4N3WA

Crystal structure of the bromodomain-phd finger module of human transcriptional co-activator cbp in complex with acetylated histone 4 peptide (h4k20ac).
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
231
structure length
184
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCDDPSQPQTTKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Structural Insights into Acetylated-Histone H4 Recognition by the Bromodomain-PHD Finger Module of Human Transcriptional Coactivator CBP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/nuclear protein
total genus 55
structure length 184
sequence length 231
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF06001 DUF902 Domain of Unknown Function (DUF902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n3wA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4n3wA02
2VNFA 5B75A 5I80A 4Z93A 2K1JA 1JOCA 5D1MB 3RPGC 5IG6A 5FE2A 5KH7A 1N72A 4LRGA 4J1PA 5EU1A 2K16A 4LC2A 4GNGA 4A0CD 5D0CA 3K2JA 5HRXA 5FE8A 4NR9A 2CKLB 4UIZA 4QSPA 5ENCA 4NR5A 4LYIA 5EWDA 2NAAA 5B76A 4HXMA 4AVXA 5F5ZA 1WEUA 4QZSA 4O7AA 3JVKA 4TYLA 4UIYA 4TZ2A 5EA1A 4CUPA 5FH8A 4IR6A 2EGPA 4S3OB 5E9VA 4PKLA 5EWCA 2OO1A 5DW1A 4N4IA 3IHPA 5DFBA 2LGVA 3T7LA 2GRCA 5FB1A 1JM4B 5B79A 5FE3A 2C2VS 2DVSA 5CQ8A 5I83A 3I3JA 5JG6A 1HYJA 3MB4A 2KIZA 3UVYA 3C6WA 4UYHA 3G0JA 1F68A 3KV5A 5BT3A 4YH4A 2VPBA 1E4UA 5KU3A 5DKCA 4OUFA 5G4SA 3U5KA 5ENEA 2M85A 5L99A 2VP7A 5IGNA 4MR5A 1E6IA 5G4RA 4UP0A 5AMFA 5A82A 1X4JA 5ACYA 5LVQA 4KV1A 1DVPA 2I50A 2RSDA 4FLPA 4N3WA 5EK9A 4P5OB 4NUDA 5B77A 5KH3A 3C5KA 3UVWA 2ECNA 2MA5A 5CPEA 2WP2A 3MB3A 3LQJA 2QJ0A 4UYFB 5HRVA 4YBSA 5EISA 4MENA 2YSJA 4ZQLA 3PHDA 5A83A 4CUTA 4C9ZA 4GPJA 3GV4A 4BW2A 3GL6A 4HXOA 4MEQA 5EI4A 2E6RA 1Z6UA 3DPLR 4YYJA 4A9NA 3N9MA 1F62A 3Q2FA 3Q2EA 5HQ6A 2ZETC 4IOQA 5D3NA 5E9KA 5D3HA 1WEQA 5HELA 2K4DA 2YQLA 5E73A 2KWNA 1X4UA 5FH6A 4WZ0A 2RNXA 4O75A 4O78A 2DX8A 5EPRA 2R0SA 4LKAA 5AITA 4UYFA 4XY9A 5CRMA 1LDJB 5CUAA 3RCWA 5LCWB 4QB3A 4TS8A 5DBMA 3VK6A 5D7XA 3ZNIA 3U5JA 4QSUA 5CQAA 4QSVA 2DVRA 4CA1A 1WEWA 2MD7B 4J0RA 5CUGA 5EWWA 4IR3A 3ZVZB 3EB5A 2C2LA 4V3KC 3MULA 5ETBA 4NR4A 2DVQA 2YEMA 2YU4A 4ZW1A 5DKDA 5J0DA 4GB0A 2L5UA 4LADB 5FFVA 4A9IA 5CS8A 4CL9A 5I1QA 1FP0A 4O64A 1WESA 5E9LA 2I7KA 4MEOA 1Z60A 2MNZA 5A5SA 1T1HA 3SVGA 5LJ2A 5A7CA 4YYHA 1LDKC 2JMDA 2L80A 1VYXA 2ECWA 1HYIA 3ZTGA 5HM0A 3T6RA 4CFKA 5EWHA 2H60A 3HCTA 4XY8A 4HXLA 2MJVB 3JVLA 3ZVYA 5AMEA 2BAYA 4QUTA 2LRIC 2D9EA 1CHCA 2KGIA 2MNYA 5LKTA 5I7YA 5TBNA 4F3IA 2KREA 4E96A 4GNFA 4WZ2A 3JVJA 3ASLA 3HMEA 4QYDA 5EWVA 2DKWA 5C8GA 4LYSA 2D8SA 4I7CA 2YHNA 2YURA 5D3PA 2I8NA 4QUUA 2ECGA 4R8PK 3QZSA 5A5QA 2N9GA 5DYCA 5FE4A 2UZGA 4UIXA 1K2FA 2OUOA 5HLSA 3SHBA 2YYRA 3O37A 5CP5A 5E0RA 3NG2A 1MM3A 5D24A 4ZUXU 5CQ4A 5FG6A 5C4QA 5EM3A 2MUMA 5F63A 5C87A 5LVRA 3DWYA 4CCGX 1JSPB 4O72A 5ENFA 2LDRA 4O70A 2KU3A 3N9OA 4BJXA 5D1KB 2MD8C 2VJFB 3P1DA 4HXNA 5CUDA 4YH3A 2EODA 3EB6A 3HCSA 5ENGA 5II2A 2VPDA 5L8TA 4LLBA 5F60A 2YW8A 4YYGA 4O74A 1EQFA 5H85A 5JWMA 5G05B 4UIWA 5KO4A 3RTRB 2E7OA 2LXHC 3U5PA 2K17A 2KR4A 4UP5A 4IC2A 2WP1A 5CUBA 3LQHA 5FE9A 5D3JA 4QSSA 5ETDA 4C67A 2JMJA 2DVVA 3L1ZB 3SOWA 2VPEA 4QY4A 5C89A 4QC1A 4FIPA 2RS9B 2VJFA 4QR3A 4TKPB 4I7DA 4CLBA 2HYED 2KYUA 4NYXA 2RNYA 4NQMA 4IC3A 5G0FA 2RO1A 2CKLA 5FBXA 5CRZA 5D3TA 3S91A 3KV6A 5KH9A 2G4AA 4AUQB 5F36A 4A9MA 5I88A 5TRBA 1Z2QA 4WHWA 1ZS5A 4QR4A 2OSSA 4BW4A 2FUIA 4HXRA 4TT6A 4UYGA 4KCXA 5HEMA 4YYDA 4Q0OA 3JVMA 5HFRA 2YYNA 3I2DA 3GG3A 3LRQA 1WGMA 5TABA 3O35A 4O71A 2M1RA 4QEWA 4OGJA 1WUMA 5DFDA 2RNWA 3UV5A 5L97A 1RMDA 2IDAA 4J0SA 5FE5A 3PUQA 2JMIA 5DLXA 5F3AA 2F42A 1WEPA 2L85A 3LXJA 5H1UA 3M62A 2KWKA 4A4BA 2E3KA 1WFKA 5H9MA 4O7CA 4LZRA 5FERA 4XYAA 2LGLA 2R10A 5BT5A 5B8DA 5II1A 5HQ5A 4YBTA 4Z6HA 2E7NA 4YAXA 5I89A 5F1LA 2G45A 4GNEA 4PCEA 5A85A 3LQIA 4O77A 5IGMA 3M99A 2LGKA 5F61A 3AQAA 5CU8A 5E9YA 5EP7A 4A9EA 4QR5A 4IORA 4IR5A 4S3OC 4YY4A 2NXBA 2F6JA 5DX4A 4NR7A 4NRCA 5E3DA 4LR6A 5FE7A 2HDPA 5TDWA 2L43A 4NUEA 3QZTA 4O7FA 3ZPVE 4QSXA 5ENIA 4CUQA 2CSYA 5H1VA 5HQ7A 4YABA 4R2YA 5G04B 5CUEA 2YREA 4UI9B 3N9LA 5CTLA 4YC9A 5EPBA 4TZ8A 4NR6A 4PPEA 4A9FA 2KFTA 3ZYQA 4A49A 4UYDA 3P5OA 3RPGB 4WA6A 4O76A 2VPGA 4WIVA 4TU6A 4O7EA 5EPSA 4BHWA 5FE0A 5FG5A 5DY7A 4ZDTA 3MQMA 4TU4A 2E6SA 4NYVA 4RVRA 2G43A 2EA6A 2XEUA 2F6NA 4PS5A 4F52B 3MHSA 4Q6FA 1JM7B 4XUAA 4BW1A 4TT2A 3KQIA 5F1HA 2YUCA 1ZBDB 4NYWA 4DONA 3DAIA 2YELA 4HBXA 1FBVA 2QIZA 4YYKA 5I40A 4N4GA 4YBMA 5FE1A 2R0YA 5IGLA 2PNXA 4LK9A 4PCIA 5EGUA 3UV2A 3O34A 4FK5A 5AIUA 3UVDA 2LSPB 5KTUA 3L1XA 3PURA 5FEYA 4CUSA 5E9IA 4A9OA 5IIDA 1XWHA 3MHHA 1WENA 2DATA 5C7NA 3D7CA 4MR6A 4MR3A 5I29A 4HBYA 4LJNA 4ALHA 4Z6IA 1JM7A 5BT4A 5D25A 3HMHA 2QICA 5DYAA 5FFYA 2KGGA 3N9NA 3MUKA 5KHMA 5DYUA 5L8UA 2LN0A 3HMFA 5TCMA 2KTBB 4YYIA 3IU6A 2YDWA 2L0BA 2LQ6A 4QF2A 4QEVA 2Y1NA 2MT5A 5I86A 5LJ0A 4QYLA 5EV9A 1WEEA 1VD4A 5J3XA 5A5PA 4B86C 5D26A 5ENBA 5KTWA 5HFQA 5LKXA 2MA6A 4FO9A 4OGIA 3U5NA 5FE6A 2L5EA 2YW5A 5LKUA 5F62A 4QNSA 4HBWA 4UYEA 3SOXA 4CUUA 1G25A 5CQ7A 5KTXA 1IYMA 4N4HA 5AD3A 3U5MA 2FSAA 3IU5A 4Q0NA 5F2PA 2YHOA 5L96A 4Z1SA 1WUGA 5F25A 5D3RA 2D82A 1WILA 4YK0A 4PY6A 4QC3A 5FB0A 5EYAF 5A5RA 5LJ1A 3TLPA 4TTEA 5CZGA 2R0VA 2AN6A 4X3GA 2ECJA 2YSMA 5DKHA 4A9HA 2YEKA 2KWJA 2L75A 4A4CA 2DWWA 4LYWA 3SVFA 5LKZA 1N87A 5CUCA 4YADA 5CQ6A 1BORA 2JRJA 2ECVA 4AYCB 4KV4A 2KE1A 1X0JA 5FDZA 3U5OA 5DYXA 3SVHA 2Y1MA 1VFYA 5DW2A 5C85A 4A9JA 3P1CA 5CGPA 4QSTA 3N9QA 5FG4A 3G0LA 4UIVA 5DKAA 4AP4A 4HBVA 4QEUA 2YT5A 5K29A 4CFLA 4ZC9A 2G6QA 5EICA 4LZ2A 2MIQA 4YYNA 5E7DA 4IOOA 4XUBA 5I7XA 5A81A 5DINA 4NQNA 4BBQA 4WZ3B 1U6GB 5DLZA 4AYCA 4QSRA 3HTKC 5ENHA 4MVTA 5IBNA 5A5NA 2CSZA 