4N3WA

Crystal structure of the bromodomain-phd finger module of human transcriptional co-activator cbp in complex with acetylated histone 4 peptide (h4k20ac).
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
231
structure length
184
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCDDPSQPQTTKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into Acetylated-Histone H4 Recognition by the Bromodomain-PHD Finger Module of Human Transcriptional Coactivator CBP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/nuclear protein
molecule keywords CREB-binding protein
total genus 55
structure length 184
sequence length 231
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF06001 DUF902 Domain of Unknown Function (DUF902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n3wA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4n3wA02
4NR5A 4HXNA 2K1JA 4OUFA 5C8GA 2RSDA 4S3OB 5F62A 4V3KC 5KH9A 1WEWA 4ZQLA 5KHMA 4YYGA 5D3PA 5HQ7A 4YYJA 5D3SA 5BT5A 1VFYA 1Z6UA 5E0RA 1N72A 5EA1A 3ZPV1 3ZYQA 3JVMA 3P5OA 2KGGA 2N9GA 3DAIA 2LV9A 2E3KA 3LJWA 5DKDA 1DVPA 2LGLA 2WP1A 5FFYA 3MQMA 3RPGB 5D3NA 2L84A 4LRGA 2Y1NA 2KWKA 3MB4A 4QC3A 2OUOA 3L1ZB 3NG2A 5HFRA 4QSXA 1JM7B 5D0CA 3N9QA 1ZS5A 4YH3A 4BW1A 2LGVA 1F68A 4TT2A 5EP7A 2QIZA 2MA6A 5A5NA 5E74A 5EPBA 5CQAA 5JWMA 3U5KA 5JG6A 3JVKA 5A83A 2MT5A 2DVQA 5DLZA 5FEYA 1U6GB 3UV2A 4CUUA 3RCWA 1T1HA 5HFQA 2LN0A 2DWWA 4IR6A 5HEMA 3O33A 4LYWA 4O71A 5K29A 4X3GA 2E7OA 5CQ7A 2D9EA 5ENGA 5LJ0A 2HDPA 3C5KA 5KH7A 2MUMA 4BBQA 3UV5A 2L80A 4QC1A 3IHPA 4B86C 5ENEA 1WILA 5LVRA 5DY7A 4B7YC 2LDRA 4QR4A 4LZRA 2YYRA 4FJCA 2DATA 4AYCB 5D3LA 5D7XA 4WIVA 5LCWB 2KGIA 4YYMA 5IGLA 5D25A 5DW2A 5FG4A 5LUUA 4QSQA 5TABA 4X2IA 5FE0A 5CU8A 2MJVB 4HXPA 4V3LC 5I3LA 1WGMA 1F62A 5EWHA 2PUYA 3ZVZB 4ZDTA 3ONIA 2DVVA 5F60A 1JM7A 4A9HA 4A9LA 2G6QA 4GPJA 4Q0OA 5H1UA 3HMEA 4MEPA 5A85A 4MR6A 5F2PA 2DVRA 5CQ8A 4UYGA 2ECWA 5D1MB 5DKAA 4N4FA 5EGUA 4C9ZA 3AADA 1XWHA 5DFBA 2KU3A 4ZUXU 4QY4A 1X4UA 2YEMA 4N4HA 4PS5A 5B75A 4XUBA 5AIUA 3QZTA 5G04B 4UIYA 4N3WA 4O7BA 4NXJA 5FBXA 4YADA 3HCSA 4IR5A 4N4IA 5ENJA 2M85A 2D82A 2I8NA 4A9OA 4IORA 4UIWA 5TRBA 4O7FA 2H60A 3KNVA 4ALGA 4YK0A 5LJ2A 1WIMA 5AD3A 1LDKC 3U5NA 1Z2QA 3NXBA 4PKLA 4YABA 1MM3A 5A5QA 5DBMA 4A49A 4IC3A 4NR6A 5F1LA 4A9KA 4WHWA 2M1RA 3HMFA 5ACYA 2RS9B 5I89A 2K16A 2YQLA 3L11A 5HRWA 2F42A 4TZ2A 4C67A 4UIZA 2KWOA 5I80A 3I2DA 5BT4A 5II2A 2CT2A 4YY4A 5B76A 5CUGA 3PUQA 2HYED 4CA1A 4NRBA 5E9KA 4LYSA 4YY6A 5EISA 4O74A 4QSWA 4UYEA 2F6JA 4ALHA 5DKCA 2RNYA 3RTRB 5FB1A 1BORA 1X4IA 5CRZA 2YREA 5F63A 1LDJB 3T6RA 4R8PK 3EB5A 4CFKA 2LSPB 4O75A 4PCIA 5LJ1A 2I50A 4CCGX 2LGGA 5IGKA 5CQ6A 5E3GA 3FKMX 4Z6IA 1ZBDB 5F25A 1WEQA 4NRCA 5ENFA 3HCUA 3U5PA 4QZSA 3P1EA 2YSJA 5KTXA 1RMDA 4I7BA 5CQ4A 4TZ8A 5E9LA 4A9IA 4LYIA 3O37A 5DYAA 4Q6FA 4CUTA 3EB6A 3LXJA 4IR4A 4AVXA 2FSAA 5I7XA 4QR5A 3S91A 4PPEA 2JMDA 1G25A 2EGPA 4UIUA 2MIQA 4QEVA 5DYCA 5G4SA 4O72A 1JOCA 3SOUA 2M3HA 4O7EA 2FUIA 1K2FA 5H85A 4HBYA 1E6IA 5CUCA 3N9LA 4NUCA 3SVFA 4CUPA 5L98A 5A5RA 4QEWA 4YBTA 4GB0A 5L96A 4UYHA 5D3RA 3N9PA 2MD8C 4UITA 5F61A 2XEUA 4FK5A 5G0FA 5E9IA 5E9MA 3P1CA 5KO4A 2FUUA 5EYAF 3JVJA 2YU4A 3O70A 4QSSA 4J0SA 5CQ5A 4Z6HA 4A9NA 5FE9A 3U5OA 2DKWA 2ECNA 2VPGA 3ZTGA 3K2JA 4QSVA 4TKPB 5HJCA 5COIA 5IIDA 3VK6A 3MXFA 5EI4A 4J3IA 4I7CA 2NAAA 2LXPC 4O76A 1WENA 3DQVR 5I83A 3MHHA 3LQJA 3P1DA 5D3TA 2PNXA 2KE1A 2YELA 3O34A 2RFJA 4YATA 4MR5A 5IGMA 4AYCA 5ENCA 2EODA 4AKNA 5HM0A 4I7DA 4AP4A 2YW5A 4E96A 4YBSA 2C2LA 4MR4A 3ASLA 3U5MA 5HELA 3UVWA 5FE2A 4TT4A 4WA6A 5TCMA 5CQ3A 5FE7A 3D7CA 2WP2A 4O64A 4UP0A 4QSTA 1EQFA 3T7LA 2YW8A 2JMIA 3I3JA 2RNXA 4O7AA 3KV6A 4HXLA 4IOOA 5E3DA 5FE6A 5TDWA 4L58A 2YHNA 2R0VA 4UI9B 4LK9A 5A5PA 4HXKA 4N4GA 4TS8A 5HENA 5L97A 5J3XA 5L8UA 4TU4A 5EQ1A 5D3HA 3PHDA 5EVAA 4YYDA 2DX8A 2BAYA 3G0LA 5H1VA 4A9MA 4NQMA 4QR3A 2L5UA 2E7NA 1VYXA 5ENHA 4A9JA 1FP0A 4R7EA 3SOXA 4F52B 2XB1A 2OO1A 2KWJA 2K17A 4CUQA 4NR8A 2CKLB 4PTBA 5ENIA 4ZC9A 5E9VA 5E9YA 5CUBA 1E4UA 3LQHA 4WZ3B 5EM3A 5A5SA 2VJEB 4XY8A 5DFDA 5EWCA 5EWWA 4QBMA 2KWNA 4UIXA 5A7CA 4GNFA 4QUUA 1V87A 4HXRA 4ZW1A 5FFVA 5TB6A 4LLBA 4Q0NA 4KV1A 2ZETC 3AQAA 4IC2A 2QJ0A 2VPDA 2VJFA 2G4AA 2ECJA 5CY9A 5C4QA 3Q2FA 5I29A 3IU6A 4QSUA 4FIPA 4LKAA 4QF3A 1WUMA 5HLSA 5CUDA 2Y43A 4QEUA 3L1XA 3M99A 5F3AA 4R2YA 1WEMA 4QF2A 5G05B 5H9MA 5FFWA 4YH4A 3UW9A 5LKZA 2KYUA 1VD4A 4O70A 5HQ5A 3U5JA 2IDAA 3UVYA 3LQIA 3DWYA 3FL2A 2MD7B 5BT3A 1FBVA 5ETDA 5I88A 5KTWA 2AN6A 2VPBA 4YYIA 5DYUA 5I7YA 3HCTA 5ETBA 2VPEA 4NYXA 5C89A 4XI1A 1CHCA 2G43A 4O78A 5A82A 5FH6A 3ZYUA 2E6SA 2OXQC 4A9EA 5LVQA 2R0SA 3SVHA 5B8DA 3ZVYA 4FO9A 5B78A 5CPEA 4MEOA 4YYKA 1IYMA 5HCLA 3O36A 5HRXA 2I7KA 3MHSA 3UVDA 3N9MA 1N87A 5LKUA 1Z60A 3SVGA 2VP7A 5FE5A 4QUTA 4MEQA 4QB3A 5TDRA 3SHBA 5CUEA 2G45A 5DFCA 2YHOA 2RI7A 5E7DA 3IU5A 5CUAA 4GNEA 2NXBA 2CSZA 5II1A 5L8TA 4CLBA 5A81A 4XUAA 2L43A 5AMEA 5JI8A 2KR4A 3M63A 4Z93A 5I1QA 4NR7A 4IOQA 4A0CD 4UYDA 4IR3A 2H0DB 4QSRA 2JRJA 3QZSA 2KIZA 2KTBB 3DPLR 4BHWA 4LJNA 1JSPB 4PCEA 2YDWA 2LXHC 1X0JA 1WEOA 4HXMA 5LKTA 5CGPA 2YUCA 5CZGA 4HXOA 4S3OC 5DYXA 5EWDA 2YQDA 5DINA 5AITA 2RO1A 3G0JA 2KFTA 4NS5A 5KTUA 5D1KB 1MM2A 5D1LB 5EK9A 4LDFA 4CURA 5C11A 2ECTA 5KH3A 4UYFB 3MULA 2MNZA 3KQIA 5E73A 3U5LA 2L5EA 3GL6A 5ENBA 4QNSA 2D8SA 4AUQB 5CP5A 4KV4A 2QICA 2UZGA 2VJFB 3M62A 4NYVA 3QZVA 5FE4A 4C66A 2YT5A 3N9OA 2LQ6A 1HYIA 5L99A 5F36A 2E6RA 4CUSA 2Y1MA 1WE9A 2ECIA 3LRQA 4LR6A 4Z1QA 5D24A 5C7NA 4HBXA 5FH8A 2YEKA 1HYJA 5G4RA 4L7XA 4MR3A 4BJXA 4QSPA 5I40A 4GNGA 2L85A 4RVRA 5CFWA 5IGNA 4NRAA 5CRMA 4HXSA 4MSXA 3MUKA 4TQNA 5EU1A 4NR4A 1WEPA 5DLXA 4OGIA 5C13A 4HBVA 5FE8A 2EA6A 4NUDA 3C6WA 3UV4A 4P5OB 3UVXA 