4N3WA

Crystal structure of the bromodomain-phd finger module of human transcriptional co-activator cbp in complex with acetylated histone 4 peptide (h4k20ac).
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
231
structure length
184
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCDDPSQPQTTKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into Acetylated-Histone H4 Recognition by the Bromodomain-PHD Finger Module of Human Transcriptional Coactivator CBP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/nuclear protein
molecule keywords CREB-binding protein
total genus 55
structure length 184
sequence length 231
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF06001 DUF902 Domain of Unknown Function (DUF902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n3wA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4n3wA02
4J0SA 5EM3A 2M6MA 2Y1NA 4LK9A 4PPEA 4QSVA 4Q0NA 2DVRA 1V87A 3NXBA 5C4QA 4TZ8A 5FG5A 5HM0A 4YYNA 3DPLR 4MSXA 2K16A 5IGMA 2L80A 5COIA 2MA5A 3IHPA 4WA6A 5KO4A 2VPBA 1WEVA 2JRJA 5B76A 4J1PA 4N4GA 5L97A 4HXKA 2KWNA 2MA6A 4QSXA 2HDPA 3U5JA 2MD8C 5C87A 2OO1A 5G05B 4LZRA 5CUAA 5BT3A 1WIMA 5ENEA 5FERA 2RI7A 1JM7A 4A9LA 4NYXA 4QYDA 2KGIA 5B78A 4FK5A 4YY4A 5E9IA 1F68A 4OGIA 3I2DA 3I3JA 3ZVZB 2LDRA 3T7LA 4A0CD 4MR3A 4MR4A 4CUUA 3MULA 4IC2A 4QSQA 4UIXA 4UYHA 2YEKA 2MJVB 5G4SA 4ZC9A 4L7XA 4R8PK 2YELA 4Z1QA 5FEYA 4XYAA 3SHBA 2G6QA 2YEMA 2E3KA 5FG4A 4QYLA 1WEUA 2PNXA 2CSZA 4CUSA 5EWDA 5L98A 4IORA 1WE9A 2OSSA 3P1CA 3T6RA 4LADB 4XUBA 5AD3A 5IGLA 1U6GB 3U5MA 1DVPA 4I7BA 1Z6UA 4QSPA 4XY9A 4DONA 5F3AA 2KE1A 1IYMA 5D0CA 3U5OA 1JM7B 5B8DA 2KWJA 5CZGA 3Q2FA 5F25A 4RVRA 5JG6A 3QZVA 1E4UA 4WZ2A 4NUCA 5D3RA 4BJXA 4HXLA 4S3OB 5DYXA 5LKXA 2FUIA 5TDWA 3LRQA 4O78A 4B7YC 1EQFA 5FFYA 4IR6A 4R7EA 4A9MA 4A9OA 2ECIA 3O37A 2LGKA 4NRCA 2KFTA 3SOXA 4X3GA 2E6SA 3KQIA 4QB3A 5DFCA 5I80A 5ENIA 3C5KA 3MQMA 5KH3A 4AYCA 4WIVA 5FFVA 5G4RA 1WEEA 2D9EA 4N4IA 4NR8A 2VNFA 5FE9A 2ECGA 3KNVA 5C7NA 2R0YA 5E9YA 5EGUA 5FH8A 5D3PA 4I7DA 2G43A 5ETDA 1LDJB 