5TDRA 5D3LA 3ZPV1 4MR4A 3NXBA 3O33A 3QZVA 5I3LA 2FUUA 4I7BA 2PUYA 4QF3A 3O70A 4HXPA 5D1LB 4NS5A 5CY9A 5H1TA 2LV9A 4FJCA 3L11A 4A9KA 5FFWA 4IR4A 5HENA 5EVAA 4GNDA 4A9LA 3S92A 4NN2A 3UV4A 5B78A 4NUCA 5E9MA 5L98A 2CT2A 1MM2A 2M3HA 3FL2A 3KNVA 5COIA 3ZYUA 2H0DB 4QBMA 3FKMX 2YQMA 4O7BA 5FH7A 4R7EA 4UIUA 3UVXA 4WHUA 3N9PA 2RI7A 5D3SA 2Y43A 2VJEB 4J3IA 4MEPA 4TQNA 4Y03A 3SOUA 4HXKA 3O7AA 3M63A 3ONIA 3HCUA 4ALGA 4C66A 3UW9A 1WIMA 5CQ5A 4UITA 5HJCA 5C13A 4CURA 4BW3A 2ECIA 4YYMA 2XB1A 4L7XA 3AADA 4MSXA 5ENJA 4YATA 4NXJA 3V43A 4NRAA 2LXPC 4B7YC 4NR8A 5DFCA 4Z1QA 5AD2A 5CQ3A 4N4FA 5HRWA 2H0DA 5C11A 2M6MA 4LZSA 5CFWA 4V3LC 3U5LA 5LUUA 4YY6A 2VJEA 1WE9A 5E3GA 4XI1A 4LDFA 2ECTA 1X4IA 1WEMA 4AKNA 2RFJA 5CQTA 3MXFA 3O36A 4QSWA 5E74A 2OXQC 1V87A 4QSQA 3LJWA 1WEOA 4X2IA 3P1FA 2YQDA 4NRBA 5TB6A 5HCLA 3DQVR 4L58A 2L84A 5A5OA 3P1EA 4HXSA 1WEVA 2KWOA 4PTBA 5JI8A 5IGKA 4W4UA 2LGGA 4TT4A 5EQ1A
chains in the Genus database with same CATH superfamily
2VNFA 5B75A 5I80A 4Z93A 2K1JA 1JOCA 5D1MB 3RPGC 5IG6A 5FE2A 5KH7A 2EXUA 1N72A 4LRGA 4J1PA 5EU1A 2K16A 4LC2A 4GNGA 4A0CD 5D0CA 3K2JA 5HRXA 5FE8A 4NR9A 2CKLB 4UIZA 4QSPA 1MBMA 5ENCA 4NR5A 4LYIA 5EWDA 2NAAA 5SVYA 5B76A 4HXMA 4AVXA 5F5ZA 1WEUA 2D8UA 4QZSA 4O7AA 3JVKA 4TYLA 4UIYA 4TZ2A 5EA1A 4CUPA 5FH8A 4IR6A 2EGPA 4S3OB 5E9VA 4PKLA 5EWCA 2OO1A 5DW1A 4N4IA 3IHPA 5DFBA 2LGVA 3T7LA 2GRCA 5FB1A 1JM4B 5B79A 5FE3A 2C2VS 2DVSA 5CQ8A 5I83A 3I3JA 5JG6A 1HYJA 3MB4A 4AI6A 2KIZA 3UVYA 3C6WA 4UYHA 3G0JA 1F68A 3KV5A 5BT3A 4YH4A 2VPBA 1E4UA 5KU3A 5DKCA 4OUFA 5G4SA 3U5KA 3LJUX 5ENEA 2M85A 3Q1DA 4AKIA 5L99A 2VP7A 5IGNA 4MR5A 1E6IA 5G4RA 4UP0A 5AMFA 5A82A 1X4JA 5ACYA 5LVQA 4KV1A 1DVPA 2I50A 2RSDA 4FLPA 4N3WA 5EK9A 4P5OB 4NUDA 5B77A 5KH3A 2B0OE 2CONA 3C5KA 3UVWA 2ECNA 2MA5A 5CPEA 2WP2A 3MB3A 3LQJA 2QJ0A 4UYFB 5HRVA 4YBSA 5EISA 4MENA 2YSJA 4ZQLA 3PHDA 5A83A 4CUTA 4C9ZA 4GPJA 3GV4A 4BW2A 3GL6A 4HXOA 4MEQA 5EI4A 2E6RA 1Z6UA 3DPLR 4YYJA 4A9NA 3N9MA 1F62A 3Q2FA 3Q2EA 5HQ6A 2ZETC 4IOQA 5D3NA 5E9KA 5D3HA 1WEQA 5HELA 2K4DA 2YQLA 5E73A 2KWNA 1X4UA 5FH6A 4WZ0A 2RNXA 4O75A 4O78A 2DX8A 5EPRA 2R0SA 4LKAA 5AITA 4UYFA 4XY9A 5CRMA 1LDJB 5CUAA 3RCWA 5LCWB 4QB3A 4TS8A 5DBMA 2CRWA 5D7XA 3ZNIA 3U5JA 4QSUA 5CQAA 4QSVA 2DVRA 4CA1A 1WEWA 2MD7B 4J0RA 5CUGA 5EWWA 4IR3A 3ZVZB 3EB5A 2C2LA 4V3KC 3MULA 5ETBA 4NR4A 2DVQA 2YEMA 2YU4A 4ZW1A 5DKDA 5J0DA 4GB0A 2L5UA 4LADB 3FAOA 5FFVA 4A9IA 5CS8A 4CL9A 5I1QA 1FP0A 4O64A 1WESA 5E9LA 4OGEA 2I7KA 4MEOA 1Z60A 2MNZA 5A5SA 1T1HA 3SVGA 5LJ2A 5A7CA 3VKGA 4YYHA 1LDKC 2JMDA 2FFWA 2L80A 1VYXA 2ECWA 1HYIA 3ZTGA 5HM0A 3T6RA 4CFKA 5EWHA 2H60A 3HCTA 4XY8A 4HXLA 2MJVB 3JVLA 3ZVYA 5AMEA 2BAYA 4QUTA 2LRIC 2D9EA 1CHCA 2KGIA 2MNYA 5LKTA 5I7YA 5TBNA 4F3IA 2KREA 4E96A 4GNFA 4WZ2A 3JVJA 3ASLA 3HMEA 4QYDA 5EWVA 2DKWA 5C8GA 4LYSA 2D8SA 4I7CA 2YHNA 2YURA 5D3PA 2I8NA 4QUUA 2ECGA 4R8PK 3QZSA 5A5QA 2N9GA 5DYCA 4QQ4A 5FE4A 2UZGA 4UIXA 1K2FA 2OUOA 5HLSA 3SHBA 2YYRA 3O37A 5CP5A 5E0RA 3NG2A 1MM3A 5D24A 4ZUXU 5CQ4A 5FG6A 5C4QA 5EM3A 2MUMA 5F63A 5C87A 5LVRA 3DWYA 4CCGX 1JSPB 4O72A 5ENFA 2LDRA 4O70A 2KU3A 3N9OA 4BJXA 5D1KB 2MD8C 2VJFB 3P1DA 4HXNA 5CUDA 4YH3A 2EODA 3EB6A 3HCSA 5ENGA 5II2A 2VPDA 5L8TA 4LLBA 5F60A 4F1PA 2YW8A 4YYGA 4O74A 1EQFA 5H85A 5JWMA 3FM8C 5G05B 5K3QA 4UIWA 5KO4A 2XOCA 3DDTA 3RTRB 2DJAA 2E7OA 2LXHC 3U5PA 2K17A 2KR4A 4UP5A 2RR4A 2WP1A 4IC2A 5CUBA 3LQHA 5FE9A 5D3JA 4QSSA 5ETDA 4C67A 2JMJA 2DVVA 3L1ZB 3SOWA 2KKYA 2VPEA 3T9KA 1DCQA 4QY4A 5C89A 4QC1A 4FIPA 2RS9B 2VJFA 4QR3A 4TKPB 4I7DA 4CLBA 2HYED 2KYUA 4NYXA 2RNYA 4NQMA 4IC3A 5G0FA 2RO1A 2CKLA 5FBXA 5CRZA 5D3TA 3S91A 3KV6A 5KH9A 2G4AA 4AUQB 5F36A 4A9MA 5I88A 5TRBA 3LVRE 1Z2QA 4WHWA 1ZS5A 4QR4A 2OSSA 4BW4A 2FUIA 4HXRA 4TT6A 4UYGA 2EJNA 4KCXA 5HEMA 4YYDA 2JUNA 4Q0OA 3JVMA 5HFRA 2YYNA 3I2DA 3GG3A 3LRQA 1WGMA 5TABA 3O35A 4O71A 2M1RA 4QEWA 4OGJA 1WUMA 5DFDA 2RNWA 3UV5A 5L97A 1RMDA 2IDAA 4J0SA 5FE5A 3PUQA 3FJUB 2JMIA 5DLXA 5F3AA 2F42A 1WEPA 2L85A 3LXJA 5H1UA 3M62A 2KWKA 4A4BA 2E3KA 1WFKA 3PLWA 5H9MA 4O7CA 4LZRA 5FERA 4XYAA 2LGLA 2R10A 5BT5A 5B8DA 5II1A 5HQ5A 4YBTA 4Z6HA 2E7NA 4YAXA 5I89A 5F1LA 3JUEA 2G45A 4GNEA 4PCEA 5A85A 3LQIA 4O77A 5IGMA 3M99A 3MDBC 2LGKA 5F61A 3AQAA 5CU8A 5E9YA 5EP7A 4A9EA 3FEHA 4QR5A 4IORA 4H9DA 4IR5A 4S3OC 4YY4A 2NXBA 2F6JA 3O47A 5DX4A 4NR7A 4NRCA 5E3DA 4LR6A 5FE7A 2HDPA 5TDWA 3KDEC 2L43A 4NUEA 3QZTA 4O7FA 3ZPVE 2P57A 4QSXA 5ENIA 5SVXA 4CUQA 2CSYA 5H1VA 5HQ7A 4YABA 2MKEA 4R2YA 5CUEA 5G04B 2YREA 4UI9B 3N9LA 5CTLA 4YC9A 5EPBA 4TZ8A 4NR6A 4PPEA 4A9FA 2KFTA 3ZYQA 4OGCA 4A49A 4UYDA 3P5OA 3RPGB 4WA6A 4O76A 2VPGA 4WIVA 4TU6A 4O7EA 5EPSA 4BHWA 5FE0A 5FG5A 3LVQE 5DY7A 4ZDTA 3MQMA 2CSVA 4TU4A 2E6SA 4NYVA 4RVRA 2G43A 2EA6A 2XEUA 2F6NA 4PS5A 3H7HA 4F52B 3MHSA 4Q6FA 1JM7B 4XUAA 4BW1A 4TT2A 3KQIA 5F1HA 2YUCA 1ZBDB 4NYWA 4DONA 3DAIA 2YELA 4HBXA 1FBVA 2QIZA 4YYKA 5I40A 4N4GA 4YBMA 5FE1A 2R0YA 5IGLA 2PNXA 4LK9A 4PCIA 5EGUA 3UV2A 3O34A 4FK5A 5AIUA 3UVDA 2LSPB 5KTUA 3L1XA 3PURA 5FEYA 4CUSA 5E9IA 4A9OA 5IIDA 1ZKRA 1XWHA 3MHHA 1WENA 2DATA 5C7NA 3D7CA 4MR6A 4MR3A 5I29A 4HBYA 4LJNA 4ALHA 4Z6IA 3FANA 3DWDA 1JM7A 5BT4A 5D25A 3D1BA 2XOYA 3HMHA 2QICA 5DYAA 5FFYA 2KGGA 2XOZA 3N9NA 3MUKA 5KHMA 5DYUA 5L8UA 2LN0A 3HMFA 5TCMA 2KTBB 4YYIA 3IU6A 2YDWA 2L0BA 2LQ6A 4QF2A 4QEVA 2Y1NA 2MT5A 5I86A 5LJ0A 4QYLA 5EV9A 1WEEA 1VD4A 5J3XA 5A5PA 4B86C 5D26A 5ENBA 5KTWA 5HFQA 5LKXA 2MA6A 4FO9A 4OGIA 3U5NA 5FE6A 2L7PA 2L5EA 2YW5A 5LKUA 5F62A 4QNSA 4HBWA 4UYEA 3SOXA 4CUUA 1G25A 3VKHA 5CQ7A 5KTXA 1IYMA 1PUOA 4N4HA 2OWAA 5AD3A 3U5MA 2FSAA 3IU5A 4Q0NA 5F2PA 2YHOA 5L96A 4Z1SA 1WUGA 5F25A 5D3RA 5SVIB 2D82A 1WILA 4YK0A 4PY6A 4QC3A 5FB0A 5EYAF 5A5RA 5LJ1A 4Z0RA 3TLPA 4TTEA 5CZGA 2R0VA 