2L0BA 4CFLA 5AMFA 2LRIC 2K4DA 4LZSA 4XYAA 4J0RA 4WZ2A 2F6NA 5CTLA 2ECGA 5FG6A 3O7AA 2H0DA 4J1PA 5EV9A 2ECVA 4LADB 4GNDA 5D3JA 2L75A 3PURA 1WEUA 4HBWA 4Z1SA 4O7CA 2YYNA 5AD2A 4TU6A 2CSYA 2YSMA 3HTKC 5IBNA 2VNFA 5HQ6A 3O35A 5DKHA 5DX4A 4F3IA 4UIVA 5FG5A 1WFKA 5EPSA 1X4JA 4TT6A 3HMHA 3V43A 4UYFA 4YAXA 4LZ2A 5HRVA 1JM4B 4A4BA 2R0YA 4MENA 5EPRA 4WZ0A 3N9NA 3TLPA 2YQMA 1WEVA 4A9FA 4QYLA 5B79A 4W4UA 1WUGA 4QYDA 3GV4A 4LC2A 4MVTA 3SOWA 2JMJA 2M6MA 3RPGC 5D26A 5I86A 4NN2A 4YC9A 5CS8A 1WEEA 4A4CA 4FLPA 2RNWA 5FB0A 4TTEA 4TYLA 5C87A 4XY9A 4NQNA 5DW1A 4YYHA 4NR9A 4Y03A 5KU3A 2KREA 4CL9A 5C85A 4BW2A 5CQTA 2MA5A 4DONA 4OGJA 5TBNA 3MB3A 5B77A 3S92A 2VJEA 2R10A 5FE1A 2MNYA 5EICA 5FERA 3ZPVE 4O77A 3JVLA 5F1HA 5FDZA 4YYNA 2C2VS 5A5OA 2CKLA 2OSSA 5EWVA 4NUEA 4YBMA 3ZNIA 5H1TA 3P1FA 4WHUA 2LGKA 4BW4A 5LKXA 4UP5A 5F5ZA 5J0DA 4NYWA 5IG6A 2DVSA 1WESA 4BW3A 3GG3A 2YURA 5FE3A 3KV5A 4KCXA 2GRCA 4PY6A 3Q2EA 5FH7A
chains in the Genus database with same CATH superfamily
4NR5A 4HXNA 2K1JA 4OUFA 5C8GA 2RSDA 4S3OB 5F62A 4V3KC 5KH9A 1WEWA 4ZQLA 5KHMA 4YYGA 5D3PA 5HQ7A 4YYJA 5D3SA 5BT5A 1VFYA 1Z6UA 5E0RA 1N72A 5EA1A 2DJAA 3ZPV1 3ZYQA 3JVMA 3P5OA 2KGGA 2N9GA 3DAIA 2LV9A 3D1DA 3H7HA 2E3KA 3LJWA 5DKDA 1DVPA 4AKGA 2LGLA 2WP1A 5FFYA 3MQMA 3RPGB 5D3NA 2L84A 4LRGA 2Y1NA 2KWKA 3MB4A 4QC3A 2OUOA 3L1ZB 2JUNA 3NG2A 5HFRA 3FAOA 4QSXA 1JM7B 5D0CA 3N9QA 1ZS5A 4YH3A 4BW1A 2LGVA 1F68A 4TT2A 5EP7A 2CRRA 2QIZA 2MA6A 5A5NA 5E74A 5EPBA 5CQAA 5JWMA 3U5KA 5JG6A 3JVKA 5A83A 2MT5A 2DVQA 5DLZA 5FEYA 1U6GB 1MBMA 3UV2A 1ZKRA 4CUUA 3RCWA 1T1HA 5HFQA 2LN0A 2DWWA 4IR6A 5HEMA 3O33A 4LYWA 4O71A 5K29A 4X3GA 2E7OA 5CQ7A 2B0OE 2D9EA 5ENGA 5LJ0A 2HDPA 3C5KA 5KH7A 2MUMA 4BBQA 3UV5A 2L80A 4QC1A 3IHPA 4B86C 3T9KA 5ENEA 1WILA 5LVRA 5DY7A 4B7YC 2LDRA 4Z0OA 4QR4A 4LZRA 2YYRA 4FJCA 2DATA 4AYCB 5D3LA 5D7XA 4WIVA 5LCWB 2KGIA 4YYMA 5IGLA 5D25A 5DW2A 5FG4A 2EJNA 4QSQA 5LUUA 5TABA 4X2IA 5FE0A 5CU8A 2MJVB 4HXPA 4V3LC 5I3LA 5SVXA 1WGMA 1F62A 5EWHA 2PUYA 3ZVZB 4ZDTA 3ONIA 2DVVA 5F60A 1JM7A 4A9HA 4A9LA 2G6QA 4GPJA 4Q0OA 5H1UA 3HMEA 4MEPA 5A85A 4O62A 4MR6A 5F2PA 2DVRA 5CQ8A 3LDYA 4UYGA 2ECWA 5D1MB 5DKAA 4N4FA 5EGUA 4C9ZA 3AADA 1XWHA 5DFBA 2KU3A 4ZUXU 4QY4A 1X4UA 2YEMA 4N4HA 4PS5A 5B75A 4XUBA 5AIUA 3QZTA 5G04B 4UIYA 4N3WA 4O7BA 4NXJA 2YVRA 5FBXA 4YADA 3HCSA 4IR5A 4N4IA 5ENJA 2M85A 3LJUX 2D82A 2I8NA 4A9OA 4IORA 4UIWA 5TRBA 4O7FA 2H60A 3KNVA 4ALGA 4YK0A 1DCQA 5LJ2A 1WIMA 5AD3A 1LDKC 3U5NA 1Z2QA 3NXBA 4OGEA 4PKLA 4YABA 1MM3A 5A5QA 5DBMA 4A49A 4IC3A 3LVQE 4NR6A 5F1LA 4A9KA 4WHWA 2M1RA 3HMFA 5ACYA 2RS9B 5I89A 2K16A 2YQLA 3L11A 5HRWA 2F42A 4TZ2A 4C67A 4UIZA 2KWOA 5I80A 3I2DA 5BT4A 5II2A 2CT2A 3MDBC 4YY4A 5B76A 5CUGA 3PUQA 2HYED 4CA1A 3M7KA 4NRBA 5E9KA 4LYSA 4YY6A 5EISA 4O74A 4QSWA 4UYEA 2F6JA 4ALHA 5DKCA 2RNYA 3RTRB 5FB1A 1BORA 1X4IA 5CRZA 2XP0A 2YREA 5F63A 1LDJB 3T6RA 4R8PK 3EB5A 2CRWA 4CFKA 2LSPB 4O75A 4PCIA 5LJ1A 2I50A 4CCGX 2LGGA 5IGKA 5CQ6A 5E3GA 3E2DA 3FKMX 4Z6IA 5SVIB 1ZBDB 5F25A 1WEQA 4NRCA 5ENFA 3HCUA 3U5PA 4QZSA 2XOCA 3P1EA 2YSJA 5KTXA 1RMDA 4I7BA 5CQ4A 4TZ8A 5E9LA 4A9IA 4LYIA 3O37A 5DYAA 4Q6FA 4CUTA 3EB6A 3LXJA 4IR4A 4AVXA 2FSAA 5I7XA 4QR5A 3S91A 4PPEA 2JMDA 3FM8C 1G25A 2EGPA 4UIUA 2MIQA 4QEVA 5DYCA 5G4SA 4O72A 1JOCA 3SOUA 2M3HA 4O7EA 2FUIA 1K2FA 5H85A 4HBYA 1E6IA 5CUCA 3N9LA 4NUCA 3SVFA 4CUPA 5L98A 5A5RA 4QEWA 4YBTA 4GB0A 5L96A 4UYHA 5D3RA 3N9PA 3ERRA 2MD8C 4UITA 2CSVA 5F61A 2XEUA 4FK5A 5G0FA 5E9IA 5E9MA 3P1CA 5KO4A 2FUUA 5EYAF 3JVJA 2YU4A 3O70A 4QSSA 4J0SA 5CQ5A 4Z6HA 4A9NA 5FE9A 3U5OA 3FEHA 2DKWA 2ECNA 2VPGA 3ZTGA 3K2JA 5SVIA 2XOZA 4QSVA 4TKPB 2KKXA 5HJCA 5COIA 5IIDA 3VK6A 3MXFA 5EI4A 4J3IA 4I7CA 2NAAA 2LXPC 4O76A 1WENA 3DQVR 5I83A 3MHHA 3LQJA 3P1DA 5D3TA 2PNXA 2KE1A 2YELA 3O34A 3PLWA 2RFJA 4YATA 4MR5A 5IGMA 4AYCA 5ENCA 2EODA 4AKNA 3FJUB 5HM0A 4I7DA 4AP4A 2YW5A 4E96A 4YBSA 2C2LA 4MR4A 2L7PA 3ASLA 3U5MA 5HELA 3UVWA 5FE2A 4TT4A 4WA6A 5TCMA 5SVYA 5CQ3A 5FE7A 3D7CA 2WP2A 4O64A 4UP0A 4QSTA 1EQFA 3T7LA 2YW8A 2JMIA 3I3JA 2RNXA 4O7AA 3KV6A 4HXLA 4IOOA 5E3DA 5FE6A 2OWAA 4L58A 2YHNA 2R0VA 4UI9B 4LK9A 5TDWA 5A5PA 4HXKA 4N4GA 4TS8A 5HENA 5L97A 5J3XA 5L8UA 4TU4A 5EQ1A 5D3HA 3PHDA 3VKGA 5EVAA 4YYDA 2DX8A 2BAYA 3G0LA 5H1VA 4A9MA 4NQMA 4QR3A 2L5UA 2E7NA 1VYXA 5ENHA 4A9JA 1FP0A 4R7EA 3SOXA 4F52B 2XB1A 2OO1A 2KWJA 2K17A 4CUQA 4NR8A 2CKLB 4PTBA 5ENIA 4QQ4A 4ZC9A 5E9VA 5E9YA 5CUBA 1E4UA 3LQHA 4WZ3B 5EM3A 5A5SA 2VJEB 4XY8A 5DFDA 3Q1DA 5EWCA 5EWWA 4QBMA 2KWNA 4UIXA 5A7CA 4GNFA 4QUUA 1V87A 4HXRA 4ZW1A 2KKYA 5FFVA 5TB6A 4LLBA 4Q0NA 4KV1A 2ZETC 3AQAA 4IC2A 4AKIA 2QJ0A 2VPDA 2VJFA 2G4AA 2ECJA 5CY9A 5C4QA 3Q2FA 5I29A 3IU6A 4QSUA 4FIPA 4LKAA 4QF3A 1WUMA 5HLSA 5CUDA 2Y43A 4QEUA 3L1XA 3M99A 5F3AA 4R2YA 1WEMA 4QF2A 5G05B 5H9MA 5FFWA 4YH4A 3UW9A 5LKZA 2KYUA 1VD4A 4O70A 5HQ5A 3U5JA 2IDAA 3UVYA 3LQIA 3DWYA 3FL2A 2MD7B 5BT3A 1FBVA 2RR4A 5ETDA 5I88A 5KTWA 2AN6A 2VPBA 4YYIA 5DYUA 5I7YA 3HCTA 5ETBA 2VPEA 4NYXA 5C89A 4XI1A 1CHCA 2G43A 4O78A 5A82A 2DSMA 5FH6A 3ZYUA 2E6SA 2OXQC 4A9EA 5LVQA 2R0SA 3SVHA 5B8DA 3LVRE 4FO9A 3ZVYA 5B78A 5CPEA 4MEOA 4YYKA 1IYMA 5HCLA 3O36A 5HRXA 2I7KA 3MHSA 2P57A 3UVDA 3N9MA 1N87A 5LKUA 1Z60A 3SVGA 2VP7A 5FE5A 4QUTA 4MEQA 4QB3A 5TDRA 3SHBA 5CUEA 2G45A 5DFCA 2YHOA 2RI7A 5E7DA 3IU5A 5CUAA 2M13A 4GNEA 2NXBA 2CSZA 5II1A 5L8TA 4CLBA 5A81A 4XUAA 4AI6A 2L43A 5AMEA 5JI8A 2KR4A 3M63A 4Z93A 5I1QA 4NR7A 4IOQA 4A0CD 4UYDA 2MKEA 4IR3A 2H0DB 4QSRA 2JRJA 2IQJA 3QZSA 2KIZA 2KTBB 3DPLR 4BHWA 4LJNA 1JSPB 4PCEA 2YDWA 2LXHC 3JUEA 3O47A 1X0JA 1WEOA 4HXMA 2FFWA 5LKTA 5CGPA 2YUCA 5CZGA 4HXOA 4S3OC 5DYXA 5EWDA 2EGMA 2YQDA 5DINA 5AITA 2RO1A 3G0JA 2KFTA 4NS5A 5KTUA 5D1KB 1MM2A 5D1LB 4LDFA 5EK9A 4CURA 5C11A 2ECTA 