4N3WA

Crystal structure of the bromodomain-phd finger module of human transcriptional co-activator cbp in complex with acetylated histone 4 peptide (h4k20ac).
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
231
structure length
184
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCDDPSQPQTTKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Structural Insights into Acetylated-Histone H4 Recognition by the Bromodomain-PHD Finger Module of Human Transcriptional Coactivator CBP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/nuclear protein
total genus 55
structure length 184
sequence length 231
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF06001 DUF902 Domain of Unknown Function (DUF902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n3wA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4n3wA02
5J0DA 3ZTGA 4LYIA 4QSRA 4UYFB 5ENEA 2YEKA 4MR6A 4X3GA 2YYNA 4YYMA 3P1CA 4NS5A 2Y1NA 3ZPV1 5B78A 2YURA 4PTBA 5KTUA 5G04B 4GPJA 4Z1SA 2LXPC 3HCSA 4LDFA 4QSXA 2HYED 4V3LC 3P1DA 4HXRA 4NR4A 4ALGA 4YYKA 2MUMA 3GV4A 4AUQB 3ONIA 4QSPA 5KTWA 4WHWA 4KV1A 5HEMA 5A81A 2MD7B 3DQVR 5D24A 1VFYA 2F6JA 2N9GA 4CUSA 5ENCA 5LVRA 2BAYA 5CQ8A 2YHOA 2H60A 2RS9B 4NR7A 4NR9A 4NYWA 4ALHA 2LQ6A 3L11A 4YH3A 4CUPA 5IBNA 4NQNA 4A9HA 1Z60A 3JVLA 1E4UA 4CFLA 4UITA 2KYUA 5TB6A 4LK9A 5AITA 1JM7A 4AYCB 1X4JA 5CRMA 4QUUA 4NYVA 5D3JA 4FIPA 5HJCA 1CHCA 4YYJA 5C11A 2L43A 5CQ3A 5DYAA 5CY9A 2JMIA 3LRQA 4UIXA 4UYFA 5E9KA 5LCWB 5D25A 2DWWA 5F1HA 2D8SA 5FB1A 2K4DA 5D3LA 2R10A 3O34A 2LGKA 4O71A 3SVFA 4O7FA 4A9LA 1MM2A 4Q0OA 5E3GA 4HBWA 2DVSA 2FUUA 5JI8A 3HCUA 4NR6A 3RPGB 4FK5A 4NUEA 2E6SA 3MHHA 4QF3A 4NUDA 1G25A 4YYIA 5CTLA 4WZ2A 3MQMA 2LGVA 4QY4A 5HRWA 4CA1A 5L8UA 3EB5A 4HXNA 2MA6A 2L85A 3FKMX 4J3IA 3SOWA 4QC1A 3Q2FA 2L5EA 5EV9A 5J3XA 5FERA 5F63A 5FG4A 4A9MA 4O7BA 5H1UA 4MR4A 5K29A 3KQIA 2E7NA 4I7BA 4AYCA 5EK9A 2DVQA 5CFWA 3RCWA 2LSPB 5C89A 4A4CA 5E7DA 2LGGA 5I89A 5DKHA 4QR3A 4R8PK 1F62A 2VPGA 5A5RA 4TZ2A 5CRZA 5TCMA 4YYGA 3MXFA 4CFKA 5FG6A 4UIYA 5F2PA 3P1EA 4PPEA 4AP4A 2F6NA 5B77A 5LKUA 3U5PA 3P5OA 3K2JA 5DYXA 5IGMA 1WE9A 5DKAA 4XI1A 2MNZA 3LXJA 4IR6A 3LQJA 4CL9A 4F3IA 4J0SA 2IDAA 4V3KC 2DATA 2VPDA 3GG3A 5CUGA 3ZVYA 2LN0A 5EWDA 2HDPA 3ZNIA 2PUYA 5HRVA 4N3WA 4NRBA 4HXOA 3DAIA 4NR8A 5D3TA 2CSYA 5CQAA 5CUEA 1BORA 1Z2QA 5I3LA 3JVJA 5EM3A 4TT2A 4ZDTA 5H85A 5F62A 3AADA 5FG5A 5AMFA 5II1A 2CT2A 4PY6A 5A85A 5I83A 5I40A 5EPSA 4LYSA 5F60A 3FL2A 5B76A 5ENBA 3SVGA 4XUBA 5EP7A 2DVRA 4B7YC 5DW1A 5E74A 4LZSA 3JVKA 2M3HA 4MEQA 4TKPB 5FE4A 2YU4A 1WGMA 4QSQA 5E9YA 4TZ8A 1X4IA 5A5OA 5D3SA 3P1FA 3UVYA 1WEEA 1VD4A 3M99A 4A4BA 5HELA 1N72A 2WP2A 2K1JA 4Q6FA 1HYJA 4BW2A 4A9EA 1LDKC 2KIZA 2MNYA 2OXQC 4O75A 4NN2A 1HYIA 4N4FA 3O7AA 2RO1A 4XY8A 4OUFA 5IGLA 1WUMA 1ZS5A 4Q0NA 5BT5A 5LKZA 4O64A 3O35A 3SVHA 4ZQLA 1WUGA 5E0RA 2K16A 2YEMA 5TABA 4F52B 3UV2A 5DW2A 4NRAA 5EVAA 3O33A 4IR5A 5ENFA 2YUCA 4S3OB 5F5ZA 5II2A 3L1ZB 1DVPA 3T7LA 5CZGA 4ZC9A 2EGPA 2G43A 5FE2A 4YBSA 4MSXA 4O72A 4A0CD 4QEUA 5HFRA 4R7EA 1ZBDB 5FE8A 5E9LA 3O36A 2WP1A 2Y1MA 3M63A 3U5MA 3N9PA 4PCIA 5BT4A 5I86A 4HXLA 3MHSA 4LZRA 4Y03A 4A9KA 5D26A 2R0SA 4J0RA 5DLZA 4Z6IA 5C8GA 4UYEA 5JWMA 5AIUA 1XWHA 1JM4B 5HQ7A 5FE9A 3MUKA 4YYDA 5L99A 4NXJA 3RTRB 5FBXA 4FO9A 5BT3A 3UVXA 4GNGA 4BBQA 4CLBA 4O7CA 2GRCA 5A5NA 3IU6A 2ECNA 4CUTA 5CU8A 4QYLA 5CUAA 1FP0A 4UIWA 3LJWA 3VK6A 5G4SA 1WEWA 2YQLA 2VJFB 5D3HA 4Z6HA 4Z1QA 1JOCA 5EYAF 5ETDA 3U5KA 5E9IA 5F3AA 5HQ6A 4NRCA 4PCEA 2L75A 1WEUA 2LRIC 2MD8C 4QSTA 5A5QA 4CUUA 5I80A 5ETBA 3UVWA 4YYNA 4CURA 1WILA 3ZYUA 3N9NA 4GNFA 3IU5A 4YC9A 5L98A 4BJXA 5D1KB 2K17A 2XB1A 4C9ZA 4NUCA 4UI9B 5KH9A 2YELA 4YABA 5FE6A 2QICA 5CGPA 3PUQA 2DX8A 2KREA 1WIMA 5D3PA 4LRGA 5DY7A 5E3DA 5CQ5A 5HQ5A 5IIDA 5F25A 5G05B 5A83A 5D7XA 5L96A 2CSZA 4A9IA 1RMDA 5HRXA 5ENIA 5E9MA 3U5JA 5L97A 4YYHA 4IC3A 5I88A 5LJ0A 4IOQA 1WEMA 5CUBA 3HMEA 2RNYA 4P5OB 5KHMA 2DVVA 5D3RA 5DKDA 2C2LA 1LDJB 1Z6UA 5CQ4A 4BHWA 5CS8A 4FJCA 2ECWA 5IG6A 2VJFA 1T1HA 4QYDA 4LJNA 5DFDA 4C66A 4KV4A 2I7KA 2E7OA 2YSMA 1WEPA 3JVMA 5C87A 2L5UA 3N9OA 5EU1A 4WIVA 2KGGA 4YADA 2NXBA 1WEVA 4RVRA 5HCLA 3ZVZB 4B86C 5KH7A 5HM0A 4IR3A 3QZTA 4WA6A 4CCGX 4UP0A 2KWNA 3G0LA 3MULA 4IOOA 2VP7A 4OGIA 2L84A 4NR5A 4XYAA 3O70A 4O7AA 5KO4A 1WEOA 2I8NA 4HXPA 5KU3A 5A5PA 4HBYA 5FE7A 2PNXA 2JRJA 4Z93A 4AKNA 3MB4A 2YREA 3QZSA 4KCXA 3S91A 3N9MA 3KV6A 3I2DA 5FH8A 5G4RA 3C6WA 4YY6A 3N9LA 2EA6A 3T6RA 5D1LB 2RNWA 5DBMA 4A9OA 5IGNA 4YBTA 5FB0A 5L8TA 2YHNA 1EQFA 4IORA 4CUQA 2QIZA 1F68A 2YW8A 4I7CA 5D1MB 4W4UA 2KR4A 2ECJA 3MB3A 3PHDA 4QEVA 5FDZA 4QSVA 5FFVA 4WZ0A 4IR4A 2KWJA 4MEPA 2H0DB 1WENA 5FE0A 5F36A 2CKLB 2VNFA 3HTKC 5B8DA 5ENGA 5H1TA 3N9QA 4A9FA 4L58A 4UYGA 4ZUXU 4UIZA 5C85A 2JMDA 2VPEA 2ZETC 4I7DA 5LVQA 3UVDA 3ZPVE 4MEOA 5ACYA 4DONA 1JM7B 5DFBA 5D3NA 3HMFA 2XEUA 2E6RA 3D7CA 3QZVA 4BW4A 2YQMA 5AD3A 3SHBA 2YW5A 2VJEB 4QSUA 2OSSA 2D82A 2RFJA 3UV5A 5KTXA 2F42A 5LKXA 1VYXA 4QNSA 2UZGA 1IYMA 4HBXA 2MA5A 3G0JA 4UP5A 5EWVA 5DYUA 4YY4A 5A82A 4YH4A 4MENA 1X0JA 4QBMA 2KWKA 2OO1A 4N4IA 5COIA 5HENA 2ECGA 5ENJA 5EICA 3L1XA 4PKLA 5EA1A 2FUIA 4LR6A 3SOUA 5FE1A 4O76A 3HCTA 3RPGC 4WHUA 2LDRA 2Y43A 4QSWA 5EGUA 4O77A 5CQ7A 5E73A 2LGLA 3SOXA 5I29A 1WESA 5B75A 5FFWA 4A9NA 3NG2A 2NAAA 2H0DA 5TRBA 2CKLA 4O78A 4GNEA 5F61A 4GB0A 5C13A 2ECIA 5KH3A 4N4HA 5DKCA 3LQHA 3UW9A 5DX4A 5LUUA 5E9VA 4LKAA 2KE1A 2LV9A 4MVTA 4TT4A 4WZ3B 4A9JA 4O74A 4N4GA 5EWWA 5D0CA 4TU6A 2VJEA 4QZSA 4QUTA 4NYXA 1U6GB 5C7NA 5FEYA 4TS8A 4YK0A 1X4UA 4QC3A 3EB6A 2G4AA 2G45A 4AVXA 5JG6A 3NXBA 4OGJA 2VPBA 5EWHA 5B79A 4LLBA 2LXHC 2L80A 2YSJA 4IC2A 2OUOA 4LADB 5EWCA 4MR5A 3U5LA 4BW3A 1WEQA 5CUCA 3ASLA 5EPRA 2E3KA 