2DSMA

Nmr structure of bacillus subtilis protein yqai, northeast structural genomics target sr450
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
72
structure length
72
Chain Sequence
MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILRENLERYLREQLGFEFKNAQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yqaI
publication title NMR Structure of Bacillus Subtilis Protein YqaI, Northeast Structural Genomics Target SR450
rcsb
source organism Bacillus subtilis
total genus 6
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09466 Yqai Hypothetical protein Yqai
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.30 Alpha Beta 2-Layer Sandwich Herpes Virus-1 YqaI domain 2dsmA00
2DSMA
chains in the Genus database with same CATH superfamily
1HYIA 3ZPVE 1V87A 2CRRA 4FIPA 2KFTA 2BAYA 4BHWA 1WEQA 2K4DA 3DPLR 2KREA 4AYCB 3U5NA 4WA6A 2M13A 3SOWA 1BORA 2KGGA 2KWJA 3T6RA 3JUEA 2M85A 4ZUXU 5D1LB 3H7HA 2ECGA 2JUNA 1X4UA 2ZETC 3FL2A 2G43A 1VYXA 2EXUA 4Z0RA 1Z2QA 4AUQB 5TABA 5LKZA 5KH7A 4CA1A 3O70A 3O33A 5B79A 3PUQA 2LDRA 3M63A 2F42A 3T9KA 5H1UA 3ZVZB 5G0FA 2KYUA 3SOUA 1Z6UA 3HCSA 2I50A 4B86C 3O36A 3FEHA 3GV4A 4GB0A 4H9DA 3FANA 2VPGA 3T7LA 2IQJA 4CCGX 3M99A 1MBMA 2HDPA 2LRIC 1VFYA 1FP0A 1WEVA 3EB6A 3U5PA 2VPBA 2CRWA 2JMJA 2PNXA 4A4BA 3O7AA 2MA5A 2CKLA 2DJAA 2RI7A 2QJ0A 5SVXA 1XWHA 5AIUA 1WEWA 5LKXA 2CSVA 4QQ4A 3PHDA 2YHNA 4O64A 5KH9A 4XI1A 4OGCA 2LGKA 2MNYA 4A0CD 3U5OA 4R7EA 2C2LA 4FO9A 4BBQA 4I7DA 5FB1A 4V3KC 2CT2A 3ZTGA 2LN0A 2E61A 2EGMA 3N9LA 4YABA 3O37A 2MIQA 2L80A 3ZPV1 2G6QA 3N9OA 4UI9B 4L58A 4YATA 4IC3A 5TDRA 5B77A 2KWNA 3KNVA 3M7KA 3O34A 3L1ZB 4V3LC 4QF2A 2G45A 4YBSA 3V43A 4YBMA 2JM3A 5H9MA 3VK6A 3LDYA 4LADB 1U6GB 5FB0A 3HCUA 2KIZA 4F1PA 3RPGC 4LJNA 1WEMA 1WEUA 4R8PK 2LQ6A 2JMDA 2L75A 3MHHA 5J3XA 2M3HA 2YUCA 5LKUA 3C6WA 3LVRE 3L11A 3SUBA 5I3LA 1E4UA 3LVQE 3O35A 2L0BA 2CKLB 2KE1A 3FM8C 4TKPB 1MM3A 2M6MA 4B7YC 1WENA 5D1MB 3N9QA 2EODA 2FUIA 2L7PA 2YREA 1DVPA 3FJUB 3ASLA 3IHPA 2KR4A 4Z0OA 4WZ3B 2L5UA 3O47A 5H1VA 1ZBDB 5D1KB 4A4CA 3NG2A 2PUYA 3DDTA 5JG6A 4AVXA 4GNEA 1FBVA 2KWKA 5SVYA 2LAUA 2Y1NA 2KKYA 2YURA 3C5KA 2VJEB 5G04B 4S3OC 2XOYA 2MT5A 4ZQLA 2KGIA 3KQIA 4Q6FA 2K17A 1LDJB 2ECJA 2XP0A 3KDEC 2LGVA 1F62A 2MA6A 3DQVR 3KV5A 3N9MA 5K3QA 2LV9A 2XOZA 2MD8C 3ZNIA 2D8SA 3RTRB 3ZYQA 2VPDA 5B8DA 5C13A 2MKEA 1WFKA 2LGLA 3MHSA 5B76A 4GNGA 1JOCA 5LKTA 2CONA 2F6NA 4FJCA 1LDKC 2YSJA 2K16A 2FFWA 1WEPA 2YVRA 4A49A 2JMIA 1N87A 5DINA 2H0DA 4O62A 2MUMA 4GNDA 5H1TA 2VJEA 3RPGB 2D8UA 3I2DA 2B0OE 2ECTA 4NN2A 1IYMA 5AITA 2MNZA 2YQMA 4P5OB 1JM7A 2Y1MA 2YU4A 4N4FA 1HYJA 4N3WA 3DWDA 2YYRA 2EGPA 4YC9A 3SHBA 2UZGA 