3D1BA 5KH3A 4UYFB 3MULA 2MNZA 3KQIA 5E73A 3U5LA 2L5EA 3GL6A 5ENBA 4QNSA 2D8SA 4AUQB 5CP5A 4KV4A 3VKHA 2QICA 2UZGA 2VJFB 3M62A 4NYVA 3QZVA 5FE4A 4C66A 2YT5A 3N9OA 2LQ6A 1HYIA 5L99A 5F36A 4F1PA 2E6RA 4CUSA 2Y1MA 1WE9A 2ECIA 3LRQA 4LR6A 4Z1QA 2EXUA 5D24A 5C7NA 4H9DA 4HBXA 5FH8A 2YEKA 1HYJA 5G4RA 4L7XA 4MR3A 4BJXA 4QSPA 5I40A 4GNGA 2L85A 4RVRA 5CFWA 5IGNA 4NRAA 5CRMA 2XOYA 4HXSA 5K3QA 4MSXA 3MUKA 4TQNA 5EU1A 4NR4A 1WEPA 5DLXA 4OGIA 2E61A 5C13A 4HBVA 5FE8A 1PUOA 2EA6A 4NUDA 3C6WA 3UV4A 4P5OB 2FD4A 3UVXA 2L0BA 4CFLA 5AMFA 2LRIC 2K4DA 4LZSA 4XYAA 4J0RA 4WZ2A 2F6NA 5CTLA 4OGCA 2ECGA 5FG6A 3O7AA 2JM3A 2H0DA 4J1PA 5EV9A 2ECVA 4LADB 4GNDA 5D3JA 2L75A 3DDTA 3PURA 1WEUA 4HBWA 4Z1SA 4O7CA 3DWDA 2YYNA 5AD2A 4TU6A 2CSYA 2YSMA 3HTKC 5IBNA 2VNFA 5HQ6A 3O35A 5DKHA 5DX4A 4F3IA 4UIVA 5FG5A 1WFKA 5EPSA 1X4JA 4TT6A 2CONA 3HMHA 3V43A 4UYFA 4YAXA 4LZ2A 5HRVA 1JM4B 4A4BA 2R0YA 4MENA 5EPRA 4WZ0A 3N9NA 3TLPA 2YQMA 1WEVA 4A9FA 4QYLA 4Z0RA 5B79A 4W4UA 1WUGA 4QYDA 3GV4A 4LC2A 4MVTA 3SUBA 3SOWA 2JMJA 2M6MA 3RPGC 5D26A 5I86A 4NN2A 4YC9A 5CS8A 1WEEA 4A4CA 4FLPA 2RNWA 5FB0A 4TTEA 4TYLA 5C87A 4XY9A 4NQNA 5DW1A 2D8UA 4YYHA 4NR9A 4Y03A 5KU3A 2KREA 4CL9A 5C85A 4BW2A 5CQTA 2MA5A 4DONA 4OGJA 5TBNA 2LAUA 3MB3A 5B77A 3S92A 2VJEA 2R10A 5FE1A 2MNYA 5EICA 4AKHA 5FERA 3ZPVE 4O77A 3JVLA 5F1HA 5FDZA 4YYNA 2C2VS 5A5OA 3FANA 2CKLA 2OSSA 5EWVA 4NUEA 4YBMA 3ZNIA 5H1TA 3P1FA 4WHUA 3KDEC 2LGKA 4BW4A 5LKXA 4UP5A 5F5ZA 5J0DA 4NYWA 5IG6A 2DVSA 1WESA 4BW3A 3GG3A 2YURA 5FE3A 3KV5A 4KCXA 2GRCA 4PY6A 3Q2EA 5FH7A
chains in the Genus database with same CATH topology
4NR5A 4HXNA 2K1JA 4OUFA 5C8GA 2RSDA 4S3OB 5F62A 4V3KC 5KH9A 1WEWA 4ZQLA 5KHMA 4YYGA 5D3PA 5HQ7A 4YYJA 5D3SA 5BT5A 1VFYA 1Z6UA 5E0RA 1N72A 5EA1A 3ZPV1 3ZYQA 3JVMA 3P5OA 2KGGA 2N9GA 3DAIA 2LV9A 2E3KA 3LJWA 5DKDA 1DVPA 2LGLA 2WP1A 5FFYA 3MQMA 3RPGB 5D3NA 2L84A 4LRGA 2Y1NA 2KWKA 3MB4A 4QC3A 2OUOA 3L1ZB 3NG2A 5HFRA 4QSXA 1JM7B 5D0CA 3N9QA 1ZS5A 4YH3A 4BW1A 2LGVA 1F68A 4TT2A 5EP7A 2QIZA 2MA6A 5A5NA 5E74A 5EPBA 5CQAA 5JWMA 3U5KA 5JG6A 3JVKA 5A83A 2MT5A 2DVQA 5DLZA 5FEYA 1U6GB 3UV2A 4CUUA 3RCWA 1T1HA 5HFQA 2LN0A 2DWWA 4IR6A 5HEMA 3O33A 4LYWA 4O71A 5K29A 4X3GA 2E7OA 5CQ7A 2D9EA 5ENGA 5LJ0A 2HDPA 3C5KA 5KH7A 2MUMA 4BBQA 3UV5A 2L80A 4QC1A 3IHPA 4B86C 5ENEA 1WILA 5LVRA 5DY7A 4B7YC 2LDRA 4QR4A 4LZRA 2YYRA 4FJCA 2DATA 4AYCB 5D3LA 5D7XA 4WIVA 5LCWB 2KGIA 4YYMA 5IGLA 5D25A 5DW2A 5FG4A 5LUUA 4QSQA 5TABA 4X2IA 5FE0A 5CU8A 2MJVB 4HXPA 4V3LC 5I3LA 1WGMA 1F62A 5EWHA 2PUYA 3ZVZB 4ZDTA 3ONIA 2DVVA 5F60A 1JM7A 4A9HA 4A9LA 2G6QA 4GPJA 4Q0OA 5H1UA 3HMEA 4MEPA 5A85A 4MR6A 5F2PA 2DVRA 5CQ8A 4UYGA 2ECWA 5D1MB 5DKAA 4N4FA 5EGUA 4C9ZA 3AADA 1XWHA 5DFBA 2KU3A 4ZUXU 4QY4A 1X4UA 2YEMA 4N4HA 4PS5A 5B75A 4XUBA 5AIUA 3QZTA 5G04B 4UIYA 4N3WA 4O7BA 4NXJA 5FBXA 4YADA 3HCSA 4IR5A 4N4IA 5ENJA 2M85A 2D82A 2I8NA 4A9OA 4IORA 4UIWA 5TRBA 4O7FA 2H60A 3KNVA 4ALGA 4YK0A 5LJ2A 1WIMA 5AD3A 1LDKC 3U5NA 1Z2QA 3NXBA 4PKLA 4YABA 1MM3A 5A5QA 5DBMA 4A49A 4IC3A 4NR6A 5F1LA 4A9KA 4WHWA 2M1RA 3HMFA 5ACYA 2RS9B 5I89A 2K16A 2YQLA 3L11A 5HRWA 2F42A 4TZ2A 4C67A 4UIZA 2KWOA 5I80A 3I2DA 5BT4A 5II2A 2CT2A 4YY4A 5B76A 5CUGA 3PUQA 2HYED 4CA1A 4NRBA 5E9KA 4LYSA 4YY6A 5EISA 4O74A 4QSWA 4UYEA 2F6JA 4ALHA 5DKCA 2RNYA 3RTRB 5FB1A 1BORA 1X4IA 5CRZA 2YREA 5F63A 1LDJB 3T6RA 4R8PK 3EB5A 4CFKA 2LSPB 4O75A 4PCIA 5LJ1A 2I50A 4CCGX 2LGGA 5IGKA 5CQ6A 5E3GA 3FKMX 4Z6IA 1ZBDB 5F25A 1WEQA 4NRCA 5ENFA 3HCUA 3U5PA 4QZSA 3P1EA 2YSJA 5KTXA 1RMDA 4I7BA 5CQ4A 4TZ8A 5E9LA 4A9IA 4LYIA 3O37A 5DYAA 4Q6FA 4CUTA 3EB6A 3LXJA 4IR4A 4AVXA 2FSAA 5I7XA 4QR5A 3S91A 4PPEA 2JMDA 1G25A 2EGPA 4UIUA 2MIQA 4QEVA 5DYCA 5G4SA 4O72A 1JOCA 3SOUA 2M3HA 4O7EA 2FUIA 1K2FA 5H85A 4HBYA 1E6IA 5CUCA 3N9LA 4NUCA 3SVFA 4CUPA 5L98A 5A5RA 4QEWA 4YBTA 4GB0A 5L96A 4UYHA 5D3RA 3N9PA 2MD8C 4UITA 5F61A 2XEUA 4FK5A 5G0FA 5E9IA 5E9MA 3P1CA 5KO4A 2FUUA 5EYAF 3JVJA 2YU4A 3O70A 4QSSA 4J0SA 5CQ5A 4Z6HA 4A9NA 5FE9A 3U5OA 2DKWA 2ECNA 2VPGA 3ZTGA 3K2JA 4QSVA 4TKPB 5HJCA 5COIA 5IIDA 3VK6A 3MXFA 5EI4A 4J3IA 4I7CA 2NAAA 2LXPC 4O76A 1WENA 3DQVR 5I83A 3MHHA 3LQJA 3P1DA 5D3TA 2PNXA 2KE1A 2YELA 3O34A 2RFJA 4YATA 4MR5A 5IGMA 4AYCA 5ENCA 2EODA 4AKNA 5HM0A 4I7DA 4AP4A 2YW5A 4E96A 4YBSA 2C2LA 4MR4A 3ASLA 3U5MA 5HELA 3UVWA 5FE2A 4TT4A 4WA6A 5TCMA 5CQ3A 5FE7A 3D7CA 2WP2A 4O64A 4UP0A 4QSTA 1EQFA 3T7LA 2YW8A 2JMIA 3I3JA 2RNXA 4O7AA 3KV6A 4HXLA 4IOOA 5E3DA 5FE6A 5TDWA 4L58A 2YHNA 2R0VA 4UI9B 4LK9A 5A5PA 4HXKA 4N4GA 4TS8A 5HENA 5L97A 5J3XA 5L8UA 4TU4A 5EQ1A 5D3HA 3PHDA 5EVAA 4YYDA 2DX8A 2BAYA 3G0LA 5H1VA 4A9MA 4NQMA 4QR3A 2L5UA 2E7NA 1VYXA 5ENHA 4A9JA 1FP0A 4R7EA 3SOXA 4F52B 2XB1A 2OO1A 2KWJA 2K17A 4CUQA 4NR8A 2CKLB 4PTBA 5ENIA 4ZC9A 5E9VA 5E9YA 5CUBA 1E4UA 3LQHA 4WZ3B 5EM3A 5A5SA 2VJEB 4XY8A 5DFDA 5EWCA 5EWWA 4QBMA 2KWNA 4UIXA 5A7CA 4GNFA 4QUUA 1V87A 4HXRA 4ZW1A 5FFVA 5TB6A 4LLBA 4Q0NA 4KV1A 2ZETC 3AQAA 4IC2A 2QJ0A 2VPDA 2VJFA 2G4AA 2ECJA 5CY9A 5C4QA 3Q2FA 5I29A 3IU6A 4QSUA 4FIPA 4LKAA 4QF3A 1WUMA 5HLSA 5CUDA 2Y43A 4QEUA 3L1XA 3M99A 5F3AA 4R2YA 1WEMA 4QF2A 5G05B 5H9MA 5FFWA 4YH4A 3UW9A 5LKZA 2KYUA 1VD4A 4O70A 5HQ5A 3U5JA 2IDAA 3UVYA 3LQIA 3DWYA 3FL2A 2MD7B 5BT3A 1FBVA 5ETDA 5I88A 5KTWA 2AN6A 2VPBA 4YYIA 5DYUA 5I7YA 3HCTA 5ETBA 2VPEA 4NYXA 5C89A 4XI1A 1CHCA 2G43A 4O78A 5A82A 5FH6A 3ZYUA 2E6SA 2OXQC 4A9EA 5LVQA 2R0SA 3SVHA 5B8DA 3ZVYA 4FO9A 5B78A 5CPEA 4MEOA 4YYKA 1IYMA 5HCLA 3O36A 5HRXA 2I7KA 3MHSA 3UVDA 3N9MA 1N87A 5LKUA 1Z60A 3SVGA 2VP7A 5FE5A 4QUTA 4MEQA 4QB3A 5TDRA 3SHBA 5CUEA 2G45A 5DFCA 2YHOA 2RI7A 5E7DA 3IU5A 5CUAA 4GNEA 2NXBA 2CSZA 5II1A 5L8TA 4CLBA 5A81A 4XUAA 2L43A 5AMEA 5JI8A 2KR4A 3M63A 4Z93A 5I1QA 4NR7A 4IOQA 4A0CD 4UYDA 4IR3A 2H0DB 4QSRA 