2ECVA 5FH6A 4NQMA 3C5KA 3DPLR 2R0VA 2MJVB 4LZ2A 3TLPA 5TDRA 1N87A 3O37A 4TTEA 5DLXA 3UV4A 5TDWA 5I7YA 3DWYA 2D9EA 4QR5A 5AD2A 3KNVA 1E6IA 2KWOA 3S92A 4O7EA 4UIVA 5EI4A 2M85A 3V43A 5HLSA 5LJ2A 5CP5A 4YAXA 5A5SA 5FE5A 2KFTA 5CUDA 4L7XA 2I50A 5H1VA 5FFYA 2RI7A 4E96A 2FSAA 5IGKA 5CPEA 2DKWA 3U5NA 2QJ0A 1FBVA 2L0BA 4ZW1A 4O70A 5CQTA 5I7XA 5CQ6A 5I1QA 4HXMA 1MM3A 4A49A 4QEWA 3ZYQA 4YATA 3Q2EA 5TBNA 4TT6A 5DFCA 5AMEA 2G6QA 2KU3A 2RSDA 4R2YA 5G0FA 4MR3A 2YQDA 2YDWA 4FLPA 2EODA 4XY9A 4S3OC 4YBMA 2ECTA 5HFQA 4QR4A 5H9MA 1JSPB 4PS5A 2YT5A 3HMHA 5A7CA 1V87A 1K2FA 2JMJA 2M6MA 4XUAA 4C67A 3I3JA 3M62A 4J1PA 4TU4A 5EQ1A 2R0YA 4UIUA 2M1RA 2MIQA 5DYCA 4X2IA 3U5OA 2AN6A 2KTBB 1WFKA 5FE3A 5F1LA 4TQNA 5C4QA 5EPBA 2YYRA 5DINA 4HXSA 5EISA 4HXKA 4QF2A 2C2VS 2RNXA 4QSSA 3LQIA 3AQAA 5LKTA 5ENHA 4UYHA 3GL6A 4LC2A 4TYLA 5FH7A 3IHPA 3KV5A 2MT5A 4UYDA 4GNDA 4BW1A 5LJ1A 4HBVA 3PURA 4QB3A 4LYWA 2KGIA
chains in the Genus database with same CATH superfamily
5J0DA 2YVRA 4LYIA 3ZTGA 4QSRA 2FD4A 4UYFB 5ENEA 2YEKA 4MR6A 4X3GA 2YYNA 4YYMA 3P1CA 4NS5A 2Y1NA 3ZPV1 5B78A 2YURA 4PTBA 5KTUA 3DDTA 4GPJA 4Z1SA 5G04B 2LXPC 3HCSA 4LDFA 4QSXA 2HYED 4V3LC 3P1DA 4HXRA 4NR4A 4ALGA 4YYKA 2MUMA 2CSVA 3GV4A 4AUQB 3ONIA 4QSPA 5KTWA 4WHWA 4KV1A 5HEMA 5A81A 2MD7B 2CRWA 5SVXA 3DQVR 3FEHA 5D24A 1VFYA 2F6JA 2N9GA 4CUSA 5ENCA 5LVRA 2BAYA 5CQ8A 2KKYA 2YHOA 2H60A 2RS9B 4NR7A 4NR9A 4NYWA 4ALHA 2LQ6A 3L11A 4YH3A 4CUPA 5IBNA 4NQNA 4A9HA 5SVYA 1Z60A 3JVLA 2RR4A 1E4UA 4CFLA 4UITA 2KYUA 5TB6A 2CRRA 2L7PA 4LK9A 5AITA 1X4JA 4AYCB 1JM7A 5CRMA 4QUUA 4NYVA 5D3JA 4FIPA 5HJCA 1CHCA 4YYJA 5C11A 2L43A 5CQ3A 5DYAA 5CY9A 2JMIA 3LRQA 4UIXA 4UYFA 5E9KA 5LCWB 5D25A 2DWWA 4Z0RA 5F1HA 2D8SA 5FB1A 2K4DA 5D3LA 2R10A 3O34A 2LGKA 4O71A 3SVFA 4O7FA 4A9LA 1MM2A 4Q0OA 5E3GA 4HBWA 2DVSA 2FUUA 5JI8A 3HCUA 4NR6A 3RPGB 4FK5A 4NUEA 2E6SA 3LVQE 3MHHA 4QF3A 4NUDA 1G25A 4YYIA 5CTLA 4WZ2A 3MQMA 2LGVA 4QY4A 5HRWA 4CA1A 5L8UA 3EB5A 4HXNA 2MA6A 2L85A 3FKMX 4J3IA 3SOWA 4QC1A 3Q2FA 2L5EA 5EV9A 5J3XA 5FERA 5F63A 5FG4A 4A9MA 4O7BA 5H1UA 4MR4A 5K29A 4AKIA 3KQIA 2E7NA 4I7BA 4AYCA 5EK9A 2DVQA 5CFWA 3RCWA 2LSPB 5C89A 4A4CA 5E7DA 2LGGA 5I89A 5DKHA 4QR3A 4R8PK 1F62A 2VPGA 5A5RA 4TZ2A 5CRZA 5TCMA 4YYGA 3MXFA 4CFKA 5FG6A 4UIYA 5F2PA 3P1EA 4PPEA 4AP4A 2F6NA 5B77A 5LKUA 3U5PA 3P5OA 3K2JA 4AKHA 5DYXA 5IGMA 1WE9A 2JM3A 5DKAA 4XI1A 2MNZA 3LXJA 4IR6A 3LQJA 4CL9A 4F3IA 4J0SA 2IDAA 4V3KC 2DATA 2VPDA 3GG3A 5CUGA 3ZVYA 2LN0A 5EWDA 2HDPA 3ZNIA 2PUYA 5HRVA 4N3WA 4NRBA 4HXOA 3DAIA 4NR8A 5D3TA 2CSYA 5CQAA 5CUEA 1BORA 1Z2QA 5I3LA 3JVJA 3LDYA 5EM3A 4TT2A 4ZDTA 5H85A 5F62A 3AADA 5FG5A 5AMFA 2M13A 5II1A 2CT2A 4PY6A 5A85A 5I83A 5I40A 5EPSA 4LYSA 5F60A 3FL2A 5B76A 5ENBA 3SVGA 4XUBA 5EP7A 2DVRA 4B7YC 5DW1A 5E74A 4LZSA 3JVKA 2CONA 2M3HA 4MEQA 4TKPB 5FE4A 2YU4A 1WGMA 4QSQA 5E9YA 4TZ8A 1X4IA 5A5OA 5D3SA 3P1FA 3UVYA 1WEEA 1VD4A 3M99A 4A4BA 5HELA 1N72A 2WP2A 2K1JA 4Q6FA 3T9KA 1HYJA 4BW2A 4A9EA 1LDKC 2KIZA 2MNYA 2OXQC 4O75A 4NN2A 1HYIA 4N4FA 3O7AA 2RO1A 4XY8A 4OUFA 5IGLA 1WUMA 1ZS5A 4Q0NA 5BT5A 5LKZA 4O64A 3O35A 3SVHA 4ZQLA 1WUGA 3PLWA 5E0RA 2K16A 2YEMA 5TABA 4F52B 3UV2A 5DW2A 4NRAA 5EVAA 3O33A 4IR5A 5ENFA 2YUCA 3FANA 5F5ZA 5II2A 3L1ZB 1DVPA 4S3OB 3T7LA 5CZGA 4ZC9A 2EGPA 2G43A 5FE2A 4YBSA 4MSXA 4O72A 4A0CD 4QEUA 5HFRA 4R7EA 3LVRE 1ZBDB 5FE8A 5E9LA 3O36A 2WP1A 2Y1MA 3M63A 3U5MA 3N9PA 3O47A 4PCIA 5BT4A 5I86A 4HXLA 3MHSA 1ZKRA 4LZRA 4AI6A 4Y03A 4A9KA 5D26A 2R0SA 4J0RA 5DLZA 4Z6IA 5C8GA 4UYEA 5JWMA 5AIUA 1XWHA 1JM4B 5HQ7A 5FE9A 3MUKA 4YYDA 5L99A 4NXJA 2OWAA 3RTRB 5FBXA 4FO9A 5BT3A 3LJUX 3UVXA 4GNGA 4BBQA 4CLBA 4Z0OA 4O7CA 3VKHA 2GRCA 5A5NA 3IU6A 2ECNA 4QQ4A 4CUTA 5CU8A 2DJAA 4QYLA 5CUAA 1FP0A 4UIWA 3LJWA 2EXUA 3VK6A 5G4SA 1WEWA 2YQLA 2VJFB 5D3HA 4OGEA 4Z6HA 4Z1QA 1JOCA 5EYAF 5ETDA 3U5KA 5SVIB 5E9IA 5F3AA 5HQ6A 4NRCA 4PCEA 2L75A 1WEUA 2LRIC 2MD8C 2XOZA 4QSTA 5A5QA 4CUUA 5I80A 5ETBA 3UVWA 4YYNA 4CURA 1WILA 3ZYUA 3N9NA 4GNFA 3IU5A 4YC9A 5L98A 4BJXA 3VKGA 5D1KB 2K17A 3ERRA 2XB1A 2KKXA 4C9ZA 4NUCA 4UI9B 5KH9A 2YELA 4YABA 5FE6A 2QICA 5CGPA 3PUQA 2DX8A 2IQJA 2KREA 1WIMA 5D3PA 4LRGA 5DY7A 5E3DA 3D1BA 5CQ5A 5HQ5A 5IIDA 5F25A 5G05B 5A83A 5D7XA 5L96A 2CSZA 4A9IA 3JUEA 1RMDA 5HRXA 5ENIA 5E9MA 3U5JA 5L97A 4YYHA 4IC3A 5I88A 5LJ0A 1MBMA 4IOQA 3FAOA 1WEMA 5CUBA 3HMEA 3SUBA 2RNYA 4P5OB 5KHMA 2DVVA 5D3RA 5DKDA 2C2LA 1LDJB 1Z6UA 5CQ4A 4BHWA 5CS8A 3H7HA 4FJCA 2ECWA 5IG6A 2VJFA 1T1HA 4QYDA 4LJNA 5DFDA 4C66A 4KV4A 2I7KA 2E7OA 1DCQA 2YSMA 1WEPA 3JVMA 5C87A 2L5UA 3N9OA 5EU1A 4WIVA 2KGGA 4YADA 4O62A 2NXBA 1WEVA 4RVRA 5HCLA 3ZVZB 4B86C 5KH7A 5HM0A 4IR3A 3QZTA 4WA6A 4CCGX 4UP0A 2KWNA 3G0LA 3MULA 4IOOA 2VP7A 4OGIA 2L84A 4NR5A 4XYAA 3O70A 4O7AA 5KO4A 1WEOA 2I8NA 2XOCA 4HXPA 5KU3A 5A5PA 4HBYA 5FE7A 2PNXA 2JRJA 4Z93A 4AKNA 3MB4A 2YREA 3QZSA 4KCXA 3S91A 3N9MA 3KV6A 3I2DA 5FH8A 2JUNA 5G4RA 3C6WA 4YY6A 3N9LA 2EA6A 3T6RA 5D1LB 2RNWA 5DBMA 4A9OA 5IGNA 4YBTA 5FB0A 5L8TA 2YHNA 1EQFA 4IORA 4CUQA 2QIZA 1F68A 2YW8A 4I7CA 5D1MB 4W4UA 2KR4A 2ECJA 3MB3A 3PHDA 4QEVA 5FDZA 4QSVA 5FFVA 4WZ0A 4IR4A 2KWJA 4MEPA 2DSMA 2H0DB 1WENA 5FE0A 5F36A 2CKLB 2VNFA 3HTKC 5B8DA 5ENGA 5H1TA 3N9QA 4A9FA 4L58A 4UYGA 4ZUXU 4UIZA 5C85A 2JMDA 2VPEA 2ZETC 4I7DA 5LVQA 3UVDA 3ZPVE 4MEOA 5ACYA 4DONA 1JM7B 5DFBA 5D3NA 3HMFA 2XEUA 2E6RA 3D7CA 3QZVA 4BW4A 2YQMA 5K3QA 5AD3A 3SHBA 2YW5A 1PUOA 2VJEB 4QSUA 2OSSA 2D82A 2RFJA 3UV5A 5KTXA 2F42A 5LKXA 1VYXA 4QNSA 2UZGA 1IYMA 4HBXA 2MA5A 3G0JA 4OGCA 5EWVA 5DYUA 4YY4A 5A82A 4YH4A 4AKGA 4UP5A 4MENA 1X0JA 4QBMA 2KWKA 2OO1A 4N4IA 5COIA 5HENA 2ECGA 5ENJA 5EICA 3L1XA 2FFWA 4PKLA 5EA1A 2FUIA 4LR6A 3SOUA 5FE1A 4O76A 3HCTA 3RPGC 3M7KA 4WHUA 2LDRA 2Y43A 4QSWA 5EGUA 4O77A 5CQ7A 