3PLWA 4F52B 2P57A 1DCQA 5G05B 2MD7B 2QIZA 3SOXA 2XEUA 4R2YA 4MVTA 2VJFA 2YHOA 2LXPC 5TRBA 4LK9A 1MM2A 4GNFA 4I7BA 2RR4A 2L43A 2ECIA 5TBNA 3M62A 3LJUX 2OWAA 2VNFA 2KKXA 2XB1A 4S3OB 2K1JA 3QZVA 2YQLA 1WIMA 4W4UA 4PTBA 1X4JA 1Z60A 4IC2A 3ZVYA 2YW8A 5LCWB 4C9ZA 2JRJA 5KH3A 4FK5A 2AN6A 2XOCA 2VP7A 2ECVA 2H0DB 4L7XA 4X3GA 5FEYA 4PPEA 3HTKC 4UP5A 1WEOA 2VPEA 2F6JA 3N9NA 1K2FA 4YBTA 4YAXA 3EB5A 5FERA 4LKAA 2KWOA 2IDAA 4OGEA 1X4IA 1WEEA 1JM7B 4WZ2A 1WE9A 4YADA 4AYCA 1G25A 5SVIB 2OXQC 3HCTA 2ECNA 3GL6A 3U5MA 3PURA 1RMDA 1WILA 3L1XA 2LGGA 5TDWA 4ZDTA 2HYED 3E2DA 3LQJA 5B78A 2Y43A 1VD4A 2YT5A 3LQIA 3LQHA 2M1RA 2C2VS 2VJFB 2E6RA 2FSAA 3Q1DA 4UP0A 4WZ0A 2FD4A 3N9PA 3MDBC 2CSYA 4LLBA 1T1HA 2E6SA 4AP4A 5EYAF 5C11A 2EA6A 2NAAA 3FAOA 1WGMA 4MSXA 1WESA 5DKAA 1CHCA 3LRQA 2KU3A 2QICA 2ECWA 4QF3A 2FUUA 5B75A 2LXHC 2CSZA 2RSDA 5SVIA 4I7CA 2DX8A 2YSMA 3KV6A 2DSMA
chains in the Genus database with same CATH topology
2DSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSM A; 
#chains in the Genus database with same CATH topology
 1HYI A;  3ZPV E;  1V87 A;  2CRR A;  4FIP A;  2KFT A;  2BAY A;  4BHW A;  1WEQ A;  2K4D A;  3DPL R;  2KRE A;  4AYC B;  3U5N A;  4WA6 A;  2M13 A;  3SOW A;  1BOR A;  2KGG A;  2KWJ A;  3T6R A;  3JUE A;  2M85 A;  4ZUX U;  5D1L B;  3H7H A;  2ECG A;  2JUN A;  1X4U A;  2ZET C;  3FL2 A;  2G43 A;  1VYX A;  2EXU A;  4Z0R A;  1Z2Q A;  4AUQ B;  5TAB A;  5LKZ A;  5KH7 A;  4CA1 A;  3O70 A;  3O33 A;  5B79 A;  3PUQ A;  2LDR A;  3M63 A;  2F42 A;  3T9K A;  5H1U A;  3ZVZ B;  5G0F A;  2KYU A;  3SOU A;  1Z6U A;  3HCS A;  2I50 A;  4B86 C;  3O36 A;  3FEH A;  3GV4 A;  4GB0 A;  4H9D A;  3FAN A;  2VPG A;  3T7L A;  2IQJ A;  4CCG X;  3M99 A;  1MBM A;  2HDP A;  2LRI C;  1VFY A;  1FP0 A;  1WEV A;  3EB6 A;  3U5P A;  2VPB A;  2CRW A;  2JMJ A;  2PNX A;  4A4B A;  3O7A A;  2MA5 A;  2CKL A;  2DJA A;  2RI7 A;  2QJ0 A;  5SVX A;  1XWH A;  5AIU A;  1WEW A;  5LKX A;  2CSV A;  4QQ4 A;  3PHD A;  2YHN A;  4O64 A;  5KH9 A;  4XI1 A;  4OGC A;  2LGK A;  2MNY A;  4A0C D;  3U5O A;  4R7E A;  2C2L A;  4FO9 A;  4BBQ A;  4I7D A;  5FB1 A;  4V3K C;  2CT2 A;  3ZTG A;  2LN0 A;  2E61 A;  2EGM A;  3N9L A;  4YAB A;  3O37 A;  2MIQ A;  2L80 A;  3ZPV 1;  2G6Q A;  3N9O A;  4UI9 B;  4L58 A;  4YAT A;  4IC3 A;  5TDR A;  5B77 A;  2KWN A;  3KNV A;  3M7K A;  3O34 A;  3L1Z B;  4V3L C;  4QF2 A;  2G45 A;  4YBS A;  3V43 A;  4YBM A;  2JM3 A;  5H9M A;  3VK6 A;  3LDY A;  4LAD B;  1U6G B;  5FB0 A;  3HCU A;  2KIZ A;  4F1P A;  3RPG C;  4LJN A;  1WEM A;  1WEU A;  4R8P K;  2LQ6 A;  2JMD A;  2L75 A;  3MHH A;  5J3X A;  2M3H A;  2YUC A;  5LKU A;  3C6W A;  3LVR E;  3L11 A;  3SUB