2JRJA 3QZSA 2KIZA 2KTBB 3DPLR 4BHWA 4LJNA 1JSPB 4PCEA 2YDWA 2LXHC 1X0JA 1WEOA 4HXMA 5LKTA 5CGPA 2YUCA 5CZGA 4HXOA 4S3OC 5DYXA 5EWDA 2YQDA 5DINA 5AITA 2RO1A 3G0JA 2KFTA 4NS5A 5KTUA 5D1KB 1MM2A 5D1LB 5EK9A 4LDFA 4CURA 5C11A 2ECTA 5KH3A 4UYFB 3MULA 2MNZA 3KQIA 5E73A 3U5LA 2L5EA 3GL6A 5ENBA 4QNSA 2D8SA 4AUQB 5CP5A 4KV4A 2QICA 2UZGA 2VJFB 3M62A 4NYVA 3QZVA 5FE4A 4C66A 2YT5A 3N9OA 2LQ6A 1HYIA 5L99A 5F36A 2E6RA 4CUSA 2Y1MA 1WE9A 2ECIA 3LRQA 4LR6A 4Z1QA 5D24A 5C7NA 4HBXA 5FH8A 2YEKA 1HYJA 5G4RA 4L7XA 4MR3A 4BJXA 4QSPA 5I40A 4GNGA 2L85A 4RVRA 5CFWA 5IGNA 4NRAA 5CRMA 4HXSA 4MSXA 3MUKA 4TQNA 5EU1A 4NR4A 1WEPA 5DLXA 4OGIA 5C13A 4HBVA 5FE8A 2EA6A 4NUDA 3C6WA 3UV4A 4P5OB 3UVXA 2L0BA 4CFLA 5AMFA 2LRIC 2K4DA 4LZSA 4XYAA 4J0RA 4WZ2A 2F6NA 5CTLA 2ECGA 5FG6A 3O7AA 2H0DA 4J1PA 5EV9A 2ECVA 4LADB 4GNDA 5D3JA 2L75A 3PURA 1WEUA 4HBWA 4Z1SA 4O7CA 2YYNA 5AD2A 4TU6A 2CSYA 2YSMA 3HTKC 5IBNA 2VNFA 5HQ6A 3O35A 5DKHA 5DX4A 4F3IA 4UIVA 5FG5A 1WFKA 5EPSA 1X4JA 4TT6A 3HMHA 3V43A 4UYFA 4YAXA 4LZ2A 5HRVA 1JM4B 4A4BA 2R0YA 4MENA 5EPRA 4WZ0A 3N9NA 3TLPA 2YQMA 1WEVA 4A9FA 4QYLA 5B79A 4W4UA 1WUGA 4QYDA 3GV4A 4LC2A 4MVTA 3SOWA 2JMJA 2M6MA 3RPGC 5D26A 5I86A 4NN2A 4YC9A 5CS8A 1WEEA 4A4CA 4FLPA 2RNWA 5FB0A 4TTEA 4TYLA 5C87A 4XY9A 4NQNA 5DW1A 4YYHA 4NR9A 4Y03A 5KU3A 2KREA 4CL9A 5C85A 4BW2A 5CQTA 2MA5A 4DONA 4OGJA 5TBNA 3MB3A 5B77A 3S92A 2VJEA 2R10A 5FE1A 2MNYA 5EICA 5FERA 3ZPVE 4O77A 3JVLA 5F1HA 5FDZA 4YYNA 2C2VS 5A5OA 2CKLA 2OSSA 5EWVA 4NUEA 4YBMA 3ZNIA 5H1TA 3P1FA 4WHUA 2LGKA 4BW4A 5LKXA 4UP5A 5F5ZA 5J0DA 4NYWA 5IG6A 2DVSA 1WESA 4BW3A 3GG3A 2YURA 5FE3A 3KV5A 4KCXA 2GRCA 4PY6A 3Q2EA 5FH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NR5 A;  4HXN A;  2K1J A;  4OUF A;  5C8G A;  2RSD A;  4S3O B;  5F62 A;  4V3K C;  5KH9 A;  1WEW A;  4ZQL A;  5KHM A;  4YYG A;  5D3P A;  5HQ7 A;  4YYJ A;  5D3S A;  5BT5 A;  1VFY A;  1Z6U A;  5E0R A;  1N72 A;  5EA1 A;  3ZPV 1;  3ZYQ A;  3JVM A;  3P5O A;  2KGG A;  2N9G A;  3DAI A;  2LV9 A;  2E3K A;  3LJW A;  5DKD A;  1DVP A;  2LGL A;  2WP1 A;  5FFY A;  3MQM A;  3RPG B;  5D3N A;  2L84 A;  4LRG A;  2Y1N A;  2KWK A;  3MB4 A;  4QC3 A;  2OUO A;  3L1Z B;  3NG2 A;  5HFR A;  4QSX A;  1JM7 B;  5D0C A;  3N9Q A;  1ZS5 A;  4YH3 A;  4BW1 A;  2LGV A;  1F68 A;  4TT2 A;  5EP7 A;  2QIZ A;  2MA6 A;  5A5N A;  5E74 A;  5EPB A;  5CQA A;  5JWM A;  3U5K A;  5JG6 A;  3JVK A;  5A83 A;  2MT5 A;  2DVQ A;  5DLZ A;  5FEY A;  1U6G B;  3UV2 A;  4CUU A;  3RCW A;  1T1H A;  5HFQ A;  2LN0 A;  2DWW A;  4IR6 A;  5HEM A;  3O33 A;  4LYW A;  4O71 A;  5K29 A;  4X3G A;  2E7O A;  5CQ7 A;  2D9E A;  5ENG A;  5LJ0 A;  2HDP A;  3C5K A;  5KH7 A;  2MUM A;  4BBQ A;  3UV5 A;  2L80 A;  4QC1 A;  3IHP A;  4B86 C;  5ENE A;  1WIL A;  5LVR A;  5DY7 A;  4B7Y C;  2LDR A;  4QR4 A;  4LZR A;  2YYR A;  4FJC A;  2DAT A;  4AYC B;  5D3L A;  5D7X A;  4WIV A;  5LCW B;  2KGI A;  4YYM A;  5IGL A;  5D25 A;  5DW2 A;  5FG4 A;  5LUU A;  4QSQ A;  5TAB A;  4X2I A;  5FE0 A;  5CU8 A;  2MJV B;  4HXP A;  4V3L C;  5I3L A;  1WGM A;  1F62 A;  5EWH A;  2PUY A;  3ZVZ B;  4ZDT A;  3ONI A;  2DVV A;  5F60 A;  1JM7 A;  4A9H A;  4A9L A;  2G6Q A;  4GPJ A;  4Q0O A;  5H1U A;  3HME A;  4MEP A;  5A85 A;  4MR6 A;  5F2P A;  2DVR A;  5CQ8 A;  4UYG A;  2ECW A;  5D1M B;  5DKA A;  4N4F A;  5EGU A;  4C9Z A;  3AAD A;  1XWH A;  5DFB A;  2KU3 A;  4ZUX U;  4QY4 A;  1X4U A;  2YEM A;  4N4H A;  4PS5 A;  5B75 A;  4XUB A;  5AIU A;  3QZT A;  5G04 B;  4UIY A;  4N3W A;  4O7B A;  4NXJ A;  5FBX A;  4YAD A;  3HCS A;  4IR5 A;  4N4I A;  5ENJ A;  2M85 A;  2D82 A;  2I8N A;  4A9O A;  4IOR A;  4UIW A;  5TRB A;  4O7F A;  2H60 A;  3KNV A;  4ALG A;  4YK0 A;  5LJ2 A;  1WIM A;  5AD3 A;  1LDK C;  3U5N A;  1Z2Q A;  3NXB A;  4PKL A;  4YAB A;  1MM3 A;  5A5Q A;  5DBM A;  4A49 A;  4IC3 A;  4NR6 A;  5F1L A;  4A9K A;  4WHW A;  2M1R A;  3HMF A;  5ACY A;  2RS9 B;  5I89 A;  2K16 A;  2YQL A;  3L11 A;  5HRW A;  2F42 A;  4TZ2 A;  4C67 A;  4UIZ A;  2KWO A;  5I80 A;  3I2D A;  5BT4 A;  5II2 A;  2CT2 A;  4YY4 A;  5B76 A;  5CUG A;  3PUQ A;  2HYE D;  4CA1 A;  4NRB A;  5E9K A;  4LYS A;  4YY6 A;  5EIS A;  4O74 A;  4QSW A;  4UYE A;  2F6J A;  4ALH A;  5DKC A;  2RNY A;  3RTR B;  5FB1 A;  1BOR A;  1X4I A;  5CRZ A;  2YRE A;  5F63 A;  1LDJ B;  3T6R A;  4R8P K;  3EB5 A;  4CFK A;  2LSP B;  4O75 A;  4PCI A;  5LJ1 A;  2I50 A;  4CCG X;  2LGG A;  5IGK A;  5CQ6 A;  5E3G A;  3FKM X;  4Z6I A;  1ZBD B;  5F25 A;  1WEQ A;  4NRC A;  5ENF A;  3HCU A;  3U5P A;  4QZS A;  3P1E A;  2YSJ A;  5KTX A;  1RMD A;  4I7B A;  5CQ4 A;  4TZ8 A;  5E9L A;  4A9I A;  4LYI A;  3O37 A;  5DYA A;  4Q6F A;  4CUT A;  3EB6 A;  3LXJ A;  4IR4 A;  4AVX A;  2FSA A;  5I7X A;  4QR5 A;  3S91 A;  4PPE A;  2JMD A;  1G25 A;  2EGP A;  4UIU A;  2MIQ A;  4QEV A;  5DYC A;  5G4S A;  4O72 A;  1JOC A;  3SOU A;  2M3H A;  4O7E A;  2FUI A;  1K2F A;  5H85 A;  4HBY A;  1E6I A;  5CUC A;  3N9L A;  4NUC A;  3SVF A;  4CUP A;  5L98 A;  5A5R A;  4QEW A;  4YBT A;  4GB0 A;  5L96 A;  4UYH A;  5D3R A;  3N9P A;  2MD8 C;  4UIT A;  5F61 A;  2XEU A;  4FK5 A;  5G0F A;  5E9I A;  5E9M A;  3P1C A;  5KO4 A;  2FUU A;  5EYA F;  3JVJ A;  2YU4 A;  3O70 A;  4QSS A;  4J0S A;  5CQ5 A;  4Z6H A;  4A9N A;  5FE9 A;  3U5O A;  2DKW A;  2ECN A;  2VPG A;  3ZTG A;  3K2J A;  4QSV A;  4TKP B;  5HJC A;  5COI A;  5IID A;  3VK6 A;  3MXF A;  5EI4 A;  4J3I A;  4I7C A;  2NAA A;  2LXP C;  4O76 A;  1WEN A;  3DQV R;  5I83 A;  3MHH A;  3LQJ A;  3P1D A;  5D3T A;  2PNX A;  2KE1 A;  2YEL A;  3O34 A;  2RFJ A;  4YAT A;  4MR5 A;  5IGM A;  4AYC A;  5ENC A;  2EOD A;  4AKN A;  5HM0 A;  4I7D A;  4AP4 A;  2YW5 A;  4E96 A;  4YBS A;  2C2L A;  4MR4 A;  3ASL A;  3U5M A;  5HEL A;  