  2JMD A;  5DIN A;  2KR4 A;  5LKU A;  4CA1 A;  4O64 A;  3EB5 A;  3N9Q A;  4MVT A;  3EB6 A;  3O7A A;  1E4U A;  4UP5 A;  2KWK A;  1RMD A;  3LRQ A;  5JG6 A;  1MM3 A;  3C6W A;  2MIQ A;  2F6J A;  2PNX A;  1VYX A;  2MKE A;  2CON A;  5AIU A;  5H1U A;  2YSM A;  4WZ3 B;  4YC9 A;  1HYJ A;  5FEY A;  5C11 A;  2EOD A;  4LJN A;  3PUQ A;  2CKL B;  2UZG A;  4W4U A;  3H7H A;  4YAX A;  4QF3 A;  4R8P K;  3M7K A;  5G0F A;  2HDP A;  3N9L A;  2LN0 A;  3O36 A;  4FK5 A;  4BBQ A;  1WEV A;  2L80 A;  3SHB A;  5B79 A;  2XB1 A;  3L1X A;  1WEU A;  3FL2 A;  1HYI A;  2M13 A;  2L43 A;  2ECW A;  3LQI A;  2VNF A;  4GNF A;  3U5N A;  3L1Z B;  2FUI A;  2YU4 A;  3N9N A;  2RSD A;  3I2D A;  3U5O A;  2ECJ A;  3FM8 C;  2VJF A;  3SOU A;  4N4F A;  2DJA A;  2M1R A;  5SVX A;  3MHH A;  2YHO A;  2YSJ A;  3FAO A;  1F62 A;  1JM7 B;  2VJE B;  1X4J A;  2KRE A;  2EXU A;  2I50 A;  3FEH A;  2KKY A;  2JM3 A;  4F1P A;  3N9M A;  5K3Q A;  2QIZ A;  5KH3 A;  3KNV A;  3V43 A;  2LXH C;  4LAD B;  4YAT A;  4QF2 A;  3ASL A;  2K17 A;  2KU3 A;  4GB0 A;  5DKA A;  4AP4 A;  2KWO A;  1CHC A;  1MBM A;  2E6R A;  1BOR A;  3JUE A;  4FIP A;  5SVY A;  3LDY A;  5G04 B;  4A49 A;  2KWJ A;  5B75 A;  2LGL A;  5TDR A;  1X4I A;  2YQL A;  2QIC A;  4L7X A;  2ECN A;  4LK9 A;  5FB0 A;  4ZQL A;  1WGM A;  2JUN A;  5D1M B;  2KE1 A;  1WIL A;  2MUM A;  2JMI A;  3DQV R;  4UP0 A;  1WIM A;  4OGE A;  4A0C D;  4AVX A;  2LV9 A;  4N3W A;  4ZUX U;  2YHN A;  2M3H A;  3ZPV 1;  2L0B A;  4LKA A;  2LXP C;  4GND A;  3MHS A;  2IDA A;  3LQJ A;  5LKX A;  2EA6 A;  2YT5 A;  2G43 A;  2CT2 A;  5KH9 A;  2OXQ C;  1LDK C;  1T1H A;  3VK6 A;  4FJC A;  3T6R A;  4OGC A;  2LQ6 A;  2CKL A;  5TRB A;  1WEP A;  1DVP A;  1ZBD B;  1WEQ A;  3M99 A;  1WES A;  4S3O B;  2MNZ A;  3NG2 A;  4YBT A;  3DWD A;  2ECI A;  3O35 A;  3FAN A;  4A4B A;  1Z60 A;  2RR4 A;  2FSA A;  2YUR A;  5H1T A;  1U6G B;  2K1J A;  2VPB A;  4GNE A;  1FBV A;  2LAU A;  2M85 A;  4R7E A;  4UI9 B;  2P57 A;  3ZTG A;  3ZVY A;  2YRE A;  2B0O E;  1WEM A;  5I3L A;  2CRW A;  3LJU X;  2EGM A;  4X3G A;  4O62 A;  2MNY A;  5D1L B;  5G05 B;  4FO9 A;  4GNG A;  1JM7 A;  3KQI A;  2VJE A;  4Z0R A;  2KGG A;  3HCT A;  3QZV A;  3GL6 A;  2HYE D;  3PUR A;  2MA6 A;  3T7L A;  3SOX A;  4ZDT A;  2ECG A;  2ZET C;  5B76 A;  4H9D A;  4Q6F A;  5AIT A;  3Q1D A;  1JOC A;  2MA5 A;  2XOC A;  1DCQ A;  3KDE C;  4A4C A;  4BHW A;  2FFW A;  4AYC B;  3RPG B;  4V3K C;  2ECT A;  2E61 A;  2YW8 A;  4I7D A;  2JRJ A;  4MSX A;  2XOY A;  3MDB C;  3KV5 A;  4LLB A;  5SVI B;  3DDT A;  3ZNI A;  