2AN6A 4X3GA 2ECJA 2YSMA 5DKHA 4A9HA 2YEKA 2KWJA 2L75A 4A4CA 2DWWA 4LYWA 3SVFA 5LKZA 1N87A 5CUCA 4YADA 5CQ6A 1BORA 2JRJA 2ECVA 3LDYA 4AYCB 4KV4A 2KE1A 1X0JA 5FDZA 3U5OA 5DYXA 3SVHA 2Y1MA 1VFYA 5DW2A 5C85A 4A9JA 5SVIA 3E2DA 3P1CA 5CGPA 4QSTA 3N9QA 5FG4A 3G0LA 4UIVA 5DKAA 4AP4A 4HBVA 4QEUA 2YT5A 5K29A 4CFLA 4ZC9A 2G6QA 5EICA 4LZ2A 2MIQA 4AKGA 4YYNA 2E61A 5E7DA 4IOOA 4XUBA 2JM3A 5I7XA 3M7KA 5A81A 5DINA 4NQNA 3D1DA 4BBQA 4WZ3B 1U6GB 2IQJA 5DLZA 4AYCA 3VK6A 4QSRA 3HTKC 5ENHA 4MVTA 2M13A 5IBNA 2YVRA 5A5NA 2CSZA 5TDRA 5D3LA 3ZPV1 4MR4A 3NXBA 3O33A 3QZVA 5I3LA 2FUUA 4I7BA 2PUYA 4QF3A 2DSMA 3O70A 4HXPA 5D1LB 4NS5A 5CY9A 5H1TA 2LV9A 2EGMA 3L11A 4A9KA 4FJCA 5FFWA 4IR4A 5HENA 4Z0OA 5EVAA 4GNDA 4A9LA 3S92A 4NN2A 3UV4A 5B78A 4NUCA 5E9MA 3ERRA 5L98A 1MM2A 2CT2A 2M3HA 3FL2A 5COIA 3ZYUA 3KNVA 2H0DB 4QBMA 3FKMX 2YQMA 4O7BA 5FH7A 4R7EA 4UIUA 3UVXA 4WHUA 4O62A 3N9PA 2RI7A 5D3SA 2Y43A 2VJEB 4J3IA 4MEPA 4TQNA 4Y03A 3SOUA 4HXKA 3O7AA 3M63A 2CRRA 3ONIA 2LAUA 3HCUA 4ALGA 4C66A 3UW9A 1WIMA 5CQ5A 4UITA 5HJCA 5C13A 4CURA 4BW3A 2ECIA 4YYMA 2XB1A 4L7XA 3AADA 4MSXA 5ENJA 4YATA 4NXJA 3V43A 2KKXA 4NRAA 2LXPC 4B7YC 2XP0A 4NR8A 5DFCA 4Z1QA 5AD2A 5CQ3A 4N4FA 5HRWA 2H0DA 3SUBA 5C11A 2M6MA 4LZSA 5CFWA 2FD4A 4V3LC 4AKHA 3U5LA 5LUUA 4YY6A 2VJEA 1WE9A 5E3GA 4XI1A 4LDFA 2ECTA 1X4IA 1WEMA 4AKNA 2RFJA 5CQTA 3MXFA 3O36A 4QSWA 5E74A 2OXQC 1V87A 4QSQA 3LJWA 1WEOA 4X2IA 3P1FA 2YQDA 4NRBA 5TB6A 5HCLA 3DQVR 4L58A 2L84A 5A5OA 3P1EA 4HXSA 1WEVA 2KWOA 4PTBA 5JI8A 5IGKA 4W4UA 2LGGA 4TT4A 5EQ1A
chains in the Genus database with same CATH topology
2VNFA 5B75A 5I80A 4Z93A 2K1JA 1JOCA 5D1MB 3RPGC 5IG6A 5FE2A 5KH7A 1N72A 4LRGA 4J1PA 5EU1A 2K16A 4LC2A 4GNGA 4A0CD 5D0CA 3K2JA 5HRXA 5FE8A 4NR9A 2CKLB 4UIZA 4QSPA 5ENCA 4NR5A 4LYIA 5EWDA 2NAAA 5B76A 4HXMA 4AVXA 5F5ZA 1WEUA 4QZSA 4O7AA 3JVKA 4TYLA 4UIYA 4TZ2A 5EA1A 4CUPA 5FH8A 4IR6A 2EGPA 4S3OB 5E9VA 4PKLA 5EWCA 2OO1A 5DW1A 4N4IA 3IHPA 5DFBA 2LGVA 3T7LA 2GRCA 5FB1A 1JM4B 5B79A 5FE3A 2C2VS 2DVSA 5CQ8A 5I83A 3I3JA 5JG6A 1HYJA 3MB4A 2KIZA 3UVYA 3C6WA 4UYHA 3G0JA 1F68A 3KV5A 5BT3A 4YH4A 2VPBA 1E4UA 5KU3A 5DKCA 4OUFA 5G4SA 3U5KA 5ENEA 2M85A 5L99A 2VP7A 5IGNA 4MR5A 1E6IA 5G4RA 4UP0A 5AMFA 5A82A 1X4JA 5ACYA 5LVQA 4KV1A 1DVPA 2I50A 2RSDA 4FLPA 4N3WA 5EK9A 4P5OB 4NUDA 5B77A 5KH3A 3C5KA 3UVWA 2ECNA 2MA5A 5CPEA 2WP2A 3MB3A 3LQJA 2QJ0A 4UYFB 5HRVA 4YBSA 5EISA 4MENA 2YSJA 4ZQLA 3PHDA 5A83A 4CUTA 4C9ZA 4GPJA 3GV4A 4BW2A 3GL6A 4HXOA 4MEQA 5EI4A 2E6RA 1Z6UA 3DPLR 4YYJA 4A9NA 3N9MA 1F62A 3Q2FA 3Q2EA 5HQ6A 2ZETC 4IOQA 5D3NA 5E9KA 5D3HA 1WEQA 5HELA 2K4DA 2YQLA 5E73A 2KWNA 1X4UA 5FH6A 4WZ0A 2RNXA 4O75A 4O78A 2DX8A 5EPRA 2R0SA 4LKAA 5AITA 4UYFA 4XY9A 5CRMA 1LDJB 5CUAA 3RCWA 5LCWB 4QB3A 4TS8A 5DBMA 3VK6A 5D7XA 3ZNIA 3U5JA 4QSUA 5CQAA 4QSVA 2DVRA 4CA1A 1WEWA 2MD7B 4J0RA 5CUGA 5EWWA 4IR3A 3ZVZB 3EB5A 2C2LA 4V3KC 3MULA 5ETBA 4NR4A 2DVQA 2YEMA 2YU4A 4ZW1A 5DKDA 5J0DA 4GB0A 2L5UA 4LADB 5FFVA 4A9IA 5CS8A 4CL9A 5I1QA 1FP0A 4O64A 1WESA 5E9LA 2I7KA 4MEOA 1Z60A 2MNZA 5A5SA 1T1HA 3SVGA 5LJ2A 5A7CA 4YYHA 1LDKC 2JMDA 2L80A 1VYXA 2ECWA 1HYIA 3ZTGA 5HM0A 3T6RA 4CFKA 5EWHA 2H60A 3HCTA 4XY8A 4HXLA 2MJVB 3JVLA 3ZVYA 5AMEA 2BAYA 4QUTA 2LRIC 2D9EA 1CHCA 2KGIA 2MNYA 5LKTA 5I7YA 5TBNA 4F3IA 2KREA 4E96A 4GNFA 4WZ2A 3JVJA 3ASLA 3HMEA 4QYDA 5EWVA 2DKWA 5C8GA 4LYSA 2D8SA 4I7CA 2YHNA 2YURA 5D3PA 2I8NA 4QUUA 2ECGA 4R8PK 3QZSA 5A5QA 2N9GA 5DYCA 5FE4A 2UZGA 4UIXA 1K2FA 2OUOA 5HLSA 3SHBA 2YYRA 3O37A 5CP5A 5E0RA 3NG2A 1MM3A 5D24A 4ZUXU 5CQ4A 5FG6A 5C4QA 5EM3A 2MUMA 5F63A 5C87A 5LVRA 3DWYA 4CCGX 1JSPB 4O72A 5ENFA 2LDRA 4O70A 2KU3A 3N9OA 4BJXA 5D1KB 2MD8C 2VJFB 3P1DA 4HXNA 5CUDA 4YH3A 2EODA 3EB6A 3HCSA 5ENGA 5II2A 2VPDA 5L8TA 4LLBA 5F60A 2YW8A 4YYGA 4O74A 1EQFA 5H85A 5JWMA 5G05B 4UIWA 5KO4A 3RTRB 2E7OA 2LXHC 3U5PA 2K17A 2KR4A 4UP5A 4IC2A 2WP1A 5CUBA 3LQHA 5FE9A 5D3JA 4QSSA 5ETDA 4C67A 2JMJA 2DVVA 3L1ZB 3SOWA 2VPEA 4QY4A 5C89A 4QC1A 4FIPA 2RS9B 2VJFA 4QR3A 4TKPB 4I7DA 4CLBA 2HYED 2KYUA 4NYXA 2RNYA 4NQMA 4IC3A 5G0FA 2RO1A 2CKLA 5FBXA 5CRZA 5D3TA 3S91A 3KV6A 5KH9A 2G4AA 4AUQB 5F36A 4A9MA 5I88A 5TRBA 1Z2QA 4WHWA 1ZS5A 4QR4A 2OSSA 4BW4A 2FUIA 4HXRA 4TT6A 4UYGA 4KCXA 5HEMA 4YYDA 4Q0OA 3JVMA 5HFRA 2YYNA 3I2DA 3GG3A 3LRQA 1WGMA 5TABA 3O35A 4O71A 2M1RA 4QEWA 4OGJA 1WUMA 5DFDA 2RNWA 3UV5A 5L97A 1RMDA 2IDAA 4J0SA 5FE5A 3PUQA 2JMIA 5DLXA 5F3AA 2F42A 1WEPA 2L85A 3LXJA 5H1UA 3M62A 2KWKA 4A4BA 2E3KA 1WFKA 5H9MA 4O7CA 4LZRA 5FERA 4XYAA 2LGLA 2R10A 5BT5A 5B8DA 5II1A 5HQ5A 4YBTA 4Z6HA 2E7NA 4YAXA 5I89A 5F1LA 2G45A 4GNEA 4PCEA 5A85A 3LQIA 4O77A 5IGMA 3M99A 2LGKA 5F61A 3AQAA 5CU8A 5E9YA 5EP7A 4A9EA 4QR5A 4IORA 4IR5A 4S3OC 4YY4A 2NXBA 2F6JA 5DX4A 4NR7A 4NRCA 5E3DA 4LR6A 5FE7A 2HDPA 5TDWA 2L43A 4NUEA 3QZTA 4O7FA 3ZPVE 4QSXA 5ENIA 4CUQA 2CSYA 5H1VA 5HQ7A 4YABA 4R2YA 5G04B 5CUEA 2YREA 4UI9B 3N9LA 5CTLA 4YC9A 5EPBA 4TZ8A 4NR6A 4PPEA 4A9FA 2KFTA 3ZYQA 4A49A 4UYDA 3P5OA 3RPGB 4WA6A 4O76A 2VPGA 4WIVA 4TU6A 4O7EA 5EPSA 4BHWA 5FE0A 5FG5A 5DY7A 4ZDTA 3MQMA 4TU4A 2E6SA 4NYVA 4RVRA 2G43A 2EA6A 2XEUA 2F6NA 4PS5A 4F52B 3MHSA 4Q6FA 1JM7B 4XUAA 4BW1A 4TT2A 3KQIA 5F1HA 2YUCA 1ZBDB 4NYWA 4DONA 3DAIA 2YELA 4HBXA 1FBVA 2QIZA 4YYKA 5I40A 4N4GA 4YBMA 5FE1A 2R0YA 5IGLA 2PNXA 4LK9A 4PCIA 5EGUA 3UV2A 3O34A 4FK5A 5AIUA 3UVDA 2LSPB 5KTUA 3L1XA 3PURA 5FEYA 4CUSA 5E9IA 4A9OA 5IIDA 1XWHA 3MHHA 1WENA 2DATA 5C7NA 3D7CA 4MR6A 4MR3A 5I29A 4HBYA 4LJNA 4ALHA 4Z6IA 1JM7A 5BT4A 5D25A 3HMHA 2QICA 5DYAA 5FFYA 2KGGA 3N9NA 3MUKA 5KHMA 5DYUA 5L8UA 2LN0A 3HMFA 5TCMA 2KTBB 4YYIA 3IU6A 2YDWA 2L0BA 2LQ6A 4QF2A 4QEVA 2Y1NA 2MT5A 5I86A 5LJ0A 4QYLA 5EV9A 1WEEA 1VD4A 5J3XA 5A5PA 4B86C 5D26A 5ENBA 5KTWA 5HFQA 5LKXA 2MA6A 4FO9A 4OGIA 3U5NA 5FE6A 2L5EA 2YW5A 5LKUA 5F62A 4QNSA 4HBWA 4UYEA 3SOXA 4CUUA 1G25A 5CQ7A 5KTXA 1IYMA 4N4HA 5AD3A 3U5MA 2FSAA 3IU5A 4Q0NA 5F2PA 2YHOA 5L96A 4Z1SA 1WUGA 5F25A 5D3RA 2D82A 1WILA 4YK0A 4PY6A 4QC3A 5FB0A 5EYAF 5A5RA 5LJ1A 3TLPA 4TTEA 5CZGA 2R0VA 2AN6A 4X3GA 2ECJA 2YSMA 5DKHA 4A9HA 2YEKA 2KWJA 2L75A 4A4CA 2DWWA 4LYWA 3SVFA 5LKZA 1N87A 5CUCA 4YADA 5CQ6A 1BORA 2JRJA 2ECVA 4AYCB 4KV4A 2KE1A 1X0JA 5FDZA 3U5OA 5DYXA 3SVHA 2Y1MA 1VFYA 5DW2A 5C85A 4A9JA 3P1CA 5CGPA 4QSTA 3N9QA 5FG4A 3G0LA 4UIVA 5DKAA 4AP4A 4HBVA 4QEUA 2YT5A 5K29A 4CFLA 4ZC9A 2G6QA 5EICA 4LZ2A 2MIQA 4YYNA 5E7DA 4IOOA 4XUBA 5I7XA 5A81A 5DINA 4NQNA 4BBQA 4WZ3B 1U6GB 5DLZA 4AYCA 4QSRA 3HTKC 5ENHA 4MVTA 5IBNA 5A5NA 2CSZA 5TDRA 5D3LA 3ZPV1 4MR4A 3NXBA 3O33A 3QZVA 5I3LA 2FUUA 4I7BA 2PUYA 4QF3A 3O70A 4HXPA 5D1LB 4NS5A 5CY9A 5H1TA 2LV9A 4FJCA 3L11A 4A9KA 5FFWA 4IR4A 5HENA 5EVAA 4GNDA 4A9LA 3S92A 4NN2A 3UV4A 5B78A 4NUCA 5E9MA 5L98A 2CT2A 1MM2A 2M3HA 3FL2A 3KNVA 5COIA 3ZYUA 2H0DB 4QBMA 3FKMX 2YQMA 4O7BA 5FH7A 4R7EA 4UIUA 3UVXA 4WHUA 3N9PA 2RI7A 5D3SA 2Y43A 2VJEB 4J3IA 4MEPA 4TQNA 4Y03A 3SOUA 4HXKA 3O7AA 3M63A 3ONIA 3HCUA 4ALGA 4C66A 3UW9A 1WIMA 5CQ5A 4UITA 5HJCA 5C13A 4CURA 4BW3A 2ECIA 4YYMA 2XB1A 4L7XA 3AADA 4MSXA 5ENJA 4YATA 4NXJA 3V43A 4NRAA 2LXPC 4B7YC 4NR8A 5DFCA 4Z1QA 5AD2A 5CQ3A 4N4FA 5HRWA 2H0DA 5C11A 2M6MA 4LZSA 5CFWA 4V3LC 3U5LA 5LUUA 4YY6A 2VJEA 1WE9A 5E3GA 4XI1A 4LDFA 2ECTA 1X4IA 1WEMA 4AKNA 2RFJA 5CQTA 3MXFA 3O36A 4QSWA 5E74A 2OXQC 1V87A 4QSQA 3LJWA 1WEOA 4X2IA 3P1FA 2YQDA 4NRBA 5TB6A 5HCLA 3DQVR 4L58A 2L84A 5A5OA 3P1EA 4HXSA 1WEVA 2KWOA 4PTBA 5JI8A 5IGKA 4W4UA 2LGGA 4TT4A 5EQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VNF A;  5B75 A;  5I80 A;  4Z93 A;  2K1J A;  1JOC A;  5D1M B;  3RPG C;  5IG6 A;  5FE2 A;  5KH7 A;  1N72 A;  4LRG A;  4J1P A;  5EU1 A;  2K16 A;  4LC2 A;  4GNG A;  4A0C D;  5D0C A;  3K2J A;  5HRX A;  5FE8 A;  4NR9 A;  2CKL B;  4UIZ A;  4QSP A;  5ENC A;  4NR5 A;  4LYI A;  5EWD A;  2NAA A;  5B76 A;  4HXM A;  4AVX A;  5F5Z A;  1WEU A;  4QZS A;  4O7A A;  3JVK A;  4TYL A;  4UIY A;  4TZ2 A;  5EA1 A;  4CUP A;  5FH8 A;  4IR6 A;  2EGP A;  4S3O B;  5E9V A;  4PKL A;  5EWC A;  2OO1 A;  5DW1 A;  4N4I A;  3IHP A;  5DFB A;  2LGV A;  3T7L A;  2GRC A;  5FB1 A;  1JM4 B;  5B79 A;  5FE3 A;  2C2V S;  2DVS A;  5CQ8 A;  5I83 A;  3I3J A;  5JG6 A;  1HYJ A;  3MB4 A;  2KIZ A;  3UVY A;  3C6W A;  4UYH A;  3G0J A;  1F68 A;  3KV5 A;  5BT3 A;  4YH4 A;  2VPB A;  1E4U A;  5KU3 A;  5DKC A;  4OUF A;  5G4S A;  3U5K A;  5ENE A;  2M85 A;  5L99 A;  2VP7 A;  5IGN A;  4MR5 A;  1E6I A;  5G4R A;  4UP0 A;  5AMF A;  5A82 A;  1X4J A;  5ACY A;  5LVQ A;  4KV1 A;  1DVP A;  2I50 A;  2RSD A;  4FLP A;  4N3W A;  5EK9 A;  4P5O B;  4NUD A;  5B77 A;  5KH3 A;  3C5K A;  3UVW A;  2ECN A;  2MA5 A;  5CPE A;  2WP2 A;  3MB3 A;  3LQJ A;  2QJ0 A;  4UYF B;  5HRV A;  4YBS A;  5EIS A;  4MEN A;  2YSJ A;  4ZQL A;  3PHD A;  5A83 A;  4CUT A;  4C9Z A;  4GPJ A;  3GV4 A;  4BW2 A;  3GL6 A;  4HXO A;  4MEQ A;  5EI4 A;  2E6R A;  1Z6U A;  3DPL R;  4YYJ A;  4A9N A;  3N9M A;  1F62 A;  3Q2F A;  3Q2E A;  5HQ6 A;  2ZET C;  4IOQ A;  5D3N A;  5E9K A;  5D3H A;  1WEQ A;  5HEL A;  2K4D A;  2YQL A;  5E73 A;  2KWN A;  1X4U A;  5FH6 A;  4WZ0 A;  2RNX A;  4O75 A;  4O78 A;  2DX8 A;  5EPR A;  2R0S A;  4LKA A;  5AIT A;  4UYF A;  4XY9 A;  5CRM A;  1LDJ B;  5CUA A;  3RCW A;  5LCW B;  4QB3 A;  4TS8 A;  5DBM A;  3VK6 A;  5D7X A;  3ZNI A;  3U5J A;  4QSU A;  5CQA A;  4QSV A;  2DVR A;  4CA1 A;  1WEW A;  2MD7 B;  4J0R A;  5CUG A;  5EWW A;  4IR3 A;  3ZVZ B;  3EB5 A;  2C2L A;  4V3K C;  3MUL A;  5ETB A;  4NR4 A;  2DVQ A;  2YEM A;  2YU4 A;  4ZW1 A;  5DKD A;  5J0D A;  4GB0 A;  2L5U A;  4LAD B;  5FFV A;  4A9I A;  5CS8 A;  4CL9 A;  5I1Q A;  1FP0 A;  4O64 A;  1WES A;  5E9L A;  2I7K A;  4MEO A;  1Z60 A;  2MNZ A;  5A5S A;  1T1H A;  3SVG A;  5LJ2 A;  5A7C A;  4YYH A;  1LDK C;  2JMD A;  2L80 A;  1VYX A;  2ECW A;  1HYI A;  3ZTG A;  5HM0 A;  3T6R A;  4CFK A;  5EWH A;  2H60 A;  3HCT A;  4XY8 A;  4HXL A;  2MJV B;  3JVL A;  3ZVY A;  5AME A;  2BAY A;  4QUT A;  2LRI C;  2D9E A;  1CHC A;  2KGI A;  2MNY A;  5LKT A;  5I7Y A;  5TBN A;  4F3I A;  2KRE A;  4E96 A;  4GNF A;  4WZ2 A;  3JVJ A;  3ASL A;  3HME A;  4QYD A;  5EWV A;  2DKW A;  5C8G A;  4LYS A;  2D8S A;  4I7C A;  2YHN A;  2YUR A;  5D3P A;  2I8N A;  4QUU A;  2ECG A;  4R8P K;  3QZS A;  5A5Q A;  2N9G A;  5DYC A;  5FE4 A;  2UZG A;  4UIX A;  1K2F A;  2OUO A;  5HLS A;  3SHB A;  2YYR A;  3O37 A;  5CP5 A;  5E0R A;  3NG2 A;  1MM3 A;  5D24 A;  4ZUX U;  5CQ4 A;  5FG6 A;  5C4Q A;  5EM3 A;  2MUM A;  5F63 A;  5C87 A;  5LVR A;  3DWY A;  4CCG X;  1JSP B;  4O72 A;  5ENF A;  2LDR A;  4O70 A;  2KU3 A;  3N9O A;  4BJX A;  5D1K B;  2MD8 C;  2VJF B;  3P1D A;  4HXN A;  5CUD A;  4YH3 A;  2EOD A;  3EB6 A;  3HCS A;  5ENG A;  5II2 A;  2VPD A;  5L8T A;  4LLB A;  5F60 A;  2YW8 A;  4YYG A;  4O74 A;  1EQF A;  5H85 A;  5JWM A;  5G05 B;  4UIW A;  5KO4 A;  3RTR B;  2E7O A;  2LXH C;  3U5P A;  2K17 A;  2KR4 A;  4UP5 A;  4IC2 A;  2WP1 A;  5CUB A;  3LQH A;  5FE9 A;  5D3J A;  4QSS A;  5ETD A;  4C67 A;  2JMJ A;  2DVV A;  3L1Z B;  3SOW A;  2VPE A;  4QY4 A;  5C89 A;  4QC1 A;  4FIP A;  2RS9 B;  2VJF A;  4QR3 A;  4TKP B;  4I7D A;  4CLB A;  2HYE D;  2KYU A;  4NYX A;  2RNY A;  4NQM A;  4IC3 A;  5G0F A;  2RO1 A;  2CKL A;  5FBX A;  5CRZ A;  5D3T A;  3S91 A;  3KV6 A;  5KH9 A;  2G4A A;  4AUQ B;  5F36 A;  4A9M A;  5I88 A;  5TRB A;  1Z2Q A;  4WHW A;  1ZS5 A;  4QR4 A;  2OSS A;  4BW4 A;  2FUI A;  4HXR A;  4TT6 A;  4UYG A;  4KCX A;  5HEM A;  4YYD A;  4Q0O A;  3JVM A;  5HFR A;  2YYN A;  3I2D A;  3GG3 A;  3LRQ A;  1WGM A;  5TAB A;  3O35 A;  