3UVW A;  5FE2 A;  4TT4 A;  4WA6 A;  5TCM A;  5CQ3 A;  5FE7 A;  3D7C A;  2WP2 A;  4O64 A;  4UP0 A;  4QST A;  1EQF A;  3T7L A;  2YW8 A;  2JMI A;  3I3J A;  2RNX A;  4O7A A;  3KV6 A;  4HXL A;  4IOO A;  5E3D A;  5FE6 A;  5TDW A;  4L58 A;  2YHN A;  2R0V A;  4UI9 B;  4LK9 A;  5A5P A;  4HXK A;  4N4G A;  4TS8 A;  5HEN A;  5L97 A;  5J3X A;  5L8U A;  4TU4 A;  5EQ1 A;  5D3H A;  3PHD A;  5EVA A;  4YYD A;  2DX8 A;  2BAY A;  3G0L A;  5H1V A;  4A9M A;  4NQM A;  4QR3 A;  2L5U A;  2E7N A;  1VYX A;  5ENH A;  4A9J A;  1FP0 A;  4R7E A;  3SOX A;  4F52 B;  2XB1 A;  2OO1 A;  2KWJ A;  2K17 A;  4CUQ A;  4NR8 A;  2CKL B;  4PTB A;  5ENI A;  4ZC9 A;  5E9V A;  5E9Y A;  5CUB A;  1E4U A;  3LQH A;  4WZ3 B;  5EM3 A;  5A5S A;  2VJE B;  4XY8 A;  5DFD A;  5EWC A;  5EWW A;  4QBM A;  2KWN A;  4UIX A;  5A7C A;  4GNF A;  4QUU A;  1V87 A;  4HXR A;  4ZW1 A;  5FFV A;  5TB6 A;  4LLB A;  4Q0N A;  4KV1 A;  2ZET C;  3AQA A;  4IC2 A;  2QJ0 A;  2VPD A;  2VJF A;  2G4A A;  2ECJ A;  5CY9 A;  5C4Q A;  3Q2F A;  5I29 A;  3IU6 A;  4QSU A;  4FIP A;  4LKA A;  4QF3 A;  1WUM A;  5HLS A;  5CUD A;  2Y43 A;  4QEU A;  3L1X A;  3M99 A;  5F3A A;  4R2Y A;  1WEM A;  4QF2 A;  5G05 B;  5H9M A;  5FFW A;  4YH4 A;  3UW9 A;  5LKZ A;  2KYU A;  1VD4 A;  4O70 A;  5HQ5 A;  3U5J A;  2IDA A;  3UVY A;  3LQI A;  3DWY A;  3FL2 A;  2MD7 B;  5BT3 A;  1FBV A;  5ETD A;  5I88 A;  5KTW A;  2AN6 A;  2VPB A;  4YYI A;  5DYU A;  5I7Y A;  3HCT A;  5ETB A;  2VPE A;  4NYX A;  5C89 A;  4XI1 A;  1CHC A;  2G43 A;  4O78 A;  5A82 A;  5FH6 A;  3ZYU A;  2E6S A;  2OXQ C;  4A9E A;  5LVQ A;  2R0S A;  3SVH A;  5B8D A;  3ZVY A;  4FO9 A;  5B78 A;  5CPE A;  4MEO A;  4YYK A;  1IYM A;  5HCL A;  3O36 A;  5HRX A;  2I7K A;  3MHS A;  3UVD A;  3N9M A;  1N87 A;  5LKU A;  1Z60 A;  3SVG A;  2VP7 A;  5FE5 A;  4QUT A;  4MEQ A;  4QB3 A;  5TDR A;  3SHB A;  5CUE A;  2G45 A;  5DFC A;  2YHO A;  2RI7 A;  5E7D A;  3IU5 A;  5CUA A;  4GNE A;  2NXB A;  2CSZ A;  5II1 A;  5L8T A;  4CLB A;  5A81 A;  4XUA A;  2L43 A;  5AME A;  5JI8 A;  2KR4 A;  3M63 A;  4Z93 A;  5I1Q A;  4NR7 A;  4IOQ A;  4A0C D;  4UYD A;  4IR3 A;  2H0D B;  4QSR A;  2JRJ A;  3QZS A;  2KIZ A;  2KTB B;  3DPL R;  4BHW A;  4LJN A;  1JSP B;  4PCE A;  2YDW A;  2LXH C;  1X0J A;  1WEO A;  4HXM A;  5LKT A;  5CGP A;  2YUC A;  5CZG A;  4HXO A;  4S3O C;  5DYX A;  5EWD A;  2YQD A;  5DIN A;  5AIT A;  2RO1 A;  3G0J A;  2KFT A;  4NS5 A;  5KTU A;  5D1K B;  1MM2 A;  5D1L B;  5EK9 A;  4LDF A;  4CUR A;  5C11 A;  2ECT A;  5KH3 A;  4UYF B;  3MUL A;  2MNZ A;  3KQI A;  5E73 A;  3U5L A;  2L5E A;  3GL6 A;  5ENB A;  4QNS A;  2D8S A;  4AUQ B;  5CP5 A;  4KV4 A;  2QIC A;  2UZG A;  2VJF B;  3M62 A;  4NYV A;  3QZV A;  5FE4 A;  4C66 A;  2YT5 A;  3N9O A;  2LQ6 A;  1HYI A;  5L99 A;  5F36 A;  2E6R A;  4CUS A;  2Y1M A;  1WE9 A;  2ECI A;  3LRQ A;  4LR6 A;  4Z1Q A;  5D24 A;  5C7N A;  4HBX A;  5FH8 A;  2YEK A;  1HYJ A;  5G4R A;  4L7X A;  4MR3 A;  4BJX A;  4QSP A;  5I40 A;  4GNG A;  2L85 A;  4RVR A;  5CFW A;  5IGN A;  4NRA A;  5CRM A;  4HXS A;  4MSX A;  3MUK A;  4TQN A;  5EU1 A;  4NR4 A;  1WEP A;  5DLX A;  4OGI A;  5C13 A;  4HBV A;  5FE8 A;  2EA6 A;  4NUD A;  3C6W A;  3UV4 A;  4P5O B;  3UVX A;  2L0B A;  4CFL A;  5AMF A;  2LRI C;  2K4D A;  4LZS A;  4XYA A;  4J0R A;  4WZ2 A;  2F6N A;  5CTL A;  2ECG A;  5FG6 A;  3O7A A;  2H0D A;  4J1P A;  5EV9 A;  2ECV A;  4LAD B;  4GND A;  5D3J A;  2L75 A;  3PUR A;  1WEU A;  4HBW A;  4Z1S A;  4O7C A;  2YYN A;  5AD2 A;  4TU6 A;  2CSY A;  2YSM A;  3HTK C;  5IBN A;  2VNF A;  5HQ6 A;  3O35 A;  5DKH A;  5DX4 A;  4F3I A;  4UIV A;  5FG5 A;  1WFK A;  5EPS A;  1X4J A;  4TT6 A;  3HMH A;  3V43 A;  4UYF A;  4YAX A;  4LZ2 A;  5HRV A;  1JM4 B;  4A4B A;  2R0Y A;  4MEN A;  5EPR A;  4WZ0 A;  3N9N A;  3TLP A;  2YQM A;  1WEV A;  4A9F A;  4QYL A;  5B79 A;  4W4U A;  1WUG A;  4QYD A;  3GV4 A;  4LC2 A;  4MVT A;  3SOW A;  2JMJ A;  2M6M A;  3RPG C;  5D26 A;  5I86 A;  4NN2 A;  4YC9 A;  5CS8 A;  1WEE A;  4A4C A;  4FLP A;  2RNW A;  5FB0 A;  4TTE A;  4TYL A;  5C87 A;  4XY9 A;  4NQN A;  5DW1 A;  4YYH A;  4NR9 A;  4Y03 A;  5KU3 A;  2KRE A;  4CL9 A;  5C85 A;  4BW2 A;  5CQT A;  2MA5 A;  4DON A;  4OGJ A;  5TBN A;  3MB3 A;  5B77 A;  3S92 A;  2VJE A;  2R10 A;  5FE1 A;  2MNY A;  5EIC A;  5FER A;  3ZPV E;  4O77 A;  3JVL A;  5F1H A;  5FDZ A;  4YYN A;  2C2V S;  5A5O A;  2CKL A;  2OSS A;  5EWV A;  4NUE A;  4YBM A;  3ZNI A;  5H1T A;  3P1F A;  4WHU A;  2LGK A;  4BW4 A;  5LKX A;  4UP5 A;  5F5Z A;  5J0D A;  4NYW A;  5IG6 A;  2DVS A;  1WES A;  4BW3 A;  3GG3 A;  2YUR A;  5FE3 A;  3KV5 A;  4KCX A;  2GRC A;  4PY6 A;  3Q2E A;  5FH7 A; 
#chains in the Genus database with same CATH topology
 4NR5 A;  4HXN A;  2K1J A;  4OUF A;  5C8G A;  2RSD A;  4S3O B;  5F62 A;  4V3K C;  5KH9 A;  1WEW A;  4ZQL A;  5KHM A;  4YYG A;  5D3P A;  5HQ7 A;  4YYJ A;  5D3S A;  5BT5 A;  1VFY A;  1Z6U A;  5E0R A;  1N72 A;  5EA1 A;  2DJA A;  3ZPV 1;  3ZYQ A;  3JVM A;  3P5O A;  2KGG A;  2N9G A;  3DAI A;  2LV9 A;  3D1D A;  3H7H A;  2E3K A;  3LJW A;  5DKD A;  1DVP A;  4AKG A;  2LGL A;  2WP1 A;  5FFY A;  3MQM A;  3RPG B;  5D3N A;  2L84 A;  4LRG A;  2Y1N A;  2KWK A;  3MB4 A;  4QC3 A;  2OUO A;  3L1Z B;  2JUN A;  3NG2 A;  5HFR A;  3FAO A;  4QSX A;  1JM7 B;  5D0C A;  3N9Q A;  1ZS5 A;  4YH3 A;  4BW1 A;  2LGV A;  1F68 A;  4TT2 A;  5EP7 A;  2CRR A;  2QIZ A;  2MA6 A;  5A5N A;  5E74 A;  5EPB A;  5CQA A;  5JWM A;  3U5K A;  5JG6 A;  3JVK A;  5A83 A;  2MT5 A;  2DVQ A;  5DLZ A;  5FEY A;  1U6G B;  1MBM A;  3UV2 A;  1ZKR A;  4CUU A;  3RCW A;  1T1H A;  5HFQ A;  2LN0 A;  2DWW A;  4IR6 A;  5HEM A;  3O33 A;  4LYW A;  4O71 A;  5K29 A;  4X3G A;  2E7O A;  5CQ7 A;  2B0O E;  2D9E