5F61A 4O77A 4TU4A 4YYJA 2YQMA 4NRAA 3Q2EA 4O7EA 4LDFA 4TT6A 2YHNA 4AUQB 2BAYA 5HLSA 4QR4A 3U5LA 1WEWA 2UZGA 4NR4A 2JMJA 3ZPVE 4Z93A 5KTUA 3M62A 5FE7A 5CRMA 4GB0A 2NXBA 2DWWA 4QNSA 2Y43A 2ECJA 2LGGA 5B77A 2LQ6A 3L11A 5CQ5A 5FBXA 5HRVA 4I7CA 1JM4B 2E6RA 4HBVA 4A9NA 2LRIC 3GG3A 4XY8A 1FBVA 2AN6A 3LQJA 4CUPA 3ZYQA 4XI1A 2CKLB 3TLPA 3ONIA 4IOOA 5CUGA 2MNYA 5A85A 4CUTA 5EPSA 3N9NA 5KTWA 2KWKA 2I7KA 4CFLA 5J0DA 4N3WA 2LN0A 4WHWA 4YBMA 4FLPA 4UIYA 4Z6HA 3AADA 2KR4A 5D3LA 5FE5A 5EWWA 5F63A 5ENJA 5HFQA 4BBQA 1HYJA 4PTBA 5D3JA 5LKZA 5DKDA 4Y03A 5LVRA 2DKWA 5C11A 5DW2A 4NUDA 4A4CA 3FKMX 5DYUA 3U5NA 2LV9A 4UYDA 2K1JA 4TZ2A 2QIZA 3PURA 4QF3A 1JSPB 5IG6A 2DVSA 5L99A 5HELA 3ASLA 4UI9B 5AITA 1X0JA 3G0JA 3D7CA 3N9LA 4Z1SA 3UVDA 5I7YA 1E6IA 5FE4A 4MEQA 4QZSA 4YYIA 3N9OA 5E0RA 4UIVA 5FG6A 2CKLA 2KU3A 2ECVA 3MB3A 4MEPA 5LVQA 4NR6A 4YBTA 5A83A 4IOQA 5E74A 5CQ4A 5HENA 4F3IA 1WGMA 2LXHC 3HCUA 2PUYA 1K2FA 4C67A 2KYUA 5CY9A 5DLZA 5HRWA 4LZ2A 2MT5A 2L5UA 2OXQC 4B86C 3L1ZB 3SVHA 4TTEA 4AVXA 2YREA 1LDKC 2ECWA 3K2JA 4KCXA 4LZSA 4O7BA 5AMEA 3FL2A 5J3XA 2H60A 3IU5A 5IBNA 5H9MA 5LJ0A 3JVKA 5D25A 3PUQA 5EK9A 3S91A 5EA1A 1F62A 5CQ3A 4QEVA 4LR6A 5AD2A 2YW8A 4UYFB 5D24A 2VPGA 3G0LA 5HEMA 4QF2A 5HCLA 5C89A 3RPGB 5IGNA 4TT4A 2MUMA 5HRXA 1ZBDB 4HXSA 5EV9A 4GNGA 5CQ7A 5II1A 3HTKC 4A9HA 5LKUA 5G04B 5A5RA 1N87A 2FUUA 5F1HA 3DWYA 4NQNA 4HXNA 4NXJA 5FH7A 4UIUA 1WUGA 2DX8A 2D8SA 4E96A 2RSDA 3ZTGA 4QR3A 4IC3A 5EVAA 2KWOA 1VYXA 2EGPA 3O70A 4LC2A 4MEOA 5DLXA 2YQLA 5I29A 3HMFA 4MVTA 5D3HA 4BW3A 4PS5A 5LJ2A 5FB0A 3UV4A 4HBYA 5KH7A 2D82A 4NYWA 5E9LA 4NRBA 4C9ZA 5IGKA 5EWVA 2DVVA 3RPGC 2YHOA 3UVXA 5HQ5A 2LGVA 4ZDTA 2DVQA 2YUCA 2VPEA 5I86A 4ZUXU 3MUKA 2R0VA 4UITA 4QEWA 4QY4A 1FP0A 4A49A 2XB1A 5CS8A 5E3GA 5ACYA 2M85A 2GRCA 5C8GA 3N9PA 4HXOA 5EP7A 2L84A 4ALGA 2VP7A 4L58A 2I50A 3VK6A 5E9KA 4KV4A 4YYMA 3P5OA 4GNEA 2KIZA 4PCIA 4TQNA 3KV5A 2F6NA 4AP4A 4IR4A 5E9MA 5TABA 2JMDA 4TKPB 2EA6A 2L5EA 4UYEA 5B75A 4TT2A 2JMIA 4O7FA 3LQHA 2KGGA 2RNXA 5AMFA 2QICA 5B79A 3M63A 4QC3A 5HQ7A 2YDWA 5EI4A 3GL6A 1HYIA 