A;  5I3L A;  1E4U A;  3LVQ E;  3O35 A;  2L0B A;  2CKL B;  2KE1 A;  3FM8 C;  4TKP B;  1MM3 A;  2M6M A;  4B7Y C;  1WEN A;  5D1M B;  3N9Q A;  2EOD A;  2FUI A;  2L7P A;  2YRE A;  1DVP A;  3FJU B;  3ASL A;  3IHP A;  2KR4 A;  4Z0O A;  4WZ3 B;  2L5U A;  3O47 A;  5H1V A;  1ZBD B;  5D1K B;  4A4C A;  3NG2 A;  2PUY A;  3DDT A;  5JG6 A;  4AVX A;  4GNE A;  1FBV A;  2KWK A;  5SVY A;  2LAU A;  2Y1N A;  2KKY A;  2YUR A;  3C5K A;  2VJE B;  5G04 B;  4S3O C;  2XOY A;  2MT5 A;  4ZQL A;  2KGI A;  3KQI A;  4Q6F A;  2K17 A;  1LDJ B;  2ECJ A;  2XP0 A;  3KDE C;  2LGV A;  1F62 A;  2MA6 A;  3DQV R;  3KV5 A;  3N9M A;  5K3Q A;  2LV9 A;  2XOZ A;  2MD8 C;  3ZNI A;  2D8S A;  3RTR B;  3ZYQ A;  2VPD A;  5B8D A;  5C13 A;  2MKE A;  1WFK A;  2LGL A;  3MHS A;  5B76 A;  4GNG A;  1JOC A;  5LKT A;  2CON A;  2F6N A;  4FJC A;  1LDK C;  2YSJ A;  2K16 A;  2FFW A;  1WEP A;  2YVR A;  4A49 A;  2JMI A;  1N87 A;  5DIN A;  2H0D A;  4O62 A;  2MUM A;  4GND A;  5H1T A;  2VJE A;  3RPG B;  2D8U A;  3I2D A;  2B0O E;  2ECT A;  4NN2 A;  1IYM A;  5AIT A;  2MNZ A;  2YQM A;  4P5O B;  1JM7 A;  2Y1M A;  2YU4 A;  4N4F A;  1HYJ A;  4N3W A;  3DWD A;  2YYR A;  2EGP A;  4YC9 A;  3SHB A;  2UZG A;  3PLW A;  4F52 B;  2P57 A;  1DCQ A;  5G05 B;  2MD7 B;  2QIZ A;  3SOX A;  2XEU A;  4R2Y A;  4MVT A;  2VJF A;  2YHO A;  2LXP C;  5TRB A;  4LK9 A;  1MM2 A;  4GNF A;  4I7B A;  2RR4 A;  2L43 A;  2ECI A;  5TBN A;  3M62 A;  3LJU X;  2OWA A;  2VNF A;  2KKX A;  2XB1 A;  4S3O B;  2K1J A;  3QZV A;  2YQL A;  1WIM A;  4W4U A;  4PTB A;  1X4J A;  1Z60 A;  4IC2 A;  3ZVY A;  2YW8 A;  5LCW B;  4C9Z A;  2JRJ A;  5KH3 A;  4FK5 A;  2AN6 A;  2XOC A;  2VP7 A;  2ECV A;  2H0D B;  4L7X A;  4X3G A;  5FEY A;  4PPE A;  3HTK C;  4UP5 A;  1WEO A;  2VPE A;  2F6J A;  3N9N A;  1K2F A;  4YBT A;  4YAX A;  3EB5 A;  5FER A;  4LKA A;  2KWO A;  2IDA A;  4OGE A;  1X4I A;  1WEE A;  1JM7 B;  4WZ2 A;  1WE9 A;  4YAD A;  4AYC A;  1G25 A;  5SVI B;  2OXQ C;  3HCT A;  2ECN A;  3GL6 A;  3U5M A;  3PUR A;  1RMD A;  1WIL A;  3L1X A;  2LGG A;  5TDW A;  4ZDT A;  2HYE D;  3E2D A;  3LQJ A;  5B78 A;  2Y43 A;  1VD4 A;  2YT5 A;  3LQI A;  3LQH A;  2M1R A;  2C2V S;  2VJF B;  2E6R A;  2FSA A;  3Q1D A;  4UP0 A;  4WZ0 A;  2FD4 A;  3N9P A;  3MDB C;  2CSY A;  4LLB A;  1T1H A;  2E6S A;  4AP4 A;  5EYA F;  5C11 A;  2EA6 A;  2NAA A;  3FAO A;  1WGM A;  4MSX A;  1WES A;  5DKA A;  1CHC A;  3LRQ A;  2KU3 A;  2QIC A;  2ECW A;  4QF3 A;  2FUU A;  5B75 A;  2LXH C;  2CSZ A;  2RSD A;  5SVI A;  4I7C A;  2DX8 A;  2YSM A;  3KV6 A;  2DSM A; 
#chains in the Genus database with same CATH homology
 2DSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...