4O71 A;  2M1R A;  4QEW A;  4OGJ A;  1WUM A;  5DFD A;  2RNW A;  3UV5 A;  5L97 A;  1RMD A;  2IDA A;  4J0S A;  5FE5 A;  3PUQ A;  2JMI A;  5DLX A;  5F3A A;  2F42 A;  1WEP A;  2L85 A;  3LXJ A;  5H1U A;  3M62 A;  2KWK A;  4A4B A;  2E3K A;  1WFK A;  5H9M A;  4O7C A;  4LZR A;  5FER A;  4XYA A;  2LGL A;  2R10 A;  5BT5 A;  5B8D A;  5II1 A;  5HQ5 A;  4YBT A;  4Z6H A;  2E7N A;  4YAX A;  5I89 A;  5F1L A;  2G45 A;  4GNE A;  4PCE A;  5A85 A;  3LQI A;  4O77 A;  5IGM A;  3M99 A;  2LGK A;  5F61 A;  3AQA A;  5CU8 A;  5E9Y A;  5EP7 A;  4A9E A;  4QR5 A;  4IOR A;  4IR5 A;  4S3O C;  4YY4 A;  2NXB A;  2F6J A;  5DX4 A;  4NR7 A;  4NRC A;  5E3D A;  4LR6 A;  5FE7 A;  2HDP A;  5TDW A;  2L43 A;  4NUE A;  3QZT A;  4O7F A;  3ZPV E;  4QSX A;  5ENI A;  4CUQ A;  2CSY A;  5H1V A;  5HQ7 A;  4YAB A;  4R2Y A;  5G04 B;  5CUE A;  2YRE A;  4UI9 B;  3N9L A;  5CTL A;  4YC9 A;  5EPB A;  4TZ8 A;  4NR6 A;  4PPE A;  4A9F A;  2KFT A;  3ZYQ A;  4A49 A;  4UYD A;  3P5O A;  3RPG B;  4WA6 A;  4O76 A;  2VPG A;  4WIV A;  4TU6 A;  4O7E A;  5EPS A;  4BHW A;  5FE0 A;  5FG5 A;  5DY7 A;  4ZDT A;  3MQM A;  4TU4 A;  2E6S A;  4NYV A;  4RVR A;  2G43 A;  2EA6 A;  2XEU A;  2F6N A;  4PS5 A;  4F52 B;  3MHS A;  4Q6F A;  1JM7 B;  4XUA A;  4BW1 A;  4TT2 A;  3KQI A;  5F1H A;  2YUC A;  1ZBD B;  4NYW A;  4DON A;  3DAI A;  2YEL A;  4HBX A;  1FBV A;  2QIZ A;  4YYK A;  5I40 A;  4N4G A;  4YBM A;  5FE1 A;  2R0Y A;  5IGL A;  2PNX A;  4LK9 A;  4PCI A;  5EGU A;  3UV2 A;  3O34 A;  4FK5 A;  5AIU A;  3UVD A;  2LSP B;  5KTU A;  3L1X A;  3PUR A;  5FEY A;  4CUS A;  5E9I A;  4A9O A;  5IID A;  1XWH A;  3MHH A;  1WEN A;  2DAT A;  5C7N A;  3D7C A;  4MR6 A;  4MR3 A;  5I29 A;  4HBY A;  4LJN A;  4ALH A;  4Z6I A;  1JM7 A;  5BT4 A;  5D25 A;  3HMH A;  2QIC A;  5DYA A;  5FFY A;  2KGG A;  3N9N A;  3MUK A;  5KHM A;  5DYU A;  5L8U A;  2LN0 A;  3HMF A;  5TCM A;  2KTB B;  4YYI A;  3IU6 A;  2YDW A;  2L0B A;  2LQ6 A;  4QF2 A;  4QEV A;  2Y1N A;  2MT5 A;  5I86 A;  5LJ0 A;  4QYL A;  5EV9 A;  1WEE A;  1VD4 A;  5J3X A;  5A5P A;  4B86 C;  5D26 A;  5ENB A;  5KTW A;  5HFQ A;  5LKX A;  2MA6 A;  4FO9 A;  4OGI A;  3U5N A;  5FE6 A;  2L5E A;  2YW5 A;  5LKU A;  5F62 A;  4QNS A;  4HBW A;  4UYE A;  3SOX A;  4CUU A;  1G25 A;  5CQ7 A;  5KTX A;  1IYM A;  4N4H A;  5AD3 A;  3U5M A;  2FSA A;  3IU5 A;  4Q0N A;  5F2P A;  2YHO A;  5L96 A;  4Z1S A;  1WUG A;  5F25 A;  5D3R A;  2D82 A;  1WIL A;  4YK0 A;  4PY6 A;  4QC3 A;  5FB0 A;  5EYA F;  5A5R A;  5LJ1 A;  3TLP A;  4TTE A;  5CZG A;  2R0V A;  2AN6 A;  4X3G A;  2ECJ A;  2YSM A;  5DKH A;  4A9H A;  2YEK A;  2KWJ A;  2L75 A;  4A4C A;  2DWW A;  4LYW A;  3SVF A;  5LKZ A;  1N87 A;  5CUC A;  4YAD A;  5CQ6 A;  1BOR A;  2JRJ A;  2ECV A;  4AYC B;  4KV4 A;  2KE1 A;  1X0J A;  5FDZ A;  3U5O A;  5DYX A;  3SVH A;  2Y1M A;  1VFY A;  5DW2 A;  5C85 A;  4A9J A;  3P1C A;  5CGP A;  4QST A;  3N9Q A;  5FG4 A;  3G0L A;  4UIV A;  5DKA A;  4AP4 A;  4HBV A;  4QEU A;  2YT5 A;  5K29 A;  4CFL A;  4ZC9 A;  2G6Q A;  5EIC A;  4LZ2 A;  2MIQ A;  4YYN A;  5E7D A;  4IOO A;  4XUB A;  5I7X A;  5A81 A;  5DIN A;  4NQN A;  4BBQ A;  4WZ3 B;  1U6G B;  5DLZ A;  4AYC A;  4QSR A;  3HTK C;  5ENH A;  4MVT A;  5IBN A;  5A5N A;  2CSZ A;  5TDR A;  5D3L A;  3ZPV 1;  4MR4 A;  3NXB A;  3O33 A;  3QZV A;  5I3L A;  2FUU A;  4I7B A;  2PUY A;  4QF3 A;  3O70 A;  4HXP A;  5D1L B;  4NS5 A;  5CY9 A;  5H1T A;  2LV9 A;  4FJC A;  3L11 A;  4A9K A;  5FFW A;  4IR4 A;  5HEN A;  5EVA A;  4GND A;  4A9L A;  3S92 A;  4NN2 A;  3UV4 A;  5B78 A;  4NUC A;  5E9M A;  5L98 A;  2CT2 A;  1MM2 A;  2M3H A;  3FL2 A;  3KNV A;  5COI A;  3ZYU A;  2H0D B;  4QBM A;  3FKM X;  2YQM A;  4O7B A;  5FH7 A;  4R7E A;  4UIU A;  3UVX A;  4WHU A;  3N9P A;  2RI7 A;  5D3S A;  2Y43 A;  2VJE B;  4J3I A;  4MEP A;  4TQN A;  4Y03 A;  3SOU A;  4HXK A;  3O7A A;  3M63 A;  3ONI A;  3HCU A;  4ALG A;  4C66 A;  3UW9 A;  1WIM A;  5CQ5 A;  4UIT A;  5HJC A;  5C13 A;  4CUR A;  4BW3 A;  2ECI A;  4YYM A;  2XB1 A;  4L7X A;  3AAD A;  4MSX A;  5ENJ A;  4YAT A;  4NXJ A;  3V43 A;  4NRA A;  2LXP C;  4B7Y C;  4NR8 A;  5DFC A;  4Z1Q A;  5AD2 A;  5CQ3 A;  4N4F A;  5HRW A;  2H0D A;  5C11 A;  2M6M A;  4LZS A;  5CFW A;  4V3L C;  3U5L A;  5LUU A;  4YY6 A;  2VJE A;  1WE9 A;  5E3G A;  4XI1 A;  4LDF A;  2ECT A;  1X4I A;  1WEM A;  4AKN A;  2RFJ A;  5CQT A;  3MXF A;  3O36 A;  4QSW A;  5E74 A;  2OXQ C;  1V87 A;  4QSQ A;  3LJW A;  1WEO A;  4X2I A;  3P1F A;  2YQD A;  4NRB A;  5TB6 A;  5HCL A;  3DQV R;  4L58 A;  2L84 A;  5A5O A;  3P1E A;  4HXS A;  1WEV A;  2KWO A;  4PTB A;  5JI8 A;  5IGK A;  4W4U A;  2LGG A;  4TT4 A;  5EQ1 A; 
#chains in the Genus database with same CATH topology
 2VNF A;  5B75 A;  5I80 A;  4Z93 A;  2K1J A;  1JOC A;  5D1M B;  3RPG C;  5IG6 A;  5FE2 A;  5KH7 A;  2EXU A;  1N72 A;  4LRG A;  4J1P A;  5EU1 A;  2K16 A;  4LC2 A;  4GNG A;  4A0C D;  5D0C A;  3K2J A;  5HRX A;  5FE8 A;  4NR9 A;  2CKL B;  4UIZ A;  4QSP A;  1MBM A;  5ENC A;  4NR5 A;  4LYI A;  5EWD A;  2NAA A;  5SVY A;  5B76 A;  4HXM A;  4AVX A;  5F5Z A;  1WEU A;  2D8U A;  4QZS A;  4O7A A;  3JVK A;  4TYL A;  4UIY A;  4TZ2 A;  5EA1 A;  4CUP A;  5FH8 A;  4IR6 A;  2EGP A;  4S3O B;  5E9V A;  4PKL A;  5EWC A;  2OO1 A;  5DW1 A;  4N4I A;  3IHP A;  5DFB A;  2LGV A;  3T7L A;  2GRC A;  5FB1 A;  1JM4 B;  5B79 A;  5FE3 A;  2C2V S;  2DVS A;  5CQ8 A;  5I83 A;  3I3J A;  5JG6 A;  1HYJ A;  3MB4 A;  4AI6 A;  2KIZ A;  3UVY A;  3C6W A;  4UYH A;  3G0J A;  1F68 A;  3KV5 A;  5BT3 A;  4YH4 A;  2VPB A;  1E4U A;  5KU3 A;  5DKC A;  4OUF A;  5G4S A;  3U5K A;  3LJU X;  5ENE A;  2M85 A;  3Q1D A;  4AKI A;  5L99 A;  2VP7 A;  5IGN A;  4MR5 A;  1E6I A;  5G4R A;  4UP0 A;  5AMF A;  5A82 