2LDR A;  2FD4 A;  1X4U A;  2NAA A;  3FJU B;  3HTK C;  1G25 A;  4B86 C;  2XP0 A;  4PTB A;  5H1V A;  1FP0 A;  2H0D B;  2Y1N A;  2F42 A;  2LRI C;  2PUY A;  4WZ2 A;  3DPL R;  2E6S A;  5B78 A;  4F52 B;  3N9P A;  3PLW A;  2CSV A;  3LVQ E;  3O34 A;  2MD8 C;  5TDW A;  3HCS A;  4YAD A;  2Y43 A;  4YBM A;  2KYU A;  2VPG A;  3HCU A;  5B77 A;  2LGG A;  2XOZ A;  1VFY A;  5C13 A;  2KWN A;  2DX8 A;  2M6M A;  4YBS A;  2KKX A;  4TKP B;  5TAB A;  3U5P A;  2YQM A;  2F6N A;  2YUC A;  3ZVZ B;  1K2F A;  2L5U A;  3LQH A;  2L7P A;  5TBN A;  2G6Q A;  4IC3 A;  4XI1 A;  3O33 A;  3IHP A;  3RPG C;  4CCG X;  2D8S A;  5FER A;  5KH7 A;  2CSZ A;  2KGI A;  2XEU A;  3U5M A;  2RI7 A;  2VPE A;  5D1K B;  2K4D A;  2BAY A;  2IQJ A;  1V87 A;  4YAB A;  2KFT A;  1N87 A;  2G45 A;  2QJ0 A;  1WEW A;  1IYM A;  3SOW A;  3PHD A;  3ZYQ A;  2CSY A;  2L75 A;  4IC2 A;  4WZ0 A;  2VPD A;  3LVR E;  4AUQ B;  3GV4 A;  2MT5 A;  1WFK A;  5FB1 A;  3RTR B;  2OWA A;  3KV6 A;  5EYA F;  2JMJ A;  2C2L A;  4Z0O A;  4QQ4 A;  4AYC A;  3O37 A;  3O70 A;  1WEE A;  2YYR A;  3L11 A;  3C5K A;  3N9O A;  1WE9 A;  5SVI A;  4I7B A;  3O47 A;  2VJF B;  2LGK A;  1Z6U A;  2K16 A;  3ZPV E;  2VP7 A;  5LCW B;  4S3O C;  2H0D A;  4NN2 A;  3T9K A;  5LKT A;  1WEN A;  1XWH A;  1WEO A;  4L58 A;  3SUB A;  2DSM A;  4C9Z A;  2KIZ A;  2MD7 B;  4PPE A;  1LDJ B;  2EGP A;  2Y1M A;  4WA6 A;  2D8U A;  4I7C A;  5J3X A;  5B8D A;  1MM2 A;  1Z2Q A;  2C2V S;  4V3L C;  2AN6 A;  2CRR A; 
#chains in the Genus database with same CATH homology
 3M63 A;  1VD4 A;  3M62 A;  4B7Y C;  2ECV A;  2LGV A;  2FUU A;  4R2Y A;  5LKZ A;  5H9M A;  4P5O B;  2JMD A;  5DIN A;  2KR4 A;  5LKU A;  4CA1 A;  4O64 A;  3EB5 A;  3N9Q A;  4MVT A;  3EB6 A;  3O7A A;  1E4U A;  4UP5 A;  2KWK A;  1RMD A;  3LRQ A;  5JG6 A;  1MM3 A;  3C6W A;  2MIQ A;  2F6J A;  2PNX A;  1VYX A;  5AIU A;  5H1U A;  2YSM A;  4WZ3 B;  4YC9 A;  1HYJ A;  5FEY A;  5C11 A;  2EOD A;  4LJN A;  3PUQ A;  2CKL B;  2UZG A;  4W4U A;  4YAX A;  4QF3 A;  4R8P K;  5G0F A;  2HDP A;  3N9L A;  2LN0 A;  3O36 A;  4FK5 A;  4BBQ A;  1WEV A;  2L80 A;  3SHB A;  5B79 A;  2XB1 A;  3L1X A;  1WEU A;  3FL2 A;  1HYI A;  2L43 A;  2ECW A;  3LQI A;  2VNF A;  4GNF A;  3U5N A;  3L1Z B;  2FUI A;  2YU4 A;  3N9N A;  2RSD A;  3I2D A;  3U5O A;  2ECJ A;  2VJF A;  3SOU A;  4N4F A;  2M1R A;  3MHH A;  2YHO A;  2YSJ A;  1F62 A;  1JM7 B;  2VJE B;  1X4J A;  2KRE A;  2I50 A;  3N9M A;  2QIZ A;  5KH3 A;  3KNV A;  3V43 A;  2LXH C;  4LAD B;  4YAT A;  4QF2 A;  3ASL A;  2K17 A;  2KU3 A;  4GB0 A;  