5E73A 2LGLA 3SOXA 5I29A 1WESA 5B75A 5FFWA 3MDBC 4A9NA 2EGMA 3NG2A 2MKEA 2NAAA 2H0DA 5TRBA 2CKLA 4O78A 4GNEA 5F61A 4GB0A 5C13A 3FM8C 2ECIA 5KH3A 4N4HA 5DKCA 3LQHA 3UW9A 5DX4A 5LUUA 5E9VA 4LKAA 2KE1A 2LV9A 4MVTA 4TT4A 4WZ3B 4A9JA 4O74A 4N4GA 5EWWA 5D0CA 4TU6A 2VJEA 4QZSA 4QUTA 4NYXA 1U6GB 3E2DA 5C7NA 5FEYA 4TS8A 4YK0A 1X4UA 4QC3A 3EB6A 2G4AA 2G45A 4AVXA 5JG6A 3NXBA 4OGJA 2VPBA 5EWHA 5B79A 4LLBA 2D8UA 2LXHC 2L80A 2YSJA 4IC2A 2OUOA 4LADB 5EWCA 4MR5A 3U5LA 4BW3A 1WEQA 5CUCA 3ASLA 5EPRA 2E61A 2E3KA 2ECVA 5FH6A 3D1DA 4NQMA 3C5KA 3DPLR 2R0VA 2MJVB 4LZ2A 3TLPA 5TDRA 1N87A 3O37A 4TTEA 5DLXA 3UV4A 5TDWA 5I7YA 3DWYA 2D9EA 4QR5A 5AD2A 3KNVA 1E6IA 2KWOA 5SVIA 3S92A 4O7EA 4UIVA 5EI4A 2M85A 3V43A 5HLSA 5LJ2A 5CP5A 4YAXA 5A5SA 5FE5A 2KFTA 5CUDA 4L7XA 2I50A 5H1VA 5FFYA 2RI7A 2XOYA 4E96A 2FSAA 5IGKA 5CPEA 2B0OE 2DKWA 3U5NA 2QJ0A 1FBVA 2L0BA 4ZW1A 4O70A 5CQTA 5I7XA 5CQ6A 5I1QA 4HXMA 1MM3A 4A49A 4QEWA 3ZYQA 4YATA 3Q2EA 2LAUA 4TT6A 5DFCA 5AMEA 5TBNA 2G6QA 2KU3A 2RSDA 4R2YA 5G0FA 4MR3A 3Q1DA 2YQDA 2YDWA 4FLPA 2EODA 4XY9A 4S3OC 4YBMA 2ECTA 5HFQA 4QR4A 5H9MA 1JSPB 4PS5A 2YT5A 4H9DA 3HMHA 5A7CA 1V87A 1K2FA 2JMJA 2M6MA 3FJUB 4XUAA 4C67A 4F1PA 3I3JA 2XP0A 3M62A 4J1PA 4TU4A 5EQ1A 2R0YA 4UIUA 2M1RA 3DWDA 2MIQA 5DYCA 2EJNA 4X2IA 3U5OA 2AN6A 2KTBB 1WFKA 5FE3A 5F1LA 4TQNA 5C4QA 5EPBA 2YYRA 5DINA 4HXSA 5EISA 4HXKA 4QF2A 3KDEC 2C2VS 2RNXA 4QSSA 3LQIA 3AQAA 5LKTA 5ENHA 4UYHA 3GL6A 4LC2A 4TYLA 5FH7A 3IHPA 3KV5A 2MT5A 4UYDA 4GNDA 2P57A 4BW1A 5LJ1A 4HBVA 3PURA 4QB3A 4LYWA 2KGIA
chains in the Genus database with same CATH topology
5J0DA 3ZTGA 4LYIA 4QSRA 4UYFB 5ENEA 2YEKA 4MR6A 4X3GA 2YYNA 4YYMA 3P1CA 4NS5A 2Y1NA 3ZPV1 5B78A 2YURA 4PTBA 5KTUA 5G04B 4GPJA 4Z1SA 2LXPC 3HCSA 4LDFA 4QSXA 2HYED 4V3LC 3P1DA 4HXRA 4NR4A 4ALGA 4YYKA 2MUMA 3GV4A 4AUQB 3ONIA 4QSPA 5KTWA 4WHWA 4KV1A 5HEMA 5A81A 2MD7B 3DQVR 5D24A 1VFYA 2F6JA 2N9GA 4CUSA 5ENCA 5LVRA 2BAYA 5CQ8A 2YHOA 2H60A 2RS9B 4NR7A 4NR9A 4NYWA 4ALHA 2LQ6A 3L11A 4YH3A 4CUPA 5IBNA 4NQNA 4A9HA 1Z60A 3JVLA 1E4UA 4CFLA 4UITA 2KYUA 5TB6A 4LK9A 5AITA 1JM7A 4AYCB 1X4JA 5CRMA 4QUUA 4NYVA 5D3JA 4FIPA 5HJCA 1CHCA 4YYJA 5C11A 2L43A 5CQ3A 5DYAA 5CY9A 2JMIA 3LRQA 4UIXA 4UYFA 5E9KA 5LCWB 5D25A 2DWWA 5F1HA 2D8SA 5FB1A 2K4DA 5D3LA 2R10A 3O34A 2LGKA 4O71A 3SVFA 4O7FA 4A9LA 1MM2A 4Q0OA 5E3GA 4HBWA 2DVSA 2FUUA 5JI8A 3HCUA 4NR6A 3RPGB 4FK5A 4NUEA 2E6SA 3MHHA 4QF3A 4NUDA 1G25A 4YYIA 5CTLA 4WZ2A 3MQMA 2LGVA 4QY4A 5HRWA 4CA1A 5L8UA 3EB5A 4HXNA 2MA6A 2L85A 3FKMX 4J3IA 3SOWA 4QC1A 3Q2FA 2L5EA 5EV9A 5J3XA 5FERA 5F63A 5FG4A 4A9MA 4O7BA 5H1UA 4MR4A 5K29A 3KQIA 2E7NA 4I7BA 4AYCA 5EK9A 2DVQA 5CFWA 3RCWA 2LSPB 5C89A 4A4CA 5E7DA 2LGGA 5I89A 5DKHA 4QR3A 4R8PK 1F62A 2VPGA 5A5RA 4TZ2A 5CRZA 5TCMA 4YYGA 3MXFA 4CFKA 5FG6A 4UIYA 5F2PA 3P1EA 4PPEA 4AP4A 2F6NA 5B77A 5LKUA 3U5PA 3P5OA 3K2JA 5DYXA 5IGMA 1WE9A 5DKAA 4XI1A 2MNZA 3LXJA 4IR6A 3LQJA 4CL9A 4F3IA 4J0SA 2IDAA 4V3KC 2DATA 2VPDA 3GG3A 5CUGA 3ZVYA 2LN0A 5EWDA 2HDPA 3ZNIA 2PUYA 5HRVA 4N3WA 4NRBA 4HXOA 3DAIA 4NR8A 5D3TA 2CSYA 5CQAA 5CUEA 1BORA 1Z2QA 5I3LA 3JVJA 5EM3A 4TT2A 4ZDTA 5H85A 5F62A 3AADA 5FG5A 5AMFA 5II1A 2CT2A 4PY6A 5A85A 5I83A 5I40A 5EPSA 4LYSA 5F60A 3FL2A 5B76A 5ENBA 3SVGA 4XUBA 5EP7A 2DVRA 4B7YC 5DW1A 5E74A 4LZSA 3JVKA 2M3HA 4MEQA 4TKPB 5FE4A 2YU4A 1WGMA 4QSQA 5E9YA 4TZ8A 1X4IA 5A5OA 5D3SA 3P1FA 3UVYA 1WEEA 1VD4A 3M99A 4A4BA 5HELA 1N72A 2WP2A 2K1JA 4Q6FA 1HYJA 4BW2A 4A9EA 1LDKC 2KIZA 2MNYA 2OXQC 4O75A 4NN2A 1HYIA 4N4FA 3O7AA 2RO1A 4XY8A 4OUFA 5IGLA 1WUMA 1ZS5A 4Q0NA 5BT5A 5LKZA 4O64A 3O35A 3SVHA 4ZQLA 1WUGA 5E0RA 2K16A 2YEMA 5TABA 4F52B 3UV2A 5DW2A 4NRAA 5EVAA 3O33A 4IR5A 5ENFA 2YUCA 4S3OB 5F5ZA 5II2A 3L1ZB 1DVPA 3T7LA 5CZGA 4ZC9A 2EGPA 2G43A 5FE2A 4YBSA 4MSXA 4O72A 4A0CD 4QEUA 5HFRA 4R7EA 1ZBDB 5FE8A 5E9LA 3O36A 2WP1A 2Y1MA 3M63A 3U5MA 3N9PA 4PCIA 5BT4A 5I86A 4HXLA 3MHSA 4LZRA 4Y03A 4A9KA 5D26A 2R0SA 4J0RA 5DLZA 4Z6IA 5C8GA 4UYEA 5JWMA 5AIUA 1XWHA 1JM4B 5HQ7A 5FE9A 3MUKA 4YYDA 5L99A 4NXJA 3RTRB 5FBXA 4FO9A 5BT3A 3UVXA 4GNGA 4BBQA 4CLBA 4O7CA 2GRCA 5A5NA 3IU6A 2ECNA 4CUTA 5CU8A 4QYLA 5CUAA 1FP0A 4UIWA 3LJWA 3VK6A 5G4SA 1WEWA 2YQLA 2VJFB 5D3HA 4Z6HA 4Z1QA 1JOCA 5EYAF 5ETDA 3U5KA 5E9IA 5F3AA 5HQ6A 4NRCA 4PCEA 2L75A 1WEUA 2LRIC 2MD8C 4QSTA 5A5QA 4CUUA 5I80A 5ETBA 3UVWA 4YYNA 4CURA 1WILA 3ZYUA 3N9NA 4GNFA 3IU5A 4YC9A 5L98A 4BJXA 5D1KB 2K17A 2XB1A 4C9ZA 4NUCA 4UI9B 5KH9A 2YELA 4YABA 5FE6A 2QICA 5CGPA 3PUQA 2DX8A 2KREA 1WIMA 5D3PA 4LRGA 5DY7A 5E3DA 5CQ5A 5HQ5A 5IIDA 5F25A 5G05B 5A83A 5D7XA 5L96A 2CSZA 4A9IA 1RMDA 5HRXA 5ENIA 5E9MA 3U5JA 5L97A 4YYHA 4IC3A 5I88A 5LJ0A 4IOQA 1WEMA 5CUBA 3HMEA 2RNYA 4P5OB 5KHMA 2DVVA 5D3RA 5DKDA 2C2LA 1LDJB 1Z6UA 5CQ4A 4BHWA 5CS8A 4FJCA 2ECWA 5IG6A 2VJFA 1T1HA 4QYDA 4LJNA 5DFDA 4C66A 4KV4A 2I7KA 2E7OA 2YSMA 1WEPA 3JVMA 5C87A 2L5UA 3N9OA 5EU1A 4WIVA 2KGGA 4YADA 2NXBA 1WEVA 4RVRA 5HCLA 3ZVZB 4B86C 5KH7A 5HM0A 4IR3A 3QZTA 4WA6A 4CCGX 4UP0A 2KWNA 3G0LA 3MULA 4IOOA 2VP7A 4OGIA 2L84A 4NR5A 4XYAA 3O70A 4O7AA 5KO4A 1WEOA 2I8NA 4HXPA 5KU3A 5A5PA 4HBYA 5FE7A 2PNXA 2JRJA 4Z93A 4AKNA 3MB4A 2YREA 3QZSA 4KCXA 3S91A 3N9MA 3KV6A 3I2DA 5FH8A 5G4RA 3C6WA 4YY6A 3N9LA 2EA6A 3T6RA 5D1LB 2RNWA 5DBMA 4A9OA 5IGNA 4YBTA 5FB0A 5L8TA 2YHNA 1EQFA 4IORA 4CUQA 2QIZA 1F68A 2YW8A 4I7CA 5D1MB 4W4UA 2KR4A 2ECJA 3MB3A 3PHDA 4QEVA 5FDZA 4QSVA 5FFVA 4WZ0A 4IR4A 2KWJA 4MEPA 2H0DB 1WENA 5FE0A 5F36A 2CKLB 2VNFA 3HTKC 5B8DA 5ENGA 5H1TA 3N9QA 4A9FA 4L58A 4UYGA 4ZUXU 4UIZA 5C85A 2JMDA 2VPEA 2ZETC 4I7DA 5LVQA 3UVDA 3ZPVE 4MEOA 5ACYA 4DONA 1JM7B 5DFBA 5D3NA 3HMFA 2XEUA 2E6RA 3D7CA 3QZVA 4BW4A 2YQMA 5AD3A 3SHBA 2YW5A 2VJEB 4QSUA 2OSSA 2D82A 2RFJA 3UV5A 5KTXA 2F42A 5LKXA 1VYXA 4QNSA 2UZGA 1IYMA 