A;  1X4J A;  5ACY A;  5LVQ A;  4KV1 A;  1DVP A;  2I50 A;  2RSD A;  4FLP A;  4N3W A;  5EK9 A;  4P5O B;  4NUD A;  5B77 A;  5KH3 A;  2B0O E;  2CON A;  3C5K A;  3UVW A;  2ECN A;  2MA5 A;  5CPE A;  2WP2 A;  3MB3 A;  3LQJ A;  2QJ0 A;  4UYF B;  5HRV A;  4YBS A;  5EIS A;  4MEN A;  2YSJ A;  4ZQL A;  3PHD A;  5A83 A;  4CUT A;  4C9Z A;  4GPJ A;  3GV4 A;  4BW2 A;  3GL6 A;  4HXO A;  4MEQ A;  5EI4 A;  2E6R A;  1Z6U A;  3DPL R;  4YYJ A;  4A9N A;  3N9M A;  1F62 A;  3Q2F A;  3Q2E A;  5HQ6 A;  2ZET C;  4IOQ A;  5D3N A;  5E9K A;  5D3H A;  1WEQ A;  5HEL A;  2K4D A;  2YQL A;  5E73 A;  2KWN A;  1X4U A;  5FH6 A;  4WZ0 A;  2RNX A;  4O75 A;  4O78 A;  2DX8 A;  5EPR A;  2R0S A;  4LKA A;  5AIT A;  4UYF A;  4XY9 A;  5CRM A;  1LDJ B;  5CUA A;  3RCW A;  5LCW B;  4QB3 A;  4TS8 A;  5DBM A;  2CRW A;  5D7X A;  3ZNI A;  3U5J A;  4QSU A;  5CQA A;  4QSV A;  2DVR A;  4CA1 A;  1WEW A;  2MD7 B;  4J0R A;  5CUG A;  5EWW A;  4IR3 A;  3ZVZ B;  3EB5 A;  2C2L A;  4V3K C;  3MUL A;  5ETB A;  4NR4 A;  2DVQ A;  2YEM A;  2YU4 A;  4ZW1 A;  5DKD A;  5J0D A;  4GB0 A;  2L5U A;  4LAD B;  3FAO A;  5FFV A;  4A9I A;  5CS8 A;  4CL9 A;  5I1Q A;  1FP0 A;  4O64 A;  1WES A;  5E9L A;  4OGE A;  2I7K A;  4MEO A;  1Z60 A;  2MNZ A;  5A5S A;  1T1H A;  3SVG A;  5LJ2 A;  5A7C A;  3VKG A;  4YYH A;  1LDK C;  2JMD A;  2FFW A;  2L80 A;  1VYX A;  2ECW A;  1HYI A;  3ZTG A;  5HM0 A;  3T6R A;  4CFK A;  5EWH A;  2H60 A;  3HCT A;  4XY8 A;  4HXL A;  2MJV B;  3JVL A;  3ZVY A;  5AME A;  2BAY A;  4QUT A;  2LRI C;  2D9E A;  1CHC A;  2KGI A;  2MNY A;  5LKT A;  5I7Y A;  5TBN A;  4F3I A;  2KRE A;  4E96 A;  4GNF A;  4WZ2 A;  3JVJ A;  3ASL A;  3HME A;  4QYD A;  5EWV A;  2DKW A;  5C8G A;  4LYS A;  2D8S A;  4I7C A;  2YHN A;  2YUR A;  5D3P A;  2I8N A;  4QUU A;  2ECG A;  4R8P K;  3QZS A;  5A5Q A;  2N9G A;  5DYC A;  4QQ4 A;  5FE4 A;  2UZG A;  4UIX A;  1K2F A;  2OUO A;  5HLS A;  3SHB A;  2YYR A;  3O37 A;  5CP5 A;  5E0R A;  3NG2 A;  1MM3 A;  5D24 A;  4ZUX U;  5CQ4 A;  5FG6 A;  5C4Q A;  5EM3 A;  2MUM A;  5F63 A;  5C87 A;  5LVR A;  3DWY A;  4CCG X;  1JSP B;  4O72 A;  5ENF A;  2LDR A;  4O70 A;  2KU3 A;  3N9O A;  4BJX A;  5D1K B;  2MD8 C;  2VJF B;  3P1D A;  4HXN A;  5CUD A;  4YH3 A;  2EOD A;  3EB6 A;  3HCS A;  5ENG A;  5II2 A;  2VPD A;  5L8T A;  4LLB A;  5F60 A;  4F1P A;  2YW8 A;  4YYG A;  4O74 A;  1EQF A;  5H85 A;  5JWM A;  3FM8 C;  5G05 B;  5K3Q A;  4UIW A;  5KO4 A;  2XOC A;  3DDT A;  3RTR B;  2DJA A;  2E7O A;  2LXH C;  3U5P A;  2K17 A;  2KR4 A;  4UP5 A;  2RR4 A;  2WP1 A;  4IC2 A;  5CUB A;  3LQH A;  5FE9 A;  5D3J A;  4QSS A;  5ETD A;  4C67 A;  2JMJ A;  2DVV A;  3L1Z B;  3SOW A;  2KKY A;  2VPE A;  3T9K A;  1DCQ A;  4QY4 A;  5C89 A;  4QC1 A;  4FIP A;  2RS9 B;  2VJF A;  4QR3 A;  4TKP B;  4I7D A;  4CLB A;  2HYE D;  2KYU A;  4NYX A;  2RNY A;  4NQM A;  4IC3 A;  5G0F A;  2RO1 A;  2CKL A;  5FBX A;  5CRZ A;  5D3T A;  3S91 A;  3KV6 A;  5KH9 A;  2G4A A;  4AUQ B;  5F36 A;  4A9M A;  5I88 A;  5TRB A;  3LVR E;  1Z2Q A;  4WHW A;  1ZS5 A;  4QR4 A;  2OSS A;  4BW4 A;  2FUI A;  4HXR A;  4TT6 A;  4UYG A;  2EJN A;  4KCX A;  5HEM A;  4YYD A;  2JUN A;  4Q0O A;  3JVM A;  5HFR A;  2YYN A;  3I2D A;  3GG3 A;  3LRQ A;  1WGM A;  5TAB A;  3O35 A;  4O71 A;  2M1R A;  4QEW A;  4OGJ A;  1WUM A;  5DFD A;  2RNW A;  3UV5 A;  5L97 A;  1RMD A;  2IDA A;  4J0S A;  5FE5 A;  3PUQ A;  3FJU B;  2JMI A;  5DLX A;  5F3A A;  2F42 A;  1WEP A;  2L85 A;  3LXJ A;  5H1U A;  3M62 A;  2KWK A;  4A4B A;  2E3K A;  1WFK A;  3PLW A;  5H9M A;  4O7C A;  4LZR A;  5FER A;  4XYA A;  2LGL A;  2R10 A;  5BT5 A;  5B8D A;  5II1 A;  5HQ5 A;  4YBT A;  4Z6H A;  2E7N A;  4YAX A;  5I89 A;  5F1L A;  3JUE A;  2G45 A;  4GNE A;  4PCE A;  5A85 A;  3LQI A;  4O77 A;  5IGM A;  3M99 A;  3MDB C;  2LGK A;  5F61 A;  3AQA A;  5CU8 A;  5E9Y A;  5EP7 A;  4A9E A;  3FEH A;  4QR5 A;  4IOR A;  4H9D A;  4IR5 A;  4S3O C;  4YY4 A;  2NXB A;  2F6J A;  3O47 A;  5DX4 A;  4NR7 A;  4NRC A;  5E3D A;  4LR6 A;  5FE7 A;  2HDP A;  5TDW A;  3KDE C;  2L43 A;  4NUE A;  3QZT A;  4O7F A;  3ZPV E;  2P57 A;  4QSX A;  5ENI A;  5SVX A;  4CUQ A;  2CSY A;  5H1V A;  5HQ7 A;  4YAB A;  2MKE A;  4R2Y A;  5CUE A;  5G04 B;  2YRE A;  4UI9 B;  3N9L A;  5CTL A;  4YC9 A;  5EPB A;  4TZ8 A;  4NR6 A;  4PPE A;  4A9F A;  2KFT A;  3ZYQ A;  4OGC A;  4A49 A;  4UYD A;  3P5O A;  3RPG B;  4WA6 A;  4O76 A;  2VPG A;  4WIV A;  4TU6 A;  4O7E A;  5EPS A;  4BHW A;  5FE0 A;  5FG5 A;  3LVQ E;  5DY7 A;  4ZDT A;  3MQM A;  2CSV A;  4TU4 A;  2E6S A;  4NYV A;  4RVR A;  2G43 A;  2EA6 A;  2XEU A;  2F6N A;  4PS5 A;  3H7H A;  4F52 B;  3MHS A;  4Q6F A;  1JM7 B;  4XUA A;  4BW1 A;  4TT2 A;  3KQI A;  5F1H A;  2YUC A;  1ZBD B;  4NYW A;  4DON A;  3DAI A;  2YEL A;  4HBX A;  1FBV A;  2QIZ A;  4YYK A;  5I40 A;  4N4G A;  4YBM A;  5FE1 A;  2R0Y A;  5IGL A;  2PNX A;  4LK9 A;  4PCI A;  5EGU A;  3UV2 A;  3O34 A;  4FK5 A;  5AIU A;  3UVD A;  2LSP B;  5KTU A;  3L1X A;  3PUR A;  5FEY A;  4CUS A;  5E9I A;  4A9O A;  5IID A;  1ZKR A;  1XWH A;  3MHH A;  1WEN A;  2DAT A;  5C7N A;  3D7C A;  4MR6 A;  4MR3 A;  5I29 A;  4HBY A;  4LJN A;  4ALH A;  4Z6I A;  3FAN A;  3DWD A;  1JM7 A;  5BT4 A;  5D25 A;  3D1B A;  2XOY A;  3HMH A;  2QIC A;  5DYA A;  5FFY A;  2KGG A;  2XOZ A;  3N9N A;  3MUK A;  5KHM A;  5DYU A;  5L8U A;  2LN0 A;  3HMF A;  5TCM A;  2KTB B;  4YYI A;  3IU6 A;  2YDW A;  2L0B A;  2LQ6 A;  4QF2 A;  4QEV A;  2Y1N A;  2MT5 A;  5I86 A;  5LJ0 A;  4QYL A;  5EV9 A;  1WEE A;  1VD4 A;  5J3X A;  5A5P A;  4B86 C;  5D26 A;  5ENB A;  5KTW A;  5HFQ A;  5LKX A;  2MA6 A;  4FO9 A;  4OGI A;  3U5N A;  5FE6 A;  2L7P A;  2L5E A;  2YW5 A;  5LKU A;  5F62 A;  4QNS A;  4HBW A;  4UYE A;  3SOX A;  