A;  5ENG A;  5LJ0 A;  2HDP A;  3C5K A;  5KH7 A;  2MUM A;  4BBQ A;  3UV5 A;  2L80 A;  4QC1 A;  3IHP A;  4B86 C;  3T9K A;  5ENE A;  1WIL A;  5LVR A;  5DY7 A;  4B7Y C;  2LDR A;  4Z0O A;  4QR4 A;  4LZR A;  2YYR A;  4FJC A;  2DAT A;  4AYC B;  5D3L A;  5D7X A;  4WIV A;  5LCW B;  2KGI A;  4YYM A;  5IGL A;  5D25 A;  5DW2 A;  5FG4 A;  2EJN A;  4QSQ A;  5LUU A;  5TAB A;  4X2I A;  5FE0 A;  5CU8 A;  2MJV B;  4HXP A;  4V3L C;  5I3L A;  5SVX A;  1WGM A;  1F62 A;  5EWH A;  2PUY A;  3ZVZ B;  4ZDT A;  3ONI A;  2DVV A;  5F60 A;  1JM7 A;  4A9H A;  4A9L A;  2G6Q A;  4GPJ A;  4Q0O A;  5H1U A;  3HME A;  4MEP A;  5A85 A;  4O62 A;  4MR6 A;  5F2P A;  2DVR A;  5CQ8 A;  3LDY A;  4UYG A;  2ECW A;  5D1M B;  5DKA A;  4N4F A;  5EGU A;  4C9Z A;  3AAD A;  1XWH A;  5DFB A;  2KU3 A;  4ZUX U;  4QY4 A;  1X4U A;  2YEM A;  4N4H A;  4PS5 A;  5B75 A;  4XUB A;  5AIU A;  3QZT A;  5G04 B;  4UIY A;  4N3W A;  4O7B A;  4NXJ A;  2YVR A;  5FBX A;  4YAD A;  3HCS A;  4IR5 A;  4N4I A;  5ENJ A;  2M85 A;  3LJU X;  2D82 A;  2I8N A;  4A9O A;  4IOR A;  4UIW A;  5TRB A;  4O7F A;  2H60 A;  3KNV A;  4ALG A;  4YK0 A;  1DCQ A;  5LJ2 A;  1WIM A;  5AD3 A;  1LDK C;  3U5N A;  1Z2Q A;  3NXB A;  4OGE A;  4PKL A;  4YAB A;  1MM3 A;  5A5Q A;  5DBM A;  4A49 A;  4IC3 A;  3LVQ E;  4NR6 A;  5F1L A;  4A9K A;  4WHW A;  2M1R A;  3HMF A;  5ACY A;  2RS9 B;  5I89 A;  2K16 A;  2YQL A;  3L11 A;  5HRW A;  2F42 A;  4TZ2 A;  4C67 A;  4UIZ A;  2KWO A;  5I80 A;  3I2D A;  5BT4 A;  5II2 A;  2CT2 A;  3MDB C;  4YY4 A;  5B76 A;  5CUG A;  3PUQ A;  2HYE D;  4CA1 A;  3M7K A;  4NRB A;  5E9K A;  4LYS A;  4YY6 A;  5EIS A;  4O74 A;  4QSW A;  4UYE A;  2F6J A;  4ALH A;  5DKC A;  2RNY A;  3RTR B;  5FB1 A;  1BOR A;  1X4I A;  5CRZ A;  2XP0 A;  2YRE A;  5F63 A;  1LDJ B;  3T6R A;  4R8P K;  3EB5 A;  2CRW A;  4CFK A;  2LSP B;  4O75 A;  4PCI A;  5LJ1 A;  2I50 A;  4CCG X;  2LGG A;  5IGK A;  5CQ6 A;  5E3G A;  3E2D A;  3FKM X;  4Z6I A;  5SVI B;  1ZBD B;  5F25 A;  1WEQ A;  4NRC A;  5ENF A;  3HCU A;  3U5P A;  4QZS A;  2XOC A;  3P1E A;  2YSJ A;  5KTX A;  1RMD A;  4I7B A;  5CQ4 A;  4TZ8 A;  5E9L A;  4A9I A;  4LYI A;  3O37 A;  5DYA A;  4Q6F A;  4CUT A;  3EB6 A;  3LXJ A;  4IR4 A;  4AVX A;  2FSA A;  5I7X A;  4QR5 A;  3S91 A;  4PPE A;  2JMD A;  3FM8 C;  1G25 A;  2EGP A;  4UIU A;  2MIQ A;  4QEV A;  5DYC A;  5G4S A;  4O72 A;  1JOC A;  3SOU A;  2M3H A;  4O7E A;  2FUI A;  1K2F A;  5H85 A;  4HBY A;  1E6I A;  5CUC A;  3N9L A;  4NUC A;  3SVF A;  4CUP A;  5L98 A;  5A5R A;  4QEW A;  4YBT A;  4GB0 A;  5L96 A;  4UYH A;  5D3R A;  3N9P A;  3ERR A;  2MD8 C;  4UIT A;  2CSV A;  5F61 A;  2XEU A;  4FK5 A;  5G0F A;  5E9I A;  5E9M A;  3P1C A;  5KO4 A;  2FUU A;  5EYA F;  3JVJ A;  2YU4 A;  3O70 A;  4QSS A;  4J0S A;  5CQ5 A;  4Z6H A;  4A9N A;  5FE9 A;  3U5O A;  3FEH A;  2DKW A;  2ECN A;  2VPG A;  3ZTG A;  3K2J A;  5SVI A;  2XOZ A;  4QSV A;  4TKP B;  2KKX A;  5HJC A;  5COI A;  5IID A;  3VK6 A;  3MXF A;  5EI4 A;  4J3I A;  4I7C A;  2NAA A;  2LXP C;  4O76 A;  1WEN A;  3DQV R;  5I83 A;  3MHH A;  3LQJ A;  3P1D A;  5D3T A;  2PNX A;  2KE1 A;  2YEL A;  3O34 A;  3PLW A;  2RFJ A;  4YAT A;  4MR5 A;  5IGM A;  4AYC A;  5ENC A;  2EOD A;  4AKN A;  3FJU B;  5HM0 A;  4I7D A;  4AP4 A;  2YW5 A;  4E96 A;  4YBS A;  2C2L A;  4MR4 A;  2L7P A;  3ASL A;  3U5M A;  5HEL A;  3UVW A;  5FE2 A;  4TT4 A;  4WA6 A;  5TCM A;  5SVY A;  5CQ3 A;  5FE7 A;  3D7C A;  2WP2 A;  4O64 A;  4UP0 A;  4QST A;  1EQF A;  3T7L A;  2YW8 A;  2JMI A;  3I3J A;  2RNX A;  4O7A A;  3KV6 A;  4HXL A;  4IOO A;  5E3D A;  5FE6 A;  2OWA A;  4L58 A;  2YHN A;  2R0V A;  4UI9 B;  4LK9 A;  5TDW A;  5A5P A;  4HXK A;  4N4G A;  4TS8 A;  5HEN A;  5L97 A;  5J3X A;  5L8U A;  4TU4 A;  5EQ1 A;  5D3H A;  3PHD A;  3VKG A;  5EVA A;  4YYD A;  2DX8 A;  2BAY A;  3G0L A;  5H1V A;  4A9M A;  4NQM A;  4QR3 A;  2L5U A;  2E7N A;  1VYX A;  5ENH A;  4A9J A;  1FP0 A;  4R7E A;  3SOX A;  4F52 B;  2XB1 A;  2OO1 A;  2KWJ A;  2K17 A;  4CUQ A;  4NR8 A;  2CKL B;  4PTB A;  5ENI A;  4QQ4 A;  4ZC9 A;  5E9V A;  5E9Y A;  5CUB A;  1E4U A;  3LQH A;  4WZ3 B;  5EM3 A;  5A5S A;  2VJE B;  4XY8 A;  5DFD A;  3Q1D A;  5EWC A;  5EWW A;  4QBM A;  2KWN A;  4UIX A;  5A7C A;  4GNF A;  4QUU A;  1V87 A;  4HXR A;  4ZW1 A;  2KKY A;  5FFV A;  5TB6 A;  4LLB A;  4Q0N A;  4KV1 A;  2ZET C;  3AQA A;  4IC2 A;  4AKI A;  2QJ0 A;  2VPD A;  2VJF A;  2G4A A;  2ECJ A;  5CY9 A;  5C4Q A;  3Q2F A;  5I29 A;  3IU6 A;  4QSU A;  4FIP A;  4LKA A;  4QF3 A;  1WUM A;  5HLS A;  5CUD A;  2Y43 A;  4QEU A;  3L1X A;  3M99 A;  5F3A A;  4R2Y A;  1WEM A;  4QF2 A;  5G05 B;  5H9M A;  5FFW A;  4YH4 A;  3UW9 A;  5LKZ A;  2KYU A;  1VD4 A;  4O70 A;  5HQ5 A;  3U5J A;  2IDA A;  3UVY A;  3LQI A;  3DWY A;  3FL2 A;  2MD7 B;  5BT3 A;  1FBV A;  2RR4 A;  5ETD A;  5I88 A;  5KTW A;  2AN6 A;  2VPB A;  4YYI A;  5DYU A;  5I7Y A;  3HCT A;  5ETB A;  2VPE A;  4NYX A;  5C89 A;  4XI1 A;  1CHC A;  2G43 A;  4O78 A;  5A82 A;  2DSM A;  5FH6 A;  3ZYU A;  2E6S A;  2OXQ C;  4A9E A;  5LVQ A;  2R0S A;  3SVH A;  5B8D A;  3LVR E;  4FO9 A;  3ZVY A;  5B78 A;  5CPE A;  4MEO A;  4YYK A;  1IYM A;  5HCL A;  3O36 A;  5HRX A;  2I7K A;  3MHS A;  2P57 A;  3UVD A;  3N9M A;  1N87 A;  5LKU A;  1Z60 A;  3SVG A;  2VP7 A;  5FE5 A;  4QUT A;  4MEQ A;  4QB3 A;  5TDR A;  3SHB A;  5CUE A;  2G45 A;  5DFC A;  2YHO A;  2RI7 A;  5E7D A;  3IU5 A;  5CUA A;  2M13 A;  4GNE A;  2NXB A;  2CSZ A;  5II1 A;  5L8T A;  4CLB A;  5A81 A;  4XUA A;  4AI6 A;  2L43 A;  5AME A;  5JI8 A;  2KR4 A;  3M63 A;  4Z93 A;  5I1Q A;  4NR7 A;  4IOQ A;  4A0C D;  4UYD A;  2MKE A;  4IR3 A;  2H0D B;  4QSR A;  2JRJ A;  2IQJ A;  3QZS A;  2KIZ A;  2KTB B;  3DPL R;  4BHW A;  4LJN A;  1JSP