4HBXA 2MA5A 3G0JA 4UP5A 5EWVA 5DYUA 4YY4A 5A82A 4YH4A 4MENA 1X0JA 4QBMA 2KWKA 2OO1A 4N4IA 5COIA 5HENA 2ECGA 5ENJA 5EICA 3L1XA 4PKLA 5EA1A 2FUIA 4LR6A 3SOUA 5FE1A 4O76A 3HCTA 3RPGC 4WHUA 2LDRA 2Y43A 4QSWA 5EGUA 4O77A 5CQ7A 5E73A 2LGLA 3SOXA 5I29A 1WESA 5B75A 5FFWA 4A9NA 3NG2A 2NAAA 2H0DA 5TRBA 2CKLA 4O78A 4GNEA 5F61A 4GB0A 5C13A 2ECIA 5KH3A 4N4HA 5DKCA 3LQHA 3UW9A 5DX4A 5LUUA 5E9VA 4LKAA 2KE1A 2LV9A 4MVTA 4TT4A 4WZ3B 4A9JA 4O74A 4N4GA 5EWWA 5D0CA 4TU6A 2VJEA 4QZSA 4QUTA 4NYXA 1U6GB 5C7NA 5FEYA 4TS8A 4YK0A 1X4UA 4QC3A 3EB6A 2G4AA 2G45A 4AVXA 5JG6A 3NXBA 4OGJA 2VPBA 5EWHA 5B79A 4LLBA 2LXHC 2L80A 2YSJA 4IC2A 2OUOA 4LADB 5EWCA 4MR5A 3U5LA 4BW3A 1WEQA 5CUCA 3ASLA 5EPRA 2E3KA 2ECVA 5FH6A 4NQMA 3C5KA 3DPLR 2R0VA 2MJVB 4LZ2A 3TLPA 5TDRA 1N87A 3O37A 4TTEA 5DLXA 3UV4A 5TDWA 5I7YA 3DWYA 2D9EA 4QR5A 5AD2A 3KNVA 1E6IA 2KWOA 3S92A 4O7EA 4UIVA 5EI4A 2M85A 3V43A 5HLSA 5LJ2A 5CP5A 4YAXA 5A5SA 5FE5A 2KFTA 5CUDA 4L7XA 2I50A 5H1VA 5FFYA 2RI7A 4E96A 2FSAA 5IGKA 5CPEA 2DKWA 3U5NA 2QJ0A 1FBVA 2L0BA 4ZW1A 4O70A 5CQTA 5I7XA 5CQ6A 5I1QA 4HXMA 1MM3A 4A49A 4QEWA 3ZYQA 4YATA 3Q2EA 5TBNA 4TT6A 5DFCA 5AMEA 2G6QA 2KU3A 2RSDA 4R2YA 5G0FA 4MR3A 2YQDA 2YDWA 4FLPA 2EODA 4XY9A 4S3OC 4YBMA 2ECTA 5HFQA 4QR4A 5H9MA 1JSPB 4PS5A 2YT5A 3HMHA 5A7CA 1V87A 1K2FA 2JMJA 2M6MA 4XUAA 4C67A 3I3JA 3M62A 4J1PA 4TU4A 5EQ1A 2R0YA 4UIUA 2M1RA 2MIQA 5DYCA 4X2IA 3U5OA 2AN6A 2KTBB 1WFKA 5FE3A 5F1LA 4TQNA 5C4QA 5EPBA 2YYRA 5DINA 4HXSA 5EISA 4HXKA 4QF2A 2C2VS 2RNXA 4QSSA 3LQIA 3AQAA 5LKTA 5ENHA 4UYHA 3GL6A 4LC2A 4TYLA 5FH7A 3IHPA 3KV5A 2MT5A 4UYDA 4GNDA 4BW1A 5LJ1A 4HBVA 3PURA 4QB3A 4LYWA 2KGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J0D A;  3ZTG A;  4LYI A;  4QSR A;  4UYF B;  5ENE A;  2YEK A;  4MR6 A;  4X3G A;  2YYN A;  4YYM A;  3P1C A;  4NS5 A;  2Y1N A;  3ZPV 1;  5B78 A;  2YUR A;  4PTB A;  5KTU A;  5G04 B;  4GPJ A;  4Z1S A;  2LXP C;  3HCS A;  4LDF A;  4QSX A;  2HYE D;  4V3L C;  3P1D A;  4HXR A;  4NR4 A;  4ALG A;  4YYK A;  2MUM A;  3GV4 A;  4AUQ B;  3ONI A;  4QSP A;  5KTW A;  4WHW A;  4KV1 A;  5HEM A;  5A81 A;  2MD7 B;  3DQV R;  5D24 A;  1VFY A;  2F6J A;  2N9G A;  4CUS A;  5ENC A;  5LVR A;  2BAY A;  5CQ8 A;  2YHO A;  2H60 A;  2RS9 B;  4NR7 A;  4NR9 A;  4NYW A;  4ALH A;  2LQ6 A;  3L11 A;  4YH3 A;  4CUP A;  5IBN A;  4NQN A;  4A9H A;  1Z60 A;  3JVL A;  1E4U A;  4CFL A;  4UIT A;  2KYU A;  5TB6 A;  4LK9 A;  5AIT A;  1JM7 A;  4AYC B;  1X4J A;  5CRM A;  4QUU A;  4NYV A;  5D3J A;  4FIP A;  5HJC A;  1CHC A;  4YYJ A;  5C11 A;  2L43 A;  5CQ3 A;  5DYA A;  5CY9 A;  2JMI A;  3LRQ A;  4UIX A;  4UYF A;  5E9K A;  5LCW B;  5D25 A;  2DWW A;  5F1H A;  2D8S A;  5FB1 A;  2K4D A;  5D3L A;  2R10 A;  3O34 A;  2LGK A;  4O71 A;  3SVF A;  4O7F A;  4A9L A;  1MM2 A;  4Q0O A;  5E3G A;  4HBW A;  2DVS A;  2FUU A;  5JI8 A;  3HCU A;  4NR6 A;  3RPG B;  4FK5 A;  4NUE A;  2E6S A;  3MHH A;  4QF3 A;  4NUD A;  1G25 A;  4YYI A;  5CTL A;  4WZ2 A;  3MQM A;  2LGV A;  4QY4 A;  5HRW A;  4CA1 A;  5L8U A;  3EB5 A;  4HXN A;  2MA6 A;  2L85 A;  3FKM X;  4J3I A;  3SOW A;  4QC1 A;  3Q2F A;  2L5E A;  5EV9 A;  5J3X A;  5FER A;  5F63 A;  5FG4 A;  4A9M A;  4O7B A;  5H1U A;  4MR4 A;  5K29 A;  3KQI A;  2E7N A;  4I7B A;  4AYC A;  5EK9 A;  2DVQ A;  5CFW A;  3RCW A;  2LSP B;  5C89 A;  4A4C A;  5E7D A;  2LGG A;  5I89 A;  5DKH A;  4QR3 A;  4R8P K;  1F62 A;  2VPG A;  5A5R A;  4TZ2 A;  5CRZ A;  5TCM A;  4YYG A;  3MXF A;  4CFK A;  5FG6 A;  4UIY A;  5F2P A;  3P1E A;  4PPE A;  4AP4 A;  2F6N A;  5B77 A;  5LKU A;  3U5P A;  3P5O A;  3K2J A;  5DYX A;  5IGM A;  1WE9 A;  5DKA A;  4XI1 A;  2MNZ A;  3LXJ A;  4IR6 A;  3LQJ A;  4CL9 A;  4F3I A;  4J0S A;  2IDA A;  4V3K C;  2DAT A;  2VPD A;  3GG3 A;  5CUG A;  3ZVY A;  2LN0 A;  5EWD A;  2HDP A;  3ZNI A;  2PUY A;  5HRV A;  4N3W A;  4NRB A;  4HXO A;  3DAI A;  4NR8 A;  5D3T A;  2CSY A;  5CQA A;  5CUE A;  1BOR A;  1Z2Q A;  5I3L A;  3JVJ A;  5EM3 A;  4TT2 A;  4ZDT A;  5H85 A;  5F62 A;  3AAD A;  5FG5 A;  5AMF A;  5II1 A;  2CT2 A;  4PY6 A;  5A85 A;  5I83 A;  5I40 A;  5EPS A;  4LYS A;  5F60 A;  3FL2 A;  5B76 A;  5ENB A;  3SVG A;  4XUB A;  5EP7 A;  2DVR A;  4B7Y C;  5DW1 A;  5E74 A;  4LZS A;  3JVK A;  2M3H A;  4MEQ A;  4TKP B;  5FE4 A;  2YU4 A;  1WGM A;  4QSQ A;  5E9Y A;  4TZ8 A;  1X4I A;  5A5O A;  5D3S A;  3P1F A;  3UVY A;  1WEE A;  1VD4 A;  3M99 A;  4A4B A;  5HEL A;  1N72 A;  2WP2 A;  2K1J A;  4Q6F A;  1HYJ A;  4BW2 A;  4A9E A;  1LDK C;  2KIZ A;  2MNY A;  2OXQ C;  4O75 A;  4NN2 A;  1HYI A;  4N4F A;  3O7A A;  2RO1 A;  4XY8 A;  4OUF A;  5IGL A;  1WUM A;  1ZS5 A;  4Q0N A;  5BT5 A;  5LKZ A;  4O64 A;  3O35 A;  3SVH A;  4ZQL A;  1WUG A;  5E0R A;  2K16 A;  2YEM A;  5TAB A;  4F52 B;  3UV2 A;  5DW2 A;  4NRA A;  5EVA A;  3O33 A;  4IR5 A;  5ENF A;  2YUC A;  4S3O B;  5F5Z A;  5II2 A;  3L1Z B;  1DVP A;  3T7L A;  5CZG A;  4ZC9 A;  2EGP A;  2G43 A;  5FE2 A;  4YBS A;  4MSX A;  4O72 A;  4A0C D;  4QEU A;  5HFR A;  4R7E A;  1ZBD B;  5FE8 A;  5E9L A;  3O36 A;  2WP1 A;  2Y1M A;  3M63 A;  3U5M A;  3N9P A;  4PCI A;  5BT4 A;  5I86 A;  4HXL A;  3MHS A;  4LZR A;  4Y03 A;  4A9K A;  5D26 A;  2R0S A;  4J0R A;  5DLZ A;  4Z6I A;  5C8G A;  4UYE A;  5JWM A;  5AIU A;  1XWH A;  1JM4 B;  5HQ7 A;  5FE9 A;  3MUK A;  4YYD A;  5L99 A;  4NXJ A;  3RTR B;  5FBX A;  4FO9 A;  5BT3 A;  3UVX A;  4GNG A;  4BBQ A;  4CLB A;  4O7C A;  2GRC A;  5A5N A;  3IU6 A;  2ECN A;  4CUT A;  5CU8 A;  4QYL A;  5CUA A;  1FP0 A;  4UIW A;  3LJW A;  3VK6 A;  5G4S A;  1WEW A;  2YQL A;  2VJF B;  5D3H A;  4Z6H A;  4Z1Q A;  1JOC A;  5EYA F;  5ETD A;  3U5K A;  5E9I A;  5F3A A;  5HQ6 A;  4NRC A;  4PCE A;  2L75 A;  1WEU A;  2LRI C;  2MD8 C;  4QST A;  