4CUU A;  1G25 A;  3VKH A;  5CQ7 A;  5KTX A;  1IYM A;  1PUO A;  4N4H A;  2OWA A;  5AD3 A;  3U5M A;  2FSA A;  3IU5 A;  4Q0N A;  5F2P A;  2YHO A;  5L96 A;  4Z1S A;  1WUG A;  5F25 A;  5D3R A;  5SVI B;  2D82 A;  1WIL A;  4YK0 A;  4PY6 A;  4QC3 A;  5FB0 A;  5EYA F;  5A5R A;  5LJ1 A;  4Z0R A;  3TLP A;  4TTE A;  5CZG A;  2R0V A;  2AN6 A;  4X3G A;  2ECJ A;  2YSM A;  5DKH A;  4A9H A;  2YEK A;  2KWJ A;  2L75 A;  4A4C A;  2DWW A;  4LYW A;  3SVF A;  5LKZ A;  1N87 A;  5CUC A;  4YAD A;  5CQ6 A;  1BOR A;  2JRJ A;  2ECV A;  3LDY A;  4AYC B;  4KV4 A;  2KE1 A;  1X0J A;  5FDZ A;  3U5O A;  5DYX A;  3SVH A;  2Y1M A;  1VFY A;  5DW2 A;  5C85 A;  4A9J A;  5SVI A;  3E2D A;  3P1C A;  5CGP A;  4QST A;  3N9Q A;  5FG4 A;  3G0L A;  4UIV A;  5DKA A;  4AP4 A;  4HBV A;  4QEU A;  2YT5 A;  5K29 A;  4CFL A;  4ZC9 A;  2G6Q A;  5EIC A;  4LZ2 A;  2MIQ A;  4AKG A;  4YYN A;  2E61 A;  5E7D A;  4IOO A;  4XUB A;  2JM3 A;  5I7X A;  3M7K A;  5A81 A;  5DIN A;  4NQN A;  3D1D A;  4BBQ A;  4WZ3 B;  1U6G B;  2IQJ A;  5DLZ A;  4AYC A;  3VK6 A;  4QSR A;  3HTK C;  5ENH A;  4MVT A;  2M13 A;  5IBN A;  2YVR A;  5A5N A;  2CSZ A;  5TDR A;  5D3L A;  3ZPV 1;  4MR4 A;  3NXB A;  3O33 A;  3QZV A;  5I3L A;  2FUU A;  4I7B A;  2PUY A;  4QF3 A;  2DSM A;  3O70 A;  4HXP A;  5D1L B;  4NS5 A;  5CY9 A;  5H1T A;  2LV9 A;  2EGM A;  3L11 A;  4A9K A;  4FJC A;  5FFW A;  4IR4 A;  5HEN A;  4Z0O A;  5EVA A;  4GND A;  4A9L A;  3S92 A;  4NN2 A;  3UV4 A;  5B78 A;  4NUC A;  5E9M A;  3ERR A;  5L98 A;  1MM2 A;  2CT2 A;  2M3H A;  3FL2 A;  5COI A;  3ZYU A;  3KNV A;  2H0D B;  4QBM A;  3FKM X;  2YQM A;  4O7B A;  5FH7 A;  4R7E A;  4UIU A;  3UVX A;  4WHU A;  4O62 A;  3N9P A;  2RI7 A;  5D3S A;  2Y43 A;  2VJE B;  4J3I A;  4MEP A;  4TQN A;  4Y03 A;  3SOU A;  4HXK A;  3O7A A;  3M63 A;  2CRR A;  3ONI A;  2LAU A;  3HCU A;  4ALG A;  4C66 A;  3UW9 A;  1WIM A;  5CQ5 A;  4UIT A;  5HJC A;  5C13 A;  4CUR A;  4BW3 A;  2ECI A;  4YYM A;  2XB1 A;  4L7X A;  3AAD A;  4MSX A;  5ENJ A;  4YAT A;  4NXJ A;  3V43 A;  2KKX A;  4NRA A;  2LXP C;  4B7Y C;  2XP0 A;  4NR8 A;  5DFC A;  4Z1Q A;  5AD2 A;  5CQ3 A;  4N4F A;  5HRW A;  2H0D A;  3SUB A;  5C11 A;  2M6M A;  4LZS A;  5CFW A;  2FD4 A;  4V3L C;  4AKH A;  3U5L A;  5LUU A;  4YY6 A;  2VJE A;  1WE9 A;  5E3G A;  4XI1 A;  4LDF A;  2ECT A;  1X4I A;  1WEM A;  4AKN A;  2RFJ A;  5CQT A;  3MXF A;  3O36 A;  4QSW A;  5E74 A;  2OXQ C;  1V87 A;  4QSQ A;  3LJW A;  1WEO A;  4X2I A;  3P1F A;  2YQD A;  4NRB A;  5TB6 A;  5HCL A;  3DQV R;  4L58 A;  2L84 A;  5A5O A;  3P1E A;  4HXS A;  1WEV A;  2KWO A;  4PTB A;  5JI8 A;  5IGK A;  4W4U A;  2LGG A;  4TT4 A;  5EQ1 A; 
#chains in the Genus database with same CATH homology
 2VNF A;  5B75 A;  5I80 A;  4Z93 A;  2K1J A;  1JOC A;  5D1M B;  3RPG C;  5IG6 A;  5FE2 A;  5KH7 A;  1N72 A;  4LRG A;  4J1P A;  5EU1 A;  2K16 A;  4LC2 A;  4GNG A;  4A0C D;  5D0C A;  3K2J A;  5HRX A;  5FE8 A;  4NR9 A;  2CKL B;  4UIZ A;  4QSP A;  5ENC A;  4NR5 A;  4LYI A;  5EWD A;  2NAA A;  5B76 A;  4HXM A;  4AVX A;  5F5Z A;  1WEU A;  4QZS A;  4O7A A;  3JVK A;  4TYL A;  4UIY A;  4TZ2 A;  5EA1 A;  4CUP A;  5FH8 A;  4IR6 A;  2EGP A;  4S3O B;  5E9V A;  4PKL A;  5EWC A;  2OO1 A;  5DW1 A;  4N4I A;  3IHP A;  5DFB A;  2LGV A;  3T7L A;  2GRC A;  5FB1 A;  1JM4 B;  5B79 A;  5FE3 A;  2C2V S;  2DVS A;  5CQ8 A;  5I83 A;  3I3J A;  5JG6 A;  1HYJ A;  3MB4 A;  2KIZ A;  3UVY A;  3C6W A;  4UYH A;  3G0J A;  1F68 A;  3KV5 A;  5BT3 A;  4YH4 A;  2VPB A;  1E4U A;  5KU3 A;  5DKC A;  4OUF A;  5G4S A;  3U5K A;  5ENE A;  2M85 A;  5L99 A;  2VP7 A;  5IGN A;  4MR5 A;  1E6I A;  5G4R A;  4UP0 A;  5AMF A;  5A82 A;  1X4J A;  5ACY A;  5LVQ A;  4KV1 A;  1DVP A;  2I50 A;  2RSD A;  4FLP A;  4N3W A;  5EK9 A;  4P5O B;  4NUD A;  5B77 A;  5KH3 A;  3C5K A;  3UVW A;  2ECN A;  2MA5 A;  5CPE A;  2WP2 A;  3MB3 A;  3LQJ A;  2QJ0 A;  4UYF B;  5HRV A;  4YBS A;  5EIS A;  4MEN A;  2YSJ A;  4ZQL A;  3PHD A;  5A83 A;  4CUT A;  4C9Z A;  4GPJ A;  3GV4 A;  4BW2 A;  3GL6 A;  4HXO A;  4MEQ A;  5EI4 A;  2E6R A;  1Z6U A;  3DPL R;  4YYJ A;  4A9N A;  3N9M A;  1F62 A;  3Q2F A;  3Q2E A;  5HQ6 A;  2ZET C;  4IOQ A;  5D3N A;  5E9K A;  5D3H A;  1WEQ A;  5HEL A;  2K4D A;  2YQL A;  5E73 A;  2KWN A;  1X4U A;  5FH6 A;  4WZ0 A;  2RNX A;  4O75 A;  4O78 A;  2DX8 A;  5EPR A;  2R0S A;  4LKA A;  5AIT A;  4UYF A;  4XY9 A;  5CRM A;  1LDJ B;  5CUA A;  3RCW A;  5LCW B;  4QB3 A;  4TS8 A;  5DBM A;  3VK6 A;  5D7X A;  3ZNI A;  3U5J A;  4QSU A;  5CQA A;  4QSV A;  2DVR A;  4CA1 A;  1WEW A;  2MD7 B;  4J0R A;  5CUG A;  5EWW A;  4IR3 A;  3ZVZ B;  3EB5 A;  2C2L A;  4V3K C;  3MUL A;  5ETB A;  4NR4 A;  2DVQ A;  2YEM A;  2YU4 A;  4ZW1 A;  5DKD A;  5J0D A;  4GB0 A;  2L5U A;  4LAD B;  5FFV A;  4A9I A;  5CS8 A;  4CL9 A;  5I1Q A;  1FP0 A;  4O64 A;  1WES A;  5E9L A;  2I7K A;  4MEO A;  1Z60 A;  2MNZ A;  5A5S A;  1T1H A;  3SVG A;  5LJ2 A;  5A7C A;  4YYH A;  1LDK C;  2JMD A;  2L80 A;  1VYX A;  2ECW A;  1HYI A;  3ZTG A;  5HM0 A;  3T6R A;  4CFK A;  5EWH A;  2H60 A;  3HCT A;  4XY8 A;  4HXL A;  2MJV B;  3JVL A;  3ZVY A;  5AME A;  2BAY A;  4QUT A;  2LRI C;  2D9E A;  1CHC A;  2KGI A;  2MNY A;  5LKT A;  5I7Y A;  5TBN A;  4F3I A;  2KRE A;  4E96 A;  4GNF A;  4WZ2 A;  3JVJ A;  3ASL A;  3HME A;  4QYD A;  5EWV A;  2DKW A;  5C8G A;  4LYS A;  2D8S A;  4I7C A;  2YHN A;  2YUR A;  5D3P A;  2I8N A;  4QUU A;  2ECG A;  4R8P K;  3QZS A;  5A5Q A;  2N9G A;  5DYC A;  5FE4 A;  2UZG A;  4UIX A;  1K2F A;  2OUO A;  5HLS A;  3SHB A;  2YYR A;  3O37 A;  5CP5 A;  5E0R A;  3NG2 A;  1MM3 A;  5D24 A;  4ZUX U;  5CQ4 A;  5FG6 A;  5C4Q A;  5EM3 A;  2MUM A;  5F63 A;  5C87 A;  5LVR A;  3DWY A;  4CCG X;  1JSP B;  