5F60A 1Z2QA 5EPBA 4FO9A 4AKNA 5FDZA 1VD4A 3GV4A 3UV5A 5I83A 2ZETC 4QUTA 3L1XA 1N72A 3LQIA 3O34A 5DX4A 4WHUA 5ENCA 1WEPA 3ZVYA 4QR5A 1WEOA 4GPJA 4A9JA 5A82A 3U5KA 2E7NA 5KTXA 1G25A 4LYIA 5IIDA 5CU8A 2RS9B 5CQTA 2QJ0A 4LKAA 5CRZA 4CUQA 4QC1A 4IR5A 3MB4A 5A5QA 3HCSA 5TDRA 3RTRB 5C13A 2VJFB 5ENBA 5D26A 2R10A 5TBNA 2N9GA 5D3NA 5D1LB 4IR3A 5CUDA 2KREA 5CQ8A 2RFJA 3PHDA 4UIZA 4ZQLA 4QSTA 4NYVA 4CURA 2CT2A 4NR5A 5FH6A 4LRGA 2LSPB 4A9KA 1T1HA 4CLBA 3IU6A 4LYSA 5A7CA 2H0DB 5KH9A 4ZW1A 4HXMA 5LUUA 5DFBA 3O36A 4FJCA 5TRBA 2M3HA 2FSAA 2MNZA 5EWHA 3SOUA 5ETBA 5ENFA 5EPRA 5F1LA 1XWHA 4O72A 5CUCA 2K4DA 5EYAF 5DKCA 1BORA 1WILA 5F62A 3JVMA 3O33A 4YYHA 2VPDA 5A81A 5BT5A 2Y1MA 5EQ1A 4ALHA 5D3SA 4GNFA 4UP5A 4O64A 2YQDA 5CGPA 2K17A 5DINA 4NR9A 3EB5A 4YC9A 5TCMA 4J0RA 4O7CA 4J3IA 5CQAA 5I7XA 2L75A 2YYRA 5CTLA 4Q0OA 4W4UA 2H0DA 4BW1A 3P1DA 5EU1A 1JOCA 2CSYA 5EWCA 1WFKA 4N4FA 4QSUA 5JI8A 4UP0A 3NG2A 3SOWA 5H1UA 5KU3A 5F2PA 5LJ1A 3O35A 4YBSA 2F42A 4YYDA 5F5ZA 1Z60A 4YADA 4YH4A 5FE6A 4P5OB 4YY6A 4QSWA 5FE8A 3HMHA 3ZPV1 3UVYA 2ECTA 4A9FA 3KV6A 3O7AA 1X4UA 2RNYA 4S3OC 5LCWB 4O74A 4YATA 4YH3A 3RCWA 3UW9A 4QSSA 5DYCA 3SVGA 5L8UA 3JVLA 1WENA 2M1RA 3QZSA 4HBXA 4O71A 2WP1A 1MM3A 1MM2A 2YSMA 5JWMA 2RO1A 4F52B 3HCTA 4QSRA 3ZYUA 5TB6A 4BHWA 5HJCA 5FE3A 4BW4A 5A5SA 1X4IA 3N9QA 5D1MB 4NUEA 2XEUA 4AYCB 2WP2A 4C66A 5I89A 2NAAA 4FIPA 4O7AA 2LGLA 2L43A 3N9MA 2YURA 5H85A 4N4HA 5FE1A 5H1VA 3P1EA 2KTBB 5ENGA 1CHCA 5E9VA 4UYFA 4BW2A 4LLBA 4NN2A 3QZTA 4LYWA 2L0BA 4UYGA 5DYAA 4MENA 5CPEA 5DFDA 3SVFA 1X4JA 5A5PA 4A4BA 5HFRA 4QUUA 4YABA 4Z6IA 3AQAA 4CCGX 4UIWA 2VJEB 5K29A 2G4AA 4YAXA 5DBMA 4CA1A 4YK0A 4PCEA 5BT4A 5HQ6A 5CUBA 5KHMA 5FE0A 3C6WA 2C2LA 3P1FA 4QEUA 5FB1A 1VFYA 2MIQA 1ZS5A 5DKHA 5L8TA 2YT5A 4YYGA 4R2YA 4X2IA 2IDAA 4Q6FA 5DW1A 4WZ0A 4MR6A 3HMEA 1WUMA 4TU6A 3MXFA 5II2A 4TYLA 5E73A 1WEQA 5FE2A 4A9IA 5AIUA 5EISA 5H1TA 4A9EA 5DY7A 2ECNA 4HXPA 2E7OA 4V3LC 4O70A 5I3LA 3ZNIA 2C2VS 2RNWA 2YYNA 4TS8A 3MHHA 3UV2A 5LKTA 5D1KB 3DQVR 4NR7A 2R0SA 5EICA 5DKAA 4QBMA 3S92A 4GNDA 2YW5A 2DATA 5E7DA 