5A5Q A;  4CUU A;  5I80 A;  5ETB A;  3UVW A;  4YYN A;  4CUR A;  1WIL A;  3ZYU A;  3N9N A;  4GNF A;  3IU5 A;  4YC9 A;  5L98 A;  4BJX A;  5D1K B;  2K17 A;  2XB1 A;  4C9Z A;  4NUC A;  4UI9 B;  5KH9 A;  2YEL A;  4YAB A;  5FE6 A;  2QIC A;  5CGP A;  3PUQ A;  2DX8 A;  2KRE A;  1WIM A;  5D3P A;  4LRG A;  5DY7 A;  5E3D A;  5CQ5 A;  5HQ5 A;  5IID A;  5F25 A;  5G05 B;  5A83 A;  5D7X A;  5L96 A;  2CSZ A;  4A9I A;  1RMD A;  5HRX A;  5ENI A;  5E9M A;  3U5J A;  5L97 A;  4YYH A;  4IC3 A;  5I88 A;  5LJ0 A;  4IOQ A;  1WEM A;  5CUB A;  3HME A;  2RNY A;  4P5O B;  5KHM A;  2DVV A;  5D3R A;  5DKD A;  2C2L A;  1LDJ B;  1Z6U A;  5CQ4 A;  4BHW A;  5CS8 A;  4FJC A;  2ECW A;  5IG6 A;  2VJF A;  1T1H A;  4QYD A;  4LJN A;  5DFD A;  4C66 A;  4KV4 A;  2I7K A;  2E7O A;  2YSM A;  1WEP A;  3JVM A;  5C87 A;  2L5U A;  3N9O A;  5EU1 A;  4WIV A;  2KGG A;  4YAD A;  2NXB A;  1WEV A;  4RVR A;  5HCL A;  3ZVZ B;  4B86 C;  5KH7 A;  5HM0 A;  4IR3 A;  3QZT A;  4WA6 A;  4CCG X;  4UP0 A;  2KWN A;  3G0L A;  3MUL A;  4IOO A;  2VP7 A;  4OGI A;  2L84 A;  4NR5 A;  4XYA A;  3O70 A;  4O7A A;  5KO4 A;  1WEO A;  2I8N A;  4HXP A;  5KU3 A;  5A5P A;  4HBY A;  5FE7 A;  2PNX A;  2JRJ A;  4Z93 A;  4AKN A;  3MB4 A;  2YRE A;  3QZS A;  4KCX A;  3S91 A;  3N9M A;  3KV6 A;  3I2D A;  5FH8 A;  5G4R A;  3C6W A;  4YY6 A;  3N9L A;  2EA6 A;  3T6R A;  5D1L B;  2RNW A;  5DBM A;  4A9O A;  5IGN A;  4YBT A;  5FB0 A;  5L8T A;  2YHN A;  1EQF A;  4IOR A;  4CUQ A;  2QIZ A;  1F68 A;  2YW8 A;  4I7C A;  5D1M B;  4W4U A;  2KR4 A;  2ECJ A;  3MB3 A;  3PHD A;  4QEV A;  5FDZ A;  4QSV A;  5FFV A;  4WZ0 A;  4IR4 A;  2KWJ A;  4MEP A;  2H0D B;  1WEN A;  5FE0 A;  5F36 A;  2CKL B;  2VNF A;  3HTK C;  5B8D A;  5ENG A;  5H1T A;  3N9Q A;  4A9F A;  4L58 A;  4UYG A;  4ZUX U;  4UIZ A;  5C85 A;  2JMD A;  2VPE A;  2ZET C;  4I7D A;  5LVQ A;  3UVD A;  3ZPV E;  4MEO A;  5ACY A;  4DON A;  1JM7 B;  5DFB A;  5D3N A;  3HMF A;  2XEU A;  2E6R A;  3D7C A;  3QZV A;  4BW4 A;  2YQM A;  5AD3 A;  3SHB A;  2YW5 A;  2VJE B;  4QSU A;  2OSS A;  2D82 A;  2RFJ A;  3UV5 A;  5KTX A;  2F42 A;  5LKX A;  1VYX A;  4QNS A;  2UZG A;  1IYM A;  4HBX A;  2MA5 A;  3G0J A;  4UP5 A;  5EWV A;  5DYU A;  4YY4 A;  5A82 A;  4YH4 A;  4MEN A;  1X0J A;  4QBM A;  2KWK A;  2OO1 A;  4N4I A;  5COI A;  5HEN A;  2ECG A;  5ENJ A;  5EIC A;  3L1X A;  4PKL A;  5EA1 A;  2FUI A;  4LR6 A;  3SOU A;  5FE1 A;  4O76 A;  3HCT A;  3RPG C;  4WHU A;  2LDR A;  2Y43 A;  4QSW A;  5EGU A;  4O77 A;  5CQ7 A;  5E73 A;  2LGL A;  3SOX A;  5I29 A;  1WES A;  5B75 A;  5FFW A;  4A9N A;  3NG2 A;  2NAA A;  2H0D A;  5TRB A;  2CKL A;  4O78 A;  4GNE A;  5F61 A;  4GB0 A;  5C13 A;  2ECI A;  5KH3 A;  4N4H A;  5DKC A;  3LQH A;  3UW9 A;  5DX4 A;  5LUU A;  5E9V A;  4LKA A;  2KE1 A;  2LV9 A;  4MVT A;  4TT4 A;  4WZ3 B;  4A9J A;  4O74 A;  4N4G A;  5EWW A;  5D0C A;  4TU6 A;  2VJE A;  4QZS A;  4QUT A;  4NYX A;  1U6G B;  5C7N A;  5FEY A;  4TS8 A;  4YK0 A;  1X4U A;  4QC3 A;  3EB6 A;  2G4A A;  2G45 A;  4AVX A;  5JG6 A;  3NXB A;  4OGJ A;  2VPB A;  5EWH A;  5B79 A;  4LLB A;  2LXH C;  2L80 A;  2YSJ A;  4IC2 A;  2OUO A;  4LAD B;  5EWC A;  4MR5 A;  3U5L A;  4BW3 A;  1WEQ A;  5CUC A;  3ASL A;  5EPR A;  2E3K A;  2ECV A;  5FH6 A;  4NQM A;  3C5K A;  3DPL R;  2R0V A;  2MJV B;  4LZ2 A;  3TLP A;  5TDR A;  1N87 A;  3O37 A;  4TTE A;  5DLX A;  3UV4 A;  5TDW A;  5I7Y A;  3DWY A;  2D9E A;  4QR5 A;  5AD2 A;  3KNV A;  1E6I A;  2KWO A;  3S92 A;  4O7E A;  4UIV A;  5EI4 A;  2M85 A;  3V43 A;  5HLS A;  5LJ2 A;  5CP5 A;  4YAX A;  5A5S A;  5FE5 A;  2KFT A;  5CUD A;  4L7X A;  2I50 A;  5H1V A;  5FFY A;  2RI7 A;  4E96 A;  2FSA A;  5IGK A;  5CPE A;  2DKW A;  3U5N A;  2QJ0 A;  1FBV A;  2L0B A;  4ZW1 A;  4O70 A;  5CQT A;  5I7X A;  5CQ6 A;  5I1Q A;  4HXM A;  1MM3 A;  4A49 A;  4QEW A;  3ZYQ A;  4YAT A;  3Q2E A;  5TBN A;  4TT6 A;  5DFC A;  5AME A;  2G6Q A;  2KU3 A;  2RSD A;  4R2Y A;  5G0F A;  4MR3 A;  2YQD A;  2YDW A;  4FLP A;  2EOD A;  4XY9 A;  4S3O C;  4YBM A;  2ECT A;  5HFQ A;  4QR4 A;  5H9M A;  1JSP B;  4PS5 A;  2YT5 A;  3HMH A;  5A7C A;  1V87 A;  1K2F A;  2JMJ A;  2M6M A;  4XUA A;  4C67 A;  3I3J A;  3M62 A;  4J1P A;  4TU4 A;  5EQ1 A;  2R0Y A;  4UIU A;  2M1R A;  2MIQ A;  5DYC A;  4X2I A;  3U5O A;  2AN6 A;  2KTB B;  1WFK A;  5FE3 A;  5F1L A;  4TQN A;  5C4Q A;  5EPB A;  2YYR A;  5DIN A;  4HXS A;  5EIS A;  4HXK A;  4QF2 A;  2C2V S;  2RNX A;  4QSS A;  3LQI A;  3AQA A;  5LKT A;  5ENH A;  4UYH A;  3GL6 A;  4LC2 A;  4TYL A;  5FH7 A;  3IHP A;  3KV5 A;  2MT5 A;  4UYD A;  4GND A;  4BW1 A;  5LJ1 A;  4HBV A;  3PUR A;  4QB3 A;  4LYW A;  2KGI A; 
#chains in the Genus database with same CATH topology
 5J0D A;  2YVR A;  4LYI A;  3ZTG A;  4QSR A;  2FD4 A;  4UYF B;  5ENE A;  2YEK A;  4MR6 A;  4X3G A;  2YYN A;  4YYM A;  3P1C A;  4NS5 A;  2Y1N A;  3ZPV 1;  5B78 A;  2YUR A;  4PTB A;  5KTU A;  3DDT A;  4GPJ A;  4Z1S A;  5G04 B;  2LXP C;  3HCS A;  4LDF A;  4QSX A;  2HYE D;  4V3L C;  3P1D A;  4HXR A;  4NR4 A;  4ALG A;  4YYK A;  2MUM A;  2CSV A;  3GV4 A;  4AUQ B;  3ONI A;  4QSP A;  5KTW A;  4WHW A;  4KV1 A;  5HEM A;  5A81 A;  2MD7 B;  2CRW A;  5SVX A;  3DQV R;  3FEH A;  5D24 A;  1VFY A;  2F6J A;  2N9G A;  4CUS A;  5ENC A;  5LVR A;  2BAY A;  5CQ8 A;  2KKY A;  2YHO A;  2H60 A;  2RS9 B;  4NR7 A;  4NR9 A;  4NYW A;  4ALH A;  2LQ6 A;  3L11 A;  4YH3 A;  4CUP A;  5IBN A;  4NQN A;  4A9H A;  5SVY A;  1Z60 A;  3JVL A;  2RR4 A;  1E4U A;  4CFL A;  4UIT A;  2KYU A;  5TB6 A;  2CRR A;  2L7P A;  4LK9 A;  5AIT A;  1X4J A;  4AYC B;  1JM7 A;  5CRM A;  4QUU A;  4NYV A;  5D3J A;  4FIP A;  5HJC A;  1CHC A;  4YYJ A;  5C11 A;  2L43 A;  5CQ3 A;  5DYA A;  5CY9 A;  2JMI A;  3LRQ A;  4UIX A;  4UYF A;  5E9K A;  5LCW B;  5D25 A;  2DWW A;  4Z0R A;  5F1H A;  2D8S A;  5FB1 A;  2K4D A;  5D3L A;  2R10 A;  3O34 A;  2LGK A;  4O71 A;  3SVF A;  4O7F A;  4A9L A;  1MM2 A;  4Q0O A;  5E3G A;  4HBW A;  2DVS A;  2FUU A;  5JI8 A;  3HCU A;  4NR6 A;  3RPG B;  4FK5 A;  4NUE A;  2E6S A;  3LVQ E;  3MHH A;  4QF3 A;  4NUD A;  1G25 A;  4YYI A;  5CTL A;  4WZ2 A;  3MQM A;  2LGV A;  4QY4 A;  5HRW A;  4CA1 A;  5L8U A;  3EB5 A;  4HXN A;  2MA6 A;  2L85 A;  3FKM X;  4J3I A;  3SOW A;  4QC1 A;  3Q2F A;  2L5E A;  5EV9 A;  5J3X A;  5FER A;  5F63 A;  5FG4 A;  4A9M A;  4O7B A;  5H1U A;  4MR4 A;  5K29 A;  4AKI A;  3KQI A;  2E7N A;  4I7B A;  4AYC A;  5EK9 A;  2DVQ A;  5CFW A;  3RCW A;  2LSP B;  5C89 A;  4A4C A;  5E7D A;  2LGG A;  5I89 A;  5DKH A;  4QR3 A;  4R8P K;  1F62 A;  2VPG A;  5A5R A;  4TZ2 A;  5CRZ A;  5TCM A;  4YYG A;  3MXF A;  4CFK A;  5FG6 A;  4UIY A;  5F2P A;  3P1E A;  4PPE A;  4AP4 A;  2F6N A;  5B77 A;  5LKU A;  3U5P A;  3P5O A;  3K2J A;  4AKH A;  5DYX A;  5IGM A;  1WE9 A;  2JM3 A;  5DKA A;  4XI1 A;  2MNZ A;  3LXJ A;  4IR6 A;  3LQJ A;  4CL9 A;  4F3I A;  4J0S A;  2IDA A;  4V3K C;  2DAT A;  2VPD A;  3GG3 A;  5CUG A;  3ZVY A;  2LN0 A;  5EWD A;  2HDP A;  3ZNI A;  2PUY A;  5HRV A;  4N3W A;  4NRB A;  4HXO A;  3DAI A;  4NR8 A;  5D3T A;  2CSY A;  5CQA A;  5CUE A;  1BOR A;  1Z2Q A;  5I3L A;  3JVJ A;  3LDY A;  5EM3 A;  4TT2 A;  4ZDT A;  5H85 A;  5F62 A;  3AAD A;  5FG5 A;  5AMF A;  2M13 A;  5II1 A;  2CT2 A;  4PY6 A;  5A85 A;  5I83 A;  5I40 A;  5EPS A;  4LYS A;  5F60 A;  3FL2 A;  5B76 A;  5ENB A;  3SVG A;  4XUB A;  5EP7 A;  2DVR A;  4B7Y C;  5DW1 A;  5E74 A;  4LZS A;  3JVK A;  2CON A;  2M3H A;  4MEQ A;  4TKP B;  5FE4 A;  2YU4 A;  1WGM A;  4QSQ A;  5E9Y A;  4TZ8 A;  1X4I A;  5A5O A;  5D3S A;  3P1F A;  3UVY A;  1WEE A;  1VD4 A;  3M99 A;  4A4B A;  5HEL A;  1N72 A;  2WP2 A;  2K1J A;  4Q6F A;  3T9K A;  1HYJ A;  4BW2 A;  4A9E A;  1LDK C;  2KIZ A;  2MNY A;  2OXQ C;  4O75 A;  4NN2 A;  1HYI A;  4N4F A;  3O7A A;  2RO1 A;  4XY8 A;  4OUF A;  5IGL A;  1WUM A;  1ZS5 A;  4Q0N A;  5BT5 A;  5LKZ A;  4O64 A;  3O35 A;  3SVH A;  4ZQL A;  1WUG A;  3PLW A;  5E0R A;  2K16 A;  2YEM A;  5TAB A;  4F52 B;  3UV2 A;  5DW2 A;  4NRA A;  5EVA A;  3O33 A;  4IR5 A;  5ENF A;  2YUC A;  3FAN A;  5F5Z A;  5II2 A;  3L1Z B;  1DVP A;  4S3O B;  3T7L A;  5CZG A;  4ZC9 A;  2EGP A;  2G43 A;  5FE2 A;  4YBS A;  4MSX A;  4O72 A;  4A0C D;  4QEU A;  5HFR A;  4R7E A;  3LVR E;  1ZBD B;  5FE8 A;  5E9L A;  3O36 A;  2WP1 A;  2Y1M A;  3M63 A;  3U5M A;  3N9P A;  3O47 A;  4PCI A;  5BT4 A;  5I86 A;  4HXL A;  3MHS A;  1ZKR A;  4LZR A;  4AI6 A;  4Y03 A;  4A9K A;  5D26 A;  2R0S A;  4J0R A;  5DLZ A;  4Z6I A;  5C8G A;  4UYE A;  5JWM A;  5AIU A;  1XWH A;  1JM4 B;  5HQ7 A;  5FE9 A;  3MUK A;  4YYD A;  5L99 A;  4NXJ A;  2OWA A;  3RTR B;  5FBX A;  4FO9 A;  5BT3 A;  3LJU X;  3UVX A;  4GNG A;  4BBQ A;  4CLB A;  4Z0O A;  4O7C A;  3VKH A;  2GRC A;  5A5N A;  3IU6 A;  2ECN A;  4QQ4 A;  4CUT A;  5CU8 A;  2DJA A;  4QYL A;  5CUA A;  1FP0 A;  4UIW A;  3LJW A;  2EXU A;  3VK6 A;  5G4S A;  1WEW A;  2YQL A;  2VJF B;  5D3H A;  4OGE A;  4Z6H A;  4Z1Q A;  1JOC A;  5EYA F;  5ETD A;  3U5K A;  5SVI B;  5E9I A;  5F3A A;  5HQ6 A;  4NRC A;  4PCE A;  2L75 A;  1WEU A;  2LRI C;  2MD8 C;  2XOZ A;  4QST A;  5A5Q A;  4CUU A;  5I80 A;  5ETB A;  3UVW A;  4YYN A;  4CUR A;  1WIL A;  3ZYU A;  3N9N A;  4GNF A;  3IU5 A;  4YC9 A;  5L98 A;  4BJX A;  3VKG A;  5D1K B;  2K17 A;  3ERR A;  2XB1 A;  2KKX A;  4C9Z A;  4NUC A;  4UI9 B;  5KH9 A;  2YEL A;  4YAB A;  5FE6 A;  2QIC A;  5CGP A;  3PUQ A;  2DX8 A;  2IQJ A;  2KRE A;  1WIM A;  5D3P A;  4LRG A;  5DY7 A;  5E3D A;  3D1B A;  5CQ5 A;  5HQ5 A;  5IID A;  5F25 A;  5G05 B;  5A83 A;  5D7X A;  5L96 A;  2CSZ A;  4A9I A;  3JUE A;  1RMD A;  5HRX A;  5ENI A;  5E9M A;  3U5J A;  5L97 A;  4YYH A;  4IC3 A;  5I88 A;  5LJ0 A;  1MBM A;  4IOQ A;  3FAO A;  1WEM A;  5CUB A;  3HME A;  3SUB A;  2RNY A;  4P5O B;  5KHM A;  2DVV A;  5D3R A;  5DKD A;  2C2L A;  1LDJ B;  1Z6U A;  5CQ4 A;  4BHW A;  5CS8 A;  3H7H A;  4FJC A;  2ECW A;  5IG6 A;  2VJF A;  1T1H A;  4QYD A;  4LJN A;  5DFD A;  4C66 A;  4KV4 A;  2I7K A;  2E7O A;  1DCQ A;  2YSM A;  1WEP A;  3JVM A;  5C87 A;  2L5U A;  3N9O A;  5EU1 A;  4WIV A;  2KGG A;  4YAD A;  4O62 A;  2NXB A;  1WEV A;  4RVR A;  5HCL A;  3ZVZ B;  4B86 C;  5KH7 A;  5HM0 A;  4IR3 A;  3QZT A;  4WA6 A;  4CCG X;  4UP0 A;  2KWN A;  3G0L A;  3MUL A;  4IOO A;  2VP7 A;  4OGI A;  2L84 A;  4NR5 A;  4XYA A;  3O70 A;  4O7A A;  5KO4 A;  1WEO A;  2I8N A;  2XOC A;  4HXP A;  5KU3 A;  5A5P A;  4HBY A;  5FE7 A;  2PNX A;  2JRJ A;  4Z93 A;  4AKN A;  3MB4 A;  2YRE A;  3QZS A;  4KCX A;  3S91 A;  3N9M A;  3KV6 A;  3I2D A;  5FH8 A;  2JUN A;  5G4R A;  3C6W A;  4YY6 A;  3N9L A;  2EA6 A;  3T6R A;  5D1L B;  2RNW A;  5DBM A;  4A9O A;  5IGN A;  4YBT A;  5FB0 A;  5L8T A;  2YHN A;  1EQF A;  4IOR A;  4CUQ A;  2QIZ A;  1F68 A;  2YW8 A;  4I7C A;  5D1M B;  4W4U A;  2KR4 A;  2ECJ A;  3MB3 A;  3PHD A;  4QEV A;  5FDZ A;  4QSV A;  5FFV A;  4WZ0 A;  4IR4 A;  2KWJ A;  4MEP A;  2DSM A;  2H0D B;  1WEN A;  5FE0 A;  5F36 A;  2CKL B;  2VNF A;  3HTK C;  5B8D A;  5ENG A;  5H1T A;  3N9Q A;  4A9F A;  4L58 A;  4UYG A;  4ZUX U;  4UIZ A;  5C85 A;  2JMD A;  2VPE A;  2ZET C;  4I7D A;  5LVQ A;  3UVD A;  3ZPV E;  4MEO A;  5ACY A;  4DON A;  1JM7 B;  5DFB A;  5D3N A;  3HMF A;  2XEU A;  2E6R A;  3D7C A;  3QZV A;  4BW4 A;  2YQM A;  5K3Q A;  5AD3 A;  3SHB A;  2YW5 A;  1PUO A;  2VJE B;  4QSU A;  2OSS A;  2D82 A;  2RFJ A;  3UV5 A;  5KTX A;  2F42 A;  5LKX A;  1VYX A;  4QNS A;  2UZG A;  1IYM A;  4HBX A;  2MA5 A;  3G0J A;  4OGC A;  5EWV A;  