B;  4PCE A;  2YDW A;  2LXH C;  3JUE A;  3O47 A;  1X0J A;  1WEO A;  4HXM A;  2FFW A;  5LKT A;  5CGP A;  2YUC A;  5CZG A;  4HXO A;  4S3O C;  5DYX A;  5EWD A;  2EGM A;  2YQD A;  5DIN A;  5AIT A;  2RO1 A;  3G0J A;  2KFT A;  4NS5 A;  5KTU A;  5D1K B;  1MM2 A;  5D1L B;  4LDF A;  5EK9 A;  4CUR A;  5C11 A;  2ECT A;  3D1B A;  5KH3 A;  4UYF B;  3MUL A;  2MNZ A;  3KQI A;  5E73 A;  3U5L A;  2L5E A;  3GL6 A;  5ENB A;  4QNS A;  2D8S A;  4AUQ B;  5CP5 A;  4KV4 A;  3VKH A;  2QIC A;  2UZG A;  2VJF B;  3M62 A;  4NYV A;  3QZV A;  5FE4 A;  4C66 A;  2YT5 A;  3N9O A;  2LQ6 A;  1HYI A;  5L99 A;  5F36 A;  4F1P A;  2E6R A;  4CUS A;  2Y1M A;  1WE9 A;  2ECI A;  3LRQ A;  4LR6 A;  4Z1Q A;  2EXU A;  5D24 A;  5C7N A;  4H9D A;  4HBX A;  5FH8 A;  2YEK A;  1HYJ A;  5G4R A;  4L7X A;  4MR3 A;  4BJX A;  4QSP A;  5I40 A;  4GNG A;  2L85 A;  4RVR A;  5CFW A;  5IGN A;  4NRA A;  5CRM A;  2XOY A;  4HXS A;  5K3Q A;  4MSX A;  3MUK A;  4TQN A;  5EU1 A;  4NR4 A;  1WEP A;  5DLX A;  4OGI A;  2E61 A;  5C13 A;  4HBV A;  5FE8 A;  1PUO A;  2EA6 A;  4NUD A;  3C6W A;  3UV4 A;  4P5O B;  2FD4 A;  3UVX A;  2L0B A;  4CFL A;  5AMF A;  2LRI C;  2K4D A;  4LZS A;  4XYA A;  4J0R A;  4WZ2 A;  2F6N A;  5CTL A;  4OGC A;  2ECG A;  5FG6 A;  3O7A A;  2JM3 A;  2H0D A;  4J1P A;  5EV9 A;  2ECV A;  4LAD B;  4GND A;  5D3J A;  2L75 A;  3DDT A;  3PUR A;  1WEU A;  4HBW A;  4Z1S A;  4O7C A;  3DWD A;  2YYN A;  5AD2 A;  4TU6 A;  2CSY A;  2YSM A;  3HTK C;  5IBN A;  2VNF A;  5HQ6 A;  3O35 A;  5DKH A;  5DX4 A;  4F3I A;  4UIV A;  5FG5 A;  1WFK A;  5EPS A;  1X4J A;  4TT6 A;  2CON A;  3HMH A;  3V43 A;  4UYF A;  4YAX A;  4LZ2 A;  5HRV A;  1JM4 B;  4A4B A;  2R0Y A;  4MEN A;  5EPR A;  4WZ0 A;  3N9N A;  3TLP A;  2YQM A;  1WEV A;  4A9F A;  4QYL A;  4Z0R A;  5B79 A;  4W4U A;  1WUG A;  4QYD A;  3GV4 A;  4LC2 A;  4MVT A;  3SUB A;  3SOW A;  2JMJ A;  2M6M A;  3RPG C;  5D26 A;  5I86 A;  4NN2 A;  4YC9 A;  5CS8 A;  1WEE A;  4A4C A;  4FLP A;  2RNW A;  5FB0 A;  4TTE A;  4TYL A;  5C87 A;  4XY9 A;  4NQN A;  5DW1 A;  2D8U A;  4YYH A;  4NR9 A;  4Y03 A;  5KU3 A;  2KRE A;  4CL9 A;  5C85 A;  4BW2 A;  5CQT A;  2MA5 A;  4DON A;  4OGJ A;  5TBN A;  2LAU A;  3MB3 A;  5B77 A;  3S92 A;  2VJE A;  2R10 A;  5FE1 A;  2MNY A;  5EIC A;  4AKH A;  5FER A;  3ZPV E;  4O77 A;  3JVL A;  5F1H A;  5FDZ A;  4YYN A;  2C2V S;  5A5O A;  3FAN A;  2CKL A;  2OSS A;  5EWV A;  4NUE A;  4YBM A;  3ZNI A;  5H1T A;  3P1F A;  4WHU A;  3KDE C;  2LGK A;  4BW4 A;  5LKX A;  4UP5 A;  5F5Z A;  5J0D A;  4NYW A;  5IG6 A;  2DVS A;  1WES A;  4BW3 A;  3GG3 A;  2YUR A;  5FE3 A;  3KV5 A;  4KCX A;  2GRC A;  4PY6 A;  3Q2E A;  5FH7 A; 
#chains in the Genus database with same CATH homology
 4NR5 A;  4HXN A;  2K1J A;  4OUF A;  5C8G A;  2RSD A;  4S3O B;  5F62 A;  4V3K C;  5KH9 A;  1WEW A;  4ZQL A;  5KHM A;  4YYG A;  5D3P A;  5HQ7 A;  4YYJ A;  5D3S A;  5BT5 A;  1VFY A;  1Z6U A;  5E0R A;  1N72 A;  5EA1 A;  3ZPV 1;  3ZYQ A;  3JVM A;  3P5O A;  2KGG A;  2N9G A;  3DAI A;  2LV9 A;  2E3K A;  3LJW A;  5DKD A;  1DVP A;  2LGL A;  2WP1 A;  5FFY A;  3MQM A;  3RPG B;  5D3N A;  2L84 A;  4LRG A;  2Y1N A;  2KWK A;  3MB4 A;  4QC3 A;  2OUO A;  3L1Z B;  3NG2 A;  5HFR A;  4QSX A;  1JM7 B;  5D0C A;  3N9Q A;  1ZS5 A;  4YH3 A;  4BW1 A;  2LGV A;  1F68 A;  4TT2 A;  5EP7 A;  2QIZ A;  2MA6 A;  5A5N A;  5E74 A;  5EPB A;  5CQA A;  5JWM A;  3U5K A;  5JG6 A;  3JVK A;  5A83 A;  2MT5 A;  2DVQ A;  5DLZ A;  5FEY A;  1U6G B;  3UV2 A;  4CUU A;  3RCW A;  1T1H A;  5HFQ A;  2LN0 A;  2DWW A;  4IR6 A;  5HEM A;  3O33 A;  4LYW A;  4O71 A;  5K29 A;  4X3G A;  2E7O A;  5CQ7 A;  2D9E A;  5ENG A;  5LJ0 A;  2HDP A;  3C5K A;  5KH7 A;  2MUM A;  4BBQ A;  3UV5 A;  2L80 A;  4QC1 A;  3IHP A;  4B86 C;  5ENE A;  1WIL A;  5LVR A;  5DY7 A;  4B7Y C;  2LDR A;  4QR4 A;  4LZR A;  2YYR A;  4FJC A;  2DAT A;  4AYC B;  5D3L A;  5D7X A;  4WIV A;  5LCW B;  2KGI A;  4YYM A;  5IGL A;  5D25 A;  5DW2 A;  5FG4 A;  5LUU A;  4QSQ A;  5TAB A;  4X2I A;  5FE0 A;  5CU8 A;  2MJV B;  4HXP A;  4V3L C;  5I3L A;  1WGM A;  1F62 A;  5EWH A;  2PUY A;  3ZVZ B;  4ZDT A;  3ONI A;  2DVV A;  5F60 A;  1JM7 A;  4A9H A;  4A9L A;  2G6Q A;  4GPJ A;  4Q0O A;  5H1U A;  3HME A;  4MEP A;  5A85 A;  4MR6 A;  5F2P A;  2DVR A;  5CQ8 A;  4UYG A;  2ECW A;  5D1M B;  5DKA A;  4N4F A;  5EGU A;  4C9Z A;  3AAD A;  1XWH A;  5DFB A;  2KU3 A;  4ZUX U;  4QY4 A;  1X4U A;  2YEM A;  4N4H A;  4PS5 A;  5B75 A;  4XUB A;  5AIU A;  3QZT A;  5G04 B;  4UIY A;  4N3W A;  4O7B A;  4NXJ A;  5FBX A;  4YAD A;  3HCS A;  4IR5 A;  4N4I A;  5ENJ A;  2M85 A;  2D82 A;  2I8N A;  4A9O A;  4IOR A;  4UIW A;  5TRB A;  4O7F A;  2H60 A;  3KNV A;  4ALG A;  4YK0 A;  5LJ2 A;  1WIM A;  5AD3 A;  1LDK C;  3U5N A;  1Z2Q A;  3NXB A;  4PKL A;  4YAB A;  1MM3 A;  5A5Q A;  5DBM A;  4A49 A;  4IC3 A;  4NR6 A;  5F1L A;  4A9K A;  4WHW A;  2M1R A;  3HMF A;  5ACY A;  2RS9 B;  5I89 A;  2K16 A;  2YQL A;  3L11 A;  5HRW A;  2F42 A;  4TZ2 A;  4C67 A;  4UIZ A;  2KWO A;  5I80 A;  3I2D A;  5BT4 A;  5II2 A;  2CT2 A;  4YY4 A;  5B76 A;  5CUG A;  3PUQ A;  2HYE D;  4CA1 A;  4NRB A;  5E9K A;  4LYS A;  4YY6 A;  5EIS A;  4O74 A;  4QSW A;  4UYE A;  2F6J A;  4ALH A;  5DKC A;  2RNY A;  3RTR B;  5FB1 A;  1BOR A;  1X4I A;  5CRZ A;  2YRE A;  5F63 A;  1LDJ B;  3T6R A;  4R8P K;  3EB5 A;  4CFK A;  2LSP B;  4O75 A;  4PCI A;  5LJ1 A;  2I50 A;  4CCG X;  2LGG A;  5IGK A;  5CQ6 A;  5E3G A;  3FKM X;  4Z6I A;  1ZBD B;  5F25 A;  1WEQ A;  4NRC A;  5ENF A;  3HCU A;  3U5P A;  4QZS A;  3P1E A;  2YSJ A;  5KTX A;  1RMD A;  4I7B A;  5CQ4 A;  4TZ8 A;  5E9L A;  4A9I A;  4LYI A;  3O37 A;  5DYA A;  4Q6F A;  4CUT A;  3EB6 A;  3LXJ A;  4IR4 A;  4AVX A;  2FSA A;  