5DKA A;  4AP4 A;  2KWO A;  1CHC A;  2E6R A;  1BOR A;  4FIP A;  5G04 B;  4A49 A;  2KWJ A;  5B75 A;  2LGL A;  5TDR A;  1X4I A;  2YQL A;  2QIC A;  4L7X A;  2ECN A;  4LK9 A;  5FB0 A;  4ZQL A;  1WGM A;  5D1M B;  2KE1 A;  1WIL A;  2MUM A;  2JMI A;  3DQV R;  4UP0 A;  1WIM A;  4A0C D;  4AVX A;  2LV9 A;  4N3W A;  4ZUX U;  2YHN A;  2M3H A;  3ZPV 1;  2L0B A;  4LKA A;  2LXP C;  4GND A;  3MHS A;  2IDA A;  3LQJ A;  5LKX A;  2EA6 A;  2YT5 A;  2G43 A;  2CT2 A;  5KH9 A;  2OXQ C;  1LDK C;  1T1H A;  3VK6 A;  4FJC A;  3T6R A;  2LQ6 A;  2CKL A;  5TRB A;  1WEP A;  1DVP A;  1ZBD B;  1WEQ A;  3M99 A;  1WES A;  4S3O B;  2MNZ A;  3NG2 A;  4YBT A;  2ECI A;  3O35 A;  4A4B A;  1Z60 A;  2FSA A;  2YUR A;  5H1T A;  1U6G B;  2K1J A;  2VPB A;  4GNE A;  1FBV A;  4R7E A;  2M85 A;  4UI9 B;  3ZTG A;  3ZVY A;  2YRE A;  1WEM A;  5I3L A;  4X3G A;  5D1L B;  2MNY A;  5G05 B;  4FO9 A;  4GNG A;  1JM7 A;  3KQI A;  2VJE A;  2KGG A;  3HCT A;  3QZV A;  3GL6 A;  2HYE D;  3PUR A;  2MA6 A;  3T7L A;  3SOX A;  4ZDT A;  2ECG A;  2ZET C;  5B76 A;  4Q6F A;  5AIT A;  1JOC A;  2MA5 A;  4A4C A;  4BHW A;  4AYC B;  3RPG B;  4V3K C;  2ECT A;  2YW8 A;  4I7D A;  2JRJ A;  4MSX A;  3KV5 A;  4LLB A;  3ZNI A;  2LDR A;  2NAA A;  1X4U A;  3HTK C;  1G25 A;  4B86 C;  4PTB A;  5H1V A;  1FP0 A;  2H0D B;  2Y1N A;  2F42 A;  2LRI C;  2PUY A;  4WZ2 A;  3DPL R;  2E6S A;  5B78 A;  4F52 B;  3N9P A;  3O34 A;  2MD8 C;  5TDW A;  3HCS A;  4YAD A;  2Y43 A;  4YBM A;  2KYU A;  2VPG A;  3HCU A;  5B77 A;  2LGG A;  1VFY A;  5C13 A;  2KWN A;  2DX8 A;  2M6M A;  4YBS A;  4TKP B;  5TAB A;  3U5P A;  2YQM A;  2F6N A;  2YUC A;  3ZVZ B;  1K2F A;  2L5U A;  3LQH A;  5TBN A;  2G6Q A;  4IC3 A;  4XI1 A;  3O33 A;  3IHP A;  3RPG C;  4CCG X;  2D8S A;  5FER A;  5KH7 A;  2CSZ A;  2KGI A;  2XEU A;  3U5M A;  2RI7 A;  2VPE A;  5D1K B;  2K4D A;  2BAY A;  1V87 A;  4YAB A;  2KFT A;  1N87 A;  2G45 A;  2QJ0 A;  1WEW A;  1IYM A;  3SOW A;  3PHD A;  3ZYQ A;  2CSY A;  2L75 A;  4IC2 A;  4WZ0 A;  2VPD A;  4AUQ B;  3GV4 A;  2MT5 A;  1WFK A;  5FB1 A;  3RTR B;  3KV6 A;  5EYA F;  2JMJ A;  2C2L A;  4AYC A;  3O37 A;  3O70 A;  1WEE A;  2YYR A;  3L11 A;  3C5K A;  3N9O A;  1WE9 A;  4I7B A;  2VJF B;  2LGK A;  1Z6U A;  2K16 A;  3ZPV E;  2VP7 A;  5LCW B;  4S3O C;  2H0D A;  4NN2 A;  5LKT A;  1WEN A;  1XWH A;  1WEO A;  4L58 A;  4C9Z A;  2KIZ A;  2MD7 B;  4PPE A;  1LDJ B;  2EGP A;  2Y1M A;  4WA6 A;  4I7C A;  5J3X A;  5B8D A;  1MM2 A;  1Z2Q A;  2C2V S;  4V3L C;  2AN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...