5DYU A;  4YY4 A;  5A82 A;  4YH4 A;  4AKG A;  4UP5 A;  4MEN A;  1X0J A;  4QBM A;  2KWK A;  2OO1 A;  4N4I A;  5COI A;  5HEN A;  2ECG A;  5ENJ A;  5EIC A;  3L1X A;  2FFW A;  4PKL A;  5EA1 A;  2FUI A;  4LR6 A;  3SOU A;  5FE1 A;  4O76 A;  3HCT A;  3RPG C;  3M7K A;  4WHU A;  2LDR A;  2Y43 A;  4QSW A;  5EGU A;  4O77 A;  5CQ7 A;  5E73 A;  2LGL A;  3SOX A;  5I29 A;  1WES A;  5B75 A;  5FFW A;  3MDB C;  4A9N A;  2EGM A;  3NG2 A;  2MKE A;  2NAA A;  2H0D A;  5TRB A;  2CKL A;  4O78 A;  4GNE A;  5F61 A;  4GB0 A;  5C13 A;  3FM8 C;  2ECI A;  5KH3 A;  4N4H A;  5DKC A;  3LQH A;  3UW9 A;  5DX4 A;  5LUU A;  5E9V A;  4LKA A;  2KE1 A;  2LV9 A;  4MVT A;  4TT4 A;  4WZ3 B;  4A9J A;  4O74 A;  4N4G A;  5EWW A;  5D0C A;  4TU6 A;  2VJE A;  4QZS A;  4QUT A;  4NYX A;  1U6G B;  3E2D A;  5C7N A;  5FEY A;  4TS8 A;  4YK0 A;  1X4U A;  4QC3 A;  3EB6 A;  2G4A A;  2G45 A;  4AVX A;  5JG6 A;  3NXB A;  4OGJ A;  2VPB A;  5EWH A;  5B79 A;  4LLB A;  2D8U A;  2LXH C;  2L80 A;  2YSJ A;  4IC2 A;  2OUO A;  4LAD B;  5EWC A;  4MR5 A;  3U5L A;  4BW3 A;  1WEQ A;  5CUC A;  3ASL A;  5EPR A;  2E61 A;  2E3K A;  2ECV A;  5FH6 A;  3D1D A;  4NQM A;  3C5K A;  3DPL R;  2R0V A;  2MJV B;  4LZ2 A;  3TLP A;  5TDR A;  1N87 A;  3O37 A;  4TTE A;  5DLX A;  3UV4 A;  5TDW A;  5I7Y A;  3DWY A;  2D9E A;  4QR5 A;  5AD2 A;  3KNV A;  1E6I A;  2KWO A;  5SVI A;  3S92 A;  4O7E A;  4UIV A;  5EI4 A;  2M85 A;  3V43 A;  5HLS A;  5LJ2 A;  5CP5 A;  4YAX A;  5A5S A;  5FE5 A;  2KFT A;  5CUD A;  4L7X A;  2I50 A;  5H1V A;  5FFY A;  2RI7 A;  2XOY A;  4E96 A;  2FSA A;  5IGK A;  5CPE A;  2B0O E;  2DKW A;  3U5N A;  2QJ0 A;  1FBV A;  2L0B A;  4ZW1 A;  4O70 A;  5CQT A;  5I7X A;  5CQ6 A;  5I1Q A;  4HXM A;  1MM3 A;  4A49 A;  4QEW A;  3ZYQ A;  4YAT A;  3Q2E A;  2LAU A;  4TT6 A;  5DFC A;  5AME A;  5TBN A;  2G6Q A;  2KU3 A;  2RSD A;  4R2Y A;  5G0F A;  4MR3 A;  3Q1D A;  2YQD A;  2YDW A;  4FLP A;  2EOD A;  4XY9 A;  4S3O C;  4YBM A;  2ECT A;  5HFQ A;  4QR4 A;  5H9M A;  1JSP B;  4PS5 A;  2YT5 A;  4H9D A;  3HMH A;  5A7C A;  1V87 A;  1K2F A;  2JMJ A;  2M6M A;  3FJU B;  4XUA A;  4C67 A;  4F1P A;  3I3J A;  2XP0 A;  3M62 A;  4J1P A;  4TU4 A;  5EQ1 A;  2R0Y A;  4UIU A;  2M1R A;  3DWD A;  2MIQ A;  5DYC A;  2EJN A;  4X2I A;  3U5O A;  2AN6 A;  2KTB B;  1WFK A;  5FE3 A;  5F1L A;  4TQN A;  5C4Q A;  5EPB A;  2YYR A;  5DIN A;  4HXS A;  5EIS A;  4HXK A;  4QF2 A;  3KDE C;  2C2V S;  2RNX A;  4QSS A;  3LQI A;  3AQA A;  5LKT A;  5ENH A;  4UYH A;  3GL6 A;  4LC2 A;  4TYL A;  5FH7 A;  3IHP A;  3KV5 A;  2MT5 A;  4UYD A;  4GND A;  2P57 A;  4BW1 A;  5LJ1 A;  4HBV A;  3PUR A;  4QB3 A;  4LYW A;  2KGI A; 
#chains in the Genus database with same CATH homology
 5J0D A;  3ZTG A;  4LYI A;  4QSR A;  4UYF B;  5ENE A;  2YEK A;  4MR6 A;  4X3G A;  2YYN A;  4YYM A;  3P1C A;  4NS5 A;  2Y1N A;  3ZPV 1;  5B78 A;  2YUR A;  4PTB A;  5KTU A;  5G04 B;  4GPJ A;  4Z1S A;  2LXP C;  3HCS A;  4LDF A;  4QSX A;  2HYE D;  4V3L C;  3P1D A;  4HXR A;  4NR4 A;  4ALG A;  4YYK A;  2MUM A;  3GV4 A;  4AUQ B;  3ONI A;  4QSP A;  5KTW A;  4WHW A;  4KV1 A;  5HEM A;  5A81 A;  2MD7 B;  3DQV R;  5D24 A;  1VFY A;  2F6J A;  2N9G A;  4CUS A;  5ENC A;  5LVR A;  2BAY A;  5CQ8 A;  2YHO A;  2H60 A;  2RS9 B;  4NR7 A;  4NR9 A;  4NYW A;  4ALH A;  2LQ6 A;  3L11 A;  4YH3 A;  4CUP A;  5IBN A;  4NQN A;  4A9H A;  1Z60 A;  3JVL A;  1E4U A;  4CFL A;  4UIT A;  2KYU A;  5TB6 A;  4LK9 A;  5AIT A;  1JM7 A;  4AYC B;  1X4J A;  5CRM A;  4QUU A;  4NYV A;  5D3J A;  4FIP A;  5HJC A;  1CHC A;  4YYJ A;  5C11 A;  2L43 A;  5CQ3 A;  5DYA A;  5CY9 A;  2JMI A;  3LRQ A;  4UIX A;  4UYF A;  5E9K A;  5LCW B;  5D25 A;  2DWW A;  5F1H A;  2D8S A;  5FB1 A;  2K4D A;  5D3L A;  2R10 A;  3O34 A;  2LGK A;  4O71 A;  3SVF A;  4O7F A;  4A9L A;  1MM2 A;  4Q0O A;  5E3G A;  4HBW A;  2DVS A;  2FUU A;  5JI8 A;  3HCU A;  4NR6 A;  3RPG B;  4FK5 A;  4NUE A;  2E6S A;  3MHH A;  4QF3 A;  4NUD A;  1G25 A;  4YYI A;  5CTL A;  4WZ2 A;  3MQM A;  2LGV A;  4QY4 A;  5HRW A;  4CA1 A;  5L8U A;  3EB5 A;  4HXN A;  2MA6 A;  2L85 A;  3FKM X;  4J3I A;  3SOW A;  4QC1 A;  3Q2F A;  2L5E A;  5EV9 A;  5J3X A;  5FER A;  5F63 A;  5FG4 A;  4A9M A;  4O7B A;  5H1U A;  4MR4 A;  5K29 A;  3KQI A;  2E7N A;  4I7B A;  4AYC A;  5EK9 A;  2DVQ A;  5CFW A;  3RCW A;  2LSP B;  5C89 A;  4A4C A;  5E7D A;  2LGG A;  5I89 A;  5DKH A;  4QR3 A;  4R8P K;  1F62 A;  2VPG A;  5A5R A;  4TZ2 A;  5CRZ A;  5TCM A;  4YYG A;  3MXF A;  4CFK A;  5FG6 A;  4UIY A;  5F2P A;  3P1E A;  4PPE A;  4AP4 A;  2F6N A;  5B77 A;  5LKU A;  3U5P A;  3P5O A;  3K2J A;  5DYX A;  5IGM A;  1WE9 A;  5DKA A;  4XI1 A;  2MNZ A;  3LXJ A;  4IR6 A;  3LQJ A;  4CL9 A;  4F3I A;  4J0S A;  2IDA A;  4V3K C;  2DAT A;  2VPD A;  3GG3 A;  5CUG A;  3ZVY A;  2LN0 A;  5EWD A;  2HDP A;  3ZNI A;  2PUY A;  5HRV A;  4N3W A;  4NRB A;  4HXO A;  3DAI A;  4NR8 A;  5D3T A;  2CSY A;  5CQA A;  5CUE A;  1BOR A;  1Z2Q A;  5I3L A;  3JVJ A;  5EM3 A;  4TT2 A;  4ZDT A;  5H85 A;  5F62 A;  3AAD A;  5FG5 A;  5AMF A;  5II1 A;  2CT2 A;  4PY6 A;  5A85 A;  5I83 A;  5I40 A;  5EPS A;  4LYS A;  5F60 A;  3FL2 A;  5B76 A;  5ENB A;  3SVG A;  4XUB A;  5EP7 A;  2DVR A;  4B7Y C;  5DW1 A;  5E74 A;  4LZS A;  3JVK A;  2M3H A;  4MEQ A;  4TKP B;  5FE4 A;  2YU4 A;  1WGM A;  4QSQ A;  5E9Y A;  4TZ8 A;  1X4I A;  5A5O A;  5D3S A;  3P1F A;  3UVY A;  1WEE A;  1VD4 A;  3M99 A;  4A4B A;  5HEL A;  1N72 A;  2WP2 A;  2K1J A;  4Q6F A;  1HYJ A;  4BW2 A;  4A9E A;  1LDK C;  2KIZ A;  2MNY A;  2OXQ C;  4O75 A;  4NN2 A;  1HYI A;  4N4F A;  3O7A A;  2RO1 A;  4XY8 A;  4OUF A;  5IGL A;  1WUM A;  1ZS5 A;  4Q0N A;  5BT5 A;  5LKZ A;  4O64 A;  3O35 A;  3SVH A;  4ZQL A;  1WUG A;  