5I7X A;  4QR5 A;  3S91 A;  4PPE A;  2JMD A;  1G25 A;  2EGP A;  4UIU A;  2MIQ A;  4QEV A;  5DYC A;  5G4S A;  4O72 A;  1JOC A;  3SOU A;  2M3H A;  4O7E A;  2FUI A;  1K2F A;  5H85 A;  4HBY A;  1E6I A;  5CUC A;  3N9L A;  4NUC A;  3SVF A;  4CUP A;  5L98 A;  5A5R A;  4QEW A;  4YBT A;  4GB0 A;  5L96 A;  4UYH A;  5D3R A;  3N9P A;  2MD8 C;  4UIT A;  5F61 A;  2XEU A;  4FK5 A;  5G0F A;  5E9I A;  5E9M A;  3P1C A;  5KO4 A;  2FUU A;  5EYA F;  3JVJ A;  2YU4 A;  3O70 A;  4QSS A;  4J0S A;  5CQ5 A;  4Z6H A;  4A9N A;  5FE9 A;  3U5O A;  2DKW A;  2ECN A;  2VPG A;  3ZTG A;  3K2J A;  4QSV A;  4TKP B;  5HJC A;  5COI A;  5IID A;  3VK6 A;  3MXF A;  5EI4 A;  4J3I A;  4I7C A;  2NAA A;  2LXP C;  4O76 A;  1WEN A;  3DQV R;  5I83 A;  3MHH A;  3LQJ A;  3P1D A;  5D3T A;  2PNX A;  2KE1 A;  2YEL A;  3O34 A;  2RFJ A;  4YAT A;  4MR5 A;  5IGM A;  4AYC A;  5ENC A;  2EOD A;  4AKN A;  5HM0 A;  4I7D A;  4AP4 A;  2YW5 A;  4E96 A;  4YBS A;  2C2L A;  4MR4 A;  3ASL A;  3U5M A;  5HEL A;  3UVW A;  5FE2 A;  4TT4 A;  4WA6 A;  5TCM A;  5CQ3 A;  5FE7 A;  3D7C A;  2WP2 A;  4O64 A;  4UP0 A;  4QST A;  1EQF A;  3T7L A;  2YW8 A;  2JMI A;  3I3J A;  2RNX A;  4O7A A;  3KV6 A;  4HXL A;  4IOO A;  5E3D A;  5FE6 A;  5TDW A;  4L58 A;  2YHN A;  2R0V A;  4UI9 B;  4LK9 A;  5A5P A;  4HXK A;  4N4G A;  4TS8 A;  5HEN A;  5L97 A;  5J3X A;  5L8U A;  4TU4 A;  5EQ1 A;  5D3H A;  3PHD A;  5EVA A;  4YYD A;  2DX8 A;  2BAY A;  3G0L A;  5H1V A;  4A9M A;  4NQM A;  4QR3 A;  2L5U A;  2E7N A;  1VYX A;  5ENH A;  4A9J A;  1FP0 A;  4R7E A;  3SOX A;  4F52 B;  2XB1 A;  2OO1 A;  2KWJ A;  2K17 A;  4CUQ A;  4NR8 A;  2CKL B;  4PTB A;  5ENI A;  4ZC9 A;  5E9V A;  5E9Y A;  5CUB A;  1E4U A;  3LQH A;  4WZ3 B;  5EM3 A;  5A5S A;  2VJE B;  4XY8 A;  5DFD A;  5EWC A;  5EWW A;  4QBM A;  2KWN A;  4UIX A;  5A7C A;  4GNF A;  4QUU A;  1V87 A;  4HXR A;  4ZW1 A;  5FFV A;  5TB6 A;  4LLB A;  4Q0N A;  4KV1 A;  2ZET C;  3AQA A;  4IC2 A;  2QJ0 A;  2VPD A;  2VJF A;  2G4A A;  2ECJ A;  5CY9 A;  5C4Q A;  3Q2F A;  5I29 A;  3IU6 A;  4QSU A;  4FIP A;  4LKA A;  4QF3 A;  1WUM A;  5HLS A;  5CUD A;  2Y43 A;  4QEU A;  3L1X A;  3M99 A;  5F3A A;  4R2Y A;  1WEM A;  4QF2 A;  5G05 B;  5H9M A;  5FFW A;  4YH4 A;  3UW9 A;  5LKZ A;  2KYU A;  1VD4 A;  4O70 A;  5HQ5 A;  3U5J A;  2IDA A;  3UVY A;  3LQI A;  3DWY A;  3FL2 A;  2MD7 B;  5BT3 A;  1FBV A;  5ETD A;  5I88 A;  5KTW A;  2AN6 A;  2VPB A;  4YYI A;  5DYU A;  5I7Y A;  3HCT A;  5ETB A;  2VPE A;  4NYX A;  5C89 A;  4XI1 A;  1CHC A;  2G43 A;  4O78 A;  5A82 A;  5FH6 A;  3ZYU A;  2E6S A;  2OXQ C;  4A9E A;  5LVQ A;  2R0S A;  3SVH A;  5B8D A;  3ZVY A;  4FO9 A;  5B78 A;  5CPE A;  4MEO A;  4YYK A;  1IYM A;  5HCL A;  3O36 A;  5HRX A;  2I7K A;  3MHS A;  3UVD A;  3N9M A;  1N87 A;  5LKU A;  1Z60 A;  3SVG A;  2VP7 A;  5FE5 A;  4QUT A;  4MEQ A;  4QB3 A;  5TDR A;  3SHB A;  5CUE A;  2G45 A;  5DFC A;  2YHO A;  2RI7 A;  5E7D A;  3IU5 A;  5CUA A;  4GNE A;  2NXB A;  2CSZ A;  5II1 A;  5L8T A;  4CLB A;  5A81 A;  4XUA A;  2L43 A;  5AME A;  5JI8 A;  2KR4 A;  3M63 A;  4Z93 A;  5I1Q A;  4NR7 A;  4IOQ A;  4A0C D;  4UYD A;  4IR3 A;  2H0D B;  4QSR A;  2JRJ A;  3QZS A;  2KIZ A;  2KTB B;  3DPL R;  4BHW A;  4LJN A;  1JSP B;  4PCE A;  2YDW A;  2LXH C;  1X0J A;  1WEO A;  4HXM A;  5LKT A;  5CGP A;  2YUC A;  5CZG A;  4HXO A;  4S3O C;  5DYX A;  5EWD A;  2YQD A;  5DIN A;  5AIT A;  2RO1 A;  3G0J A;  2KFT A;  4NS5 A;  5KTU A;  5D1K B;  1MM2 A;  5D1L B;  5EK9 A;  4LDF A;  4CUR A;  5C11 A;  2ECT A;  5KH3 A;  4UYF B;  3MUL A;  2MNZ A;  3KQI A;  5E73 A;  3U5L A;  2L5E A;  3GL6 A;  5ENB A;  4QNS A;  2D8S A;  4AUQ B;  5CP5 A;  4KV4 A;  2QIC A;  2UZG A;  2VJF B;  3M62 A;  4NYV A;  3QZV A;  5FE4 A;  4C66 A;  2YT5 A;  3N9O A;  2LQ6 A;  1HYI A;  5L99 A;  5F36 A;  2E6R A;  4CUS A;  2Y1M A;  1WE9 A;  2ECI A;  3LRQ A;  4LR6 A;  4Z1Q A;  5D24 A;  5C7N A;  4HBX A;  5FH8 A;  2YEK A;  1HYJ A;  5G4R A;  4L7X A;  4MR3 A;  4BJX A;  4QSP A;  5I40 A;  4GNG A;  2L85 A;  4RVR A;  5CFW A;  5IGN A;  4NRA A;  5CRM A;  4HXS A;  4MSX A;  3MUK A;  4TQN A;  5EU1 A;  4NR4 A;  1WEP A;  5DLX A;  4OGI A;  5C13 A;  4HBV A;  5FE8 A;  2EA6 A;  4NUD A;  3C6W A;  3UV4 A;  4P5O B;  3UVX A;  2L0B A;  4CFL A;  5AMF A;  2LRI C;  2K4D A;  4LZS A;  4XYA A;  4J0R A;  4WZ2 A;  2F6N A;  5CTL A;  2ECG A;  5FG6 A;  3O7A A;  2H0D A;  4J1P A;  5EV9 A;  2ECV A;  4LAD B;  4GND A;  5D3J A;  2L75 A;  3PUR A;  1WEU A;  4HBW A;  4Z1S A;  4O7C A;  2YYN A;  5AD2 A;  4TU6 A;  2CSY A;  2YSM A;  3HTK C;  5IBN A;  2VNF A;  5HQ6 A;  3O35 A;  5DKH A;  5DX4 A;  4F3I A;  4UIV A;  5FG5 A;  1WFK A;  5EPS A;  1X4J A;  4TT6 A;  3HMH A;  3V43 A;  4UYF A;  4YAX A;  4LZ2 A;  5HRV A;  1JM4 B;  4A4B A;  2R0Y A;  4MEN A;  5EPR A;  4WZ0 A;  3N9N A;  3TLP A;  2YQM A;  1WEV A;  4A9F A;  4QYL A;  5B79 A;  4W4U A;  1WUG A;  4QYD A;  3GV4 A;  4LC2 A;  4MVT A;  3SOW A;  2JMJ A;  2M6M A;  3RPG C;  5D26 A;  5I86 A;  4NN2 A;  4YC9 A;  5CS8 A;  1WEE A;  4A4C A;  4FLP A;  2RNW A;  5FB0 A;  4TTE A;  4TYL A;  5C87 A;  4XY9 A;  4NQN A;  5DW1 A;  4YYH A;  4NR9 A;  4Y03 A;  5KU3 A;  2KRE A;  4CL9 A;  5C85 A;  4BW2 A;  5CQT A;  2MA5 A;  4DON A;  4OGJ A;  5TBN A;  3MB3 A;  5B77 A;  3S92 A;  2VJE A;  2R10 A;  5FE1 A;  2MNY A;  5EIC A;  5FER A;  3ZPV E;  4O77 A;  3JVL A;  5F1H A;  5FDZ A;  4YYN A;  2C2V S;  5A5O A;  2CKL A;  2OSS A;  5EWV A;  4NUE A;  4YBM A;  3ZNI A;  5H1T A;  3P1F A;  4WHU A;  2LGK A;  4BW4 A;  5LKX A;  4UP5 A;  5F5Z A;  5J0D A;  4NYW A;  5IG6 A;  2DVS A;  1WES A;  4BW3 A;  3GG3 A;  2YUR A;  5FE3 A;  3KV5 A;  4KCX A;  2GRC A;  4PY6 A;  3Q2E A;  5FH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...