4O72 A;  5ENF A;  2LDR A;  4O70 A;  2KU3 A;  3N9O A;  4BJX A;  5D1K B;  2MD8 C;  2VJF B;  3P1D A;  4HXN A;  5CUD A;  4YH3 A;  2EOD A;  3EB6 A;  3HCS A;  5ENG A;  5II2 A;  2VPD A;  5L8T A;  4LLB A;  5F60 A;  2YW8 A;  4YYG A;  4O74 A;  1EQF A;  5H85 A;  5JWM A;  5G05 B;  4UIW A;  5KO4 A;  3RTR B;  2E7O A;  2LXH C;  3U5P A;  2K17 A;  2KR4 A;  4UP5 A;  4IC2 A;  2WP1 A;  5CUB A;  3LQH A;  5FE9 A;  5D3J A;  4QSS A;  5ETD A;  4C67 A;  2JMJ A;  2DVV A;  3L1Z B;  3SOW A;  2VPE A;  4QY4 A;  5C89 A;  4QC1 A;  4FIP A;  2RS9 B;  2VJF A;  4QR3 A;  4TKP B;  4I7D A;  4CLB A;  2HYE D;  2KYU A;  4NYX A;  2RNY A;  4NQM A;  4IC3 A;  5G0F A;  2RO1 A;  2CKL A;  5FBX A;  5CRZ A;  5D3T A;  3S91 A;  3KV6 A;  5KH9 A;  2G4A A;  4AUQ B;  5F36 A;  4A9M A;  5I88 A;  5TRB A;  1Z2Q A;  4WHW A;  1ZS5 A;  4QR4 A;  2OSS A;  4BW4 A;  2FUI A;  4HXR A;  4TT6 A;  4UYG A;  4KCX A;  5HEM A;  4YYD A;  4Q0O A;  3JVM A;  5HFR A;  2YYN A;  3I2D A;  3GG3 A;  3LRQ A;  1WGM A;  5TAB A;  3O35 A;  4O71 A;  2M1R A;  4QEW A;  4OGJ A;  1WUM A;  5DFD A;  2RNW A;  3UV5 A;  5L97 A;  1RMD A;  2IDA A;  4J0S A;  5FE5 A;  3PUQ A;  2JMI A;  5DLX A;  5F3A A;  2F42 A;  1WEP A;  2L85 A;  3LXJ A;  5H1U A;  3M62 A;  2KWK A;  4A4B A;  2E3K A;  1WFK A;  5H9M A;  4O7C A;  4LZR A;  5FER A;  4XYA A;  2LGL A;  2R10 A;  5BT5 A;  5B8D A;  5II1 A;  5HQ5 A;  4YBT A;  4Z6H A;  2E7N A;  4YAX A;  5I89 A;  5F1L A;  2G45 A;  4GNE A;  4PCE A;  5A85 A;  3LQI A;  4O77 A;  5IGM A;  3M99 A;  2LGK A;  5F61 A;  3AQA A;  5CU8 A;  5E9Y A;  5EP7 A;  4A9E A;  4QR5 A;  4IOR A;  4IR5 A;  4S3O C;  4YY4 A;  2NXB A;  2F6J A;  5DX4 A;  4NR7 A;  4NRC A;  5E3D A;  4LR6 A;  5FE7 A;  2HDP A;  5TDW A;  2L43 A;  4NUE A;  3QZT A;  4O7F A;  3ZPV E;  4QSX A;  5ENI A;  4CUQ A;  2CSY A;  5H1V A;  5HQ7 A;  4YAB A;  4R2Y A;  5G04 B;  5CUE A;  2YRE A;  4UI9 B;  3N9L A;  5CTL A;  4YC9 A;  5EPB A;  4TZ8 A;  4NR6 A;  4PPE A;  4A9F A;  2KFT A;  3ZYQ A;  4A49 A;  4UYD A;  3P5O A;  3RPG B;  4WA6 A;  4O76 A;  2VPG A;  4WIV A;  4TU6 A;  4O7E A;  5EPS A;  4BHW A;  5FE0 A;  5FG5 A;  5DY7 A;  4ZDT A;  3MQM A;  4TU4 A;  2E6S A;  4NYV A;  4RVR A;  2G43 A;  2EA6 A;  2XEU A;  2F6N A;  4PS5 A;  4F52 B;  3MHS A;  4Q6F A;  1JM7 B;  4XUA A;  4BW1 A;  4TT2 A;  3KQI A;  5F1H A;  2YUC A;  1ZBD B;  4NYW A;  4DON A;  3DAI A;  2YEL A;  4HBX A;  1FBV A;  2QIZ A;  4YYK A;  5I40 A;  4N4G A;  4YBM A;  5FE1 A;  2R0Y A;  5IGL A;  2PNX A;  4LK9 A;  4PCI A;  5EGU A;  3UV2 A;  3O34 A;  4FK5 A;  5AIU A;  3UVD A;  2LSP B;  5KTU A;  3L1X A;  3PUR A;  5FEY A;  4CUS A;  5E9I A;  4A9O A;  5IID A;  1XWH A;  3MHH A;  1WEN A;  2DAT A;  5C7N A;  3D7C A;  4MR6 A;  4MR3 A;  5I29 A;  4HBY A;  4LJN A;  4ALH A;  4Z6I A;  1JM7 A;  5BT4 A;  5D25 A;  3HMH A;  2QIC A;  5DYA A;  5FFY A;  2KGG A;  3N9N A;  3MUK A;  5KHM A;  5DYU A;  5L8U A;  2LN0 A;  3HMF A;  5TCM A;  2KTB B;  4YYI A;  3IU6 A;  2YDW A;  2L0B A;  2LQ6 A;  4QF2 A;  4QEV A;  2Y1N A;  2MT5 A;  5I86 A;  5LJ0 A;  4QYL A;  5EV9 A;  1WEE A;  1VD4 A;  5J3X A;  5A5P A;  4B86 C;  5D26 A;  5ENB A;  5KTW A;  5HFQ A;  5LKX A;  2MA6 A;  4FO9 A;  4OGI A;  3U5N A;  5FE6 A;  2L5E A;  2YW5 A;  5LKU A;  5F62 A;  4QNS A;  4HBW A;  4UYE A;  3SOX A;  4CUU A;  1G25 A;  5CQ7 A;  5KTX A;  1IYM A;  4N4H A;  5AD3 A;  3U5M A;  2FSA A;  3IU5 A;  4Q0N A;  5F2P A;  2YHO A;  5L96 A;  4Z1S A;  1WUG A;  5F25 A;  5D3R A;  2D82 A;  1WIL A;  4YK0 A;  4PY6 A;  4QC3 A;  5FB0 A;  5EYA F;  5A5R A;  5LJ1 A;  3TLP A;  4TTE A;  5CZG A;  2R0V A;  2AN6 A;  4X3G A;  2ECJ A;  2YSM A;  5DKH A;  4A9H A;  2YEK A;  2KWJ A;  2L75 A;  4A4C A;  2DWW A;  4LYW A;  3SVF A;  5LKZ A;  1N87 A;  5CUC A;  4YAD A;  5CQ6 A;  1BOR A;  2JRJ A;  2ECV A;  4AYC B;  4KV4 A;  2KE1 A;  1X0J A;  5FDZ A;  3U5O A;  5DYX A;  3SVH A;  2Y1M A;  1VFY A;  5DW2 A;  5C85 A;  4A9J A;  3P1C A;  5CGP A;  4QST A;  3N9Q A;  5FG4 A;  3G0L A;  4UIV A;  5DKA A;  4AP4 A;  4HBV A;  4QEU A;  2YT5 A;  5K29 A;  4CFL A;  4ZC9 A;  2G6Q A;  5EIC A;  4LZ2 A;  2MIQ A;  4YYN A;  5E7D A;  4IOO A;  4XUB A;  5I7X A;  5A81 A;  5DIN A;  4NQN A;  4BBQ A;  4WZ3 B;  1U6G B;  5DLZ A;  4AYC A;  4QSR A;  3HTK C;  5ENH A;  4MVT A;  5IBN A;  5A5N A;  2CSZ A;  5TDR A;  5D3L A;  3ZPV 1;  4MR4 A;  3NXB A;  3O33 A;  3QZV A;  5I3L A;  2FUU A;  4I7B A;  2PUY A;  4QF3 A;  3O70 A;  4HXP A;  5D1L B;  4NS5 A;  5CY9 A;  5H1T A;  2LV9 A;  4FJC A;  3L11 A;  4A9K A;  5FFW A;  4IR4 A;  5HEN A;  5EVA A;  4GND A;  4A9L A;  3S92 A;  4NN2 A;  3UV4 A;  5B78 A;  4NUC A;  5E9M A;  5L98 A;  2CT2 A;  1MM2 A;  2M3H A;  3FL2 A;  3KNV A;  5COI A;  3ZYU A;  2H0D B;  4QBM A;  3FKM X;  2YQM A;  4O7B A;  5FH7 A;  4R7E A;  4UIU A;  3UVX A;  4WHU A;  3N9P A;  2RI7 A;  5D3S A;  2Y43 A;  2VJE B;  4J3I A;  4MEP A;  4TQN A;  4Y03 A;  3SOU A;  4HXK A;  3O7A A;  3M63 A;  3ONI A;  3HCU A;  4ALG A;  4C66 A;  3UW9 A;  1WIM A;  5CQ5 A;  4UIT A;  5HJC A;  5C13 A;  4CUR A;  4BW3 A;  2ECI A;  4YYM A;  2XB1 A;  4L7X A;  3AAD A;  4MSX A;  5ENJ A;  4YAT A;  4NXJ A;  3V43 A;  4NRA A;  2LXP C;  4B7Y C;  4NR8 A;  5DFC A;  4Z1Q A;  5AD2 A;  5CQ3 A;  4N4F A;  5HRW A;  2H0D A;  5C11 A;  2M6M A;  4LZS A;  5CFW A;  4V3L C;  3U5L A;  5LUU A;  4YY6 A;  2VJE A;  1WE9 A;  5E3G A;  4XI1 A;  4LDF A;  2ECT A;  1X4I A;  1WEM A;  4AKN A;  2RFJ A;  5CQT A;  3MXF A;  3O36 A;  4QSW A;  5E74 A;  2OXQ C;  1V87 A;  4QSQ A;  3LJW A;  1WEO A;  4X2I A;  3P1F A;  2YQD A;  4NRB A;  5TB6 A;  5HCL A;  3DQV R;  4L58 A;  2L84 A;  5A5O A;  3P1E A;  4HXS A;  1WEV A;  2KWO A;  4PTB A;  5JI8 A;  5IGK A;  4W4U A;  2LGG A;  4TT4 A;  5EQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...