5E0R A;  2K16 A;  2YEM A;  5TAB A;  4F52 B;  3UV2 A;  5DW2 A;  4NRA A;  5EVA A;  3O33 A;  4IR5 A;  5ENF A;  2YUC A;  4S3O B;  5F5Z A;  5II2 A;  3L1Z B;  1DVP A;  3T7L A;  5CZG A;  4ZC9 A;  2EGP A;  2G43 A;  5FE2 A;  4YBS A;  4MSX A;  4O72 A;  4A0C D;  4QEU A;  5HFR A;  4R7E A;  1ZBD B;  5FE8 A;  5E9L A;  3O36 A;  2WP1 A;  2Y1M A;  3M63 A;  3U5M A;  3N9P A;  4PCI A;  5BT4 A;  5I86 A;  4HXL A;  3MHS A;  4LZR A;  4Y03 A;  4A9K A;  5D26 A;  2R0S A;  4J0R A;  5DLZ A;  4Z6I A;  5C8G A;  4UYE A;  5JWM A;  5AIU A;  1XWH A;  1JM4 B;  5HQ7 A;  5FE9 A;  3MUK A;  4YYD A;  5L99 A;  4NXJ A;  3RTR B;  5FBX A;  4FO9 A;  5BT3 A;  3UVX A;  4GNG A;  4BBQ A;  4CLB A;  4O7C A;  2GRC A;  5A5N A;  3IU6 A;  2ECN A;  4CUT A;  5CU8 A;  4QYL A;  5CUA A;  1FP0 A;  4UIW A;  3LJW A;  3VK6 A;  5G4S A;  1WEW A;  2YQL A;  2VJF B;  5D3H A;  4Z6H A;  4Z1Q A;  1JOC A;  5EYA F;  5ETD A;  3U5K A;  5E9I A;  5F3A A;  5HQ6 A;  4NRC A;  4PCE A;  2L75 A;  1WEU A;  2LRI C;  2MD8 C;  4QST A;  5A5Q A;  4CUU A;  5I80 A;  5ETB A;  3UVW A;  4YYN A;  4CUR A;  1WIL A;  3ZYU A;  3N9N A;  4GNF A;  3IU5 A;  4YC9 A;  5L98 A;  4BJX A;  5D1K B;  2K17 A;  2XB1 A;  4C9Z A;  4NUC A;  4UI9 B;  5KH9 A;  2YEL A;  4YAB A;  5FE6 A;  2QIC A;  5CGP A;  3PUQ A;  2DX8 A;  2KRE A;  1WIM A;  5D3P A;  4LRG A;  5DY7 A;  5E3D A;  5CQ5 A;  5HQ5 A;  5IID A;  5F25 A;  5G05 B;  5A83 A;  5D7X A;  5L96 A;  2CSZ A;  4A9I A;  1RMD A;  5HRX A;  5ENI A;  5E9M A;  3U5J A;  5L97 A;  4YYH A;  4IC3 A;  5I88 A;  5LJ0 A;  4IOQ A;  1WEM A;  5CUB A;  3HME A;  2RNY A;  4P5O B;  5KHM A;  2DVV A;  5D3R A;  5DKD A;  2C2L A;  1LDJ B;  1Z6U A;  5CQ4 A;  4BHW A;  5CS8 A;  4FJC A;  2ECW A;  5IG6 A;  2VJF A;  1T1H A;  4QYD A;  4LJN A;  5DFD A;  4C66 A;  4KV4 A;  2I7K A;  2E7O A;  2YSM A;  1WEP A;  3JVM A;  5C87 A;  2L5U A;  3N9O A;  5EU1 A;  4WIV A;  2KGG A;  4YAD A;  2NXB A;  1WEV A;  4RVR A;  5HCL A;  3ZVZ B;  4B86 C;  5KH7 A;  5HM0 A;  4IR3 A;  3QZT A;  4WA6 A;  4CCG X;  4UP0 A;  2KWN A;  3G0L A;  3MUL A;  4IOO A;  2VP7 A;  4OGI A;  2L84 A;  4NR5 A;  4XYA A;  3O70 A;  4O7A A;  5KO4 A;  1WEO A;  2I8N A;  4HXP A;  5KU3 A;  5A5P A;  4HBY A;  5FE7 A;  2PNX A;  2JRJ A;  4Z93 A;  4AKN A;  3MB4 A;  2YRE A;  3QZS A;  4KCX A;  3S91 A;  3N9M A;  3KV6 A;  3I2D A;  5FH8 A;  5G4R A;  3C6W A;  4YY6 A;  3N9L A;  2EA6 A;  3T6R A;  5D1L B;  2RNW A;  5DBM A;  4A9O A;  5IGN A;  4YBT A;  5FB0 A;  5L8T A;  2YHN A;  1EQF A;  4IOR A;  4CUQ A;  2QIZ A;  1F68 A;  2YW8 A;  4I7C A;  5D1M B;  4W4U A;  2KR4 A;  2ECJ A;  3MB3 A;  3PHD A;  4QEV A;  5FDZ A;  4QSV A;  5FFV A;  4WZ0 A;  4IR4 A;  2KWJ A;  4MEP A;  2H0D B;  1WEN A;  5FE0 A;  5F36 A;  2CKL B;  2VNF A;  3HTK C;  5B8D A;  5ENG A;  5H1T A;  3N9Q A;  4A9F A;  4L58 A;  4UYG A;  4ZUX U;  4UIZ A;  5C85 A;  2JMD A;  2VPE A;  2ZET C;  4I7D A;  5LVQ A;  3UVD A;  3ZPV E;  4MEO A;  5ACY A;  4DON A;  1JM7 B;  5DFB A;  5D3N A;  3HMF A;  2XEU A;  2E6R A;  3D7C A;  3QZV A;  4BW4 A;  2YQM A;  5AD3 A;  3SHB A;  2YW5 A;  2VJE B;  4QSU A;  2OSS A;  2D82 A;  2RFJ A;  3UV5 A;  5KTX A;  2F42 A;  5LKX A;  1VYX A;  4QNS A;  2UZG A;  1IYM A;  4HBX A;  2MA5 A;  3G0J A;  4UP5 A;  5EWV A;  5DYU A;  4YY4 A;  5A82 A;  4YH4 A;  4MEN A;  1X0J A;  4QBM A;  2KWK A;  2OO1 A;  4N4I A;  5COI A;  5HEN A;  2ECG A;  5ENJ A;  5EIC A;  3L1X A;  4PKL A;  5EA1 A;  2FUI A;  4LR6 A;  3SOU A;  5FE1 A;  4O76 A;  3HCT A;  3RPG C;  4WHU A;  2LDR A;  2Y43 A;  4QSW A;  5EGU A;  4O77 A;  5CQ7 A;  5E73 A;  2LGL A;  3SOX A;  5I29 A;  1WES A;  5B75 A;  5FFW A;  4A9N A;  3NG2 A;  2NAA A;  2H0D A;  5TRB A;  2CKL A;  4O78 A;  4GNE A;  5F61 A;  4GB0 A;  5C13 A;  2ECI A;  5KH3 A;  4N4H A;  5DKC A;  3LQH A;  3UW9 A;  5DX4 A;  5LUU A;  5E9V A;  4LKA A;  2KE1 A;  2LV9 A;  4MVT A;  4TT4 A;  4WZ3 B;  4A9J A;  4O74 A;  4N4G A;  5EWW A;  5D0C A;  4TU6 A;  2VJE A;  4QZS A;  4QUT A;  4NYX A;  1U6G B;  5C7N A;  5FEY A;  4TS8 A;  4YK0 A;  1X4U A;  4QC3 A;  3EB6 A;  2G4A A;  2G45 A;  4AVX A;  5JG6 A;  3NXB A;  4OGJ A;  2VPB A;  5EWH A;  5B79 A;  4LLB A;  2LXH C;  2L80 A;  2YSJ A;  4IC2 A;  2OUO A;  4LAD B;  5EWC A;  4MR5 A;  3U5L A;  4BW3 A;  1WEQ A;  5CUC A;  3ASL A;  5EPR A;  2E3K A;  2ECV A;  5FH6 A;  4NQM A;  3C5K A;  3DPL R;  2R0V A;  2MJV B;  4LZ2 A;  3TLP A;  5TDR A;  1N87 A;  3O37 A;  4TTE A;  5DLX A;  3UV4 A;  5TDW A;  5I7Y A;  3DWY A;  2D9E A;  4QR5 A;  5AD2 A;  3KNV A;  1E6I A;  2KWO A;  3S92 A;  4O7E A;  4UIV A;  5EI4 A;  2M85 A;  3V43 A;  5HLS A;  5LJ2 A;  5CP5 A;  4YAX A;  5A5S A;  5FE5 A;  2KFT A;  5CUD A;  4L7X A;  2I50 A;  5H1V A;  5FFY A;  2RI7 A;  4E96 A;  2FSA A;  5IGK A;  5CPE A;  2DKW A;  3U5N A;  2QJ0 A;  1FBV A;  2L0B A;  4ZW1 A;  4O70 A;  5CQT A;  5I7X A;  5CQ6 A;  5I1Q A;  4HXM A;  1MM3 A;  4A49 A;  4QEW A;  3ZYQ A;  4YAT A;  3Q2E A;  5TBN A;  4TT6 A;  5DFC A;  5AME A;  2G6Q A;  2KU3 A;  2RSD A;  4R2Y A;  5G0F A;  4MR3 A;  2YQD A;  2YDW A;  4FLP A;  2EOD A;  4XY9 A;  4S3O C;  4YBM A;  2ECT A;  5HFQ A;  4QR4 A;  5H9M A;  1JSP B;  4PS5 A;  2YT5 A;  3HMH A;  5A7C A;  1V87 A;  1K2F A;  2JMJ A;  2M6M A;  4XUA A;  4C67 A;  3I3J A;  3M62 A;  4J1P A;  4TU4 A;  5EQ1 A;  2R0Y A;  4UIU A;  2M1R A;  2MIQ A;  5DYC A;  4X2I A;  3U5O A;  2AN6 A;  2KTB B;  1WFK A;  5FE3 A;  5F1L A;  4TQN A;  5C4Q A;  5EPB A;  2YYR A;  5DIN A;  4HXS A;  5EIS A;  4HXK A;  4QF2 A;  2C2V S;  2RNX A;  4QSS A;  3LQI A;  3AQA A;  5LKT A;  5ENH A;  4UYH A;  3GL6 A;  4LC2 A;  4TYL A;  5FH7 A;  3IHP A;  3KV5 A;  2MT5 A;  4UYD A;  4GND A;  4BW1 A;  5LJ1 A;  4HBV A;  3PUR A;  4QB3 A;  4LYW A;  2KGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...