5L96A 1WEMA 5A5OA 2VJEA 2YU4A 4KV1A 5G0FA 1RMDA 5I40A 2LXPC 5CUEA 4WZ3B 5ENHA 4NQMA 5A5NA 2HYED 2L85A 4HXRA 5FFWA 3UVWA 5CFWA 3JVJA 3U5PA 4OGJA 5I1QA 4CL9A 4V3KC 5D7XA 4LJNA 2G45A 2MD7B 2YSJA 4OUFA 2EODA 4MR5A 5F36A 5D3TA 1WESA 5I88A 5CQ6A 4HBWA 4XUAA 5CP5A 3EB6A 3MHSA 4CFKA 3DAIA 3LXJA 2I8NA 3V43A 4NS5A 4O75A 3LJWA 2F6JA 5E3DA 2OUOA 5C85A 3M99A 4O76A 4YYKA 4PKLA 4PY6A 2VJFA
chains in the Genus database with same CATH superfamily
4J0SA 5EM3A 3VKGA 4AKGA 2M6MA 2Y1NA 4QSVA 4Q0NA 2DVRA 1V87A 3NXBA 5C4QA 4LK9A 4TZ8A 5FG5A 5HM0A 4YYNA 2LAUA 3KDEC 3DPLR 4MSXA 2K16A 5IGMA 2L80A 2E61A 5COIA 2MA5A 3IHPA 4WA6A 5KO4A 2VPBA 1WEVA 2JRJA 5B76A 4J1PA 4OGCA 4N4GA 2M13A 5L97A 4HXKA 2KWNA 5SVIB 2MA6A 2IQJA 4QSXA 2HDPA 3U5JA 2MD8C 5C87A 2OO1A 5G05B 4LZRA 5CUAA 5BT3A 3LVRE 1WIMA 5ENEA 3H7HA 2RI7A 5FERA 1JM7A 4A9LA 4NYXA 4QYDA 2KGIA 5B78A 4FK5A 4YY4A 5E9IA 1F68A 4OGIA 3I2DA 3I3JA 3ZVZB 2LDRA 3PLWA 3T7LA 4A0CD 4MR3A 4MR4A 4CUUA 3MULA 3LDYA 4IC2A 4QSQA 4UIXA 4UYHA 2YEKA 2MJVB 5G4SA 4ZC9A 4L7XA 4R8PK 2YELA 4Z1QA 5FEYA 4XYAA 3SHBA 2G6QA 3ERRA 2YEMA 2E3KA 5FG4A 4QYLA 1WEUA 2PNXA 2CSZA 4CUSA 5EWDA 5L98A 4IORA 2RR4A 1WE9A 2OSSA 3P1CA 3T6RA 4LADB 4XUBA 5AD3A 5IGLA 1U6GB 3U5MA 1DVPA 4I7BA 1Z6UA 4QSPA 4XY9A 4DONA 5F3AA 2KE1A 1IYMA 2JM3A 5D0CA 3U5OA 1JM7B 5B8DA 2KWJA 3VKHA 5CZGA 2XOZA 2CONA 3Q2FA 5F25A 4RVRA 5JG6A 3QZVA 1E4UA 4AKIA 4WZ2A 4NUCA 5D3RA 4BJXA 4HXLA 4S3OB 5DYXA 5LKXA 2FUIA 5TDWA 3LRQA 4O78A 4B7YC 1EQFA 5FFYA 4IR6A 4R7EA 3D1BA 4A9MA 4A9OA 2ECIA 3O37A 2LGKA 4NRCA 2KFTA 3SOXA 4X3GA 2E6SA 3KQIA 4QB3A 5DFCA 5I80A 5ENIA 3C5KA 3MQMA 5KH3A 4AYCA 4WIVA 5FFVA 5G4RA 1WEEA 2D9EA 4N4IA 4NR8A 2VNFA 3E2DA 5FE9A 2ECGA 3KNVA 5C7NA 2R0YA 5E9YA 4PPEA 5EGUA 5FH8A 5D3PA 4I7DA 2G43A 5ETDA 1LDJB 2XOCA 5F61A 3JUEA 4O77A 4TU4A 4YYJA 2YQMA 4NRAA 3Q2EA 4O7EA 4LDFA 4TT6A 2YHNA 4AUQB 3M7KA 2BAYA 5HLSA 4QR4A 3U5LA 1WEWA 2P57A 2UZGA 4NR4A 2JMJA 3ZPVE 4Z93A 5KTUA 3M62A 5FE7A 5CRMA 4GB0A 2NXBA 2DWWA 4QNSA 2Y43A 2ECJA 2LGGA 5B77A 2LQ6A 3L11A 5CQ5A 5FBXA 5HRVA 4I7CA 1JM4B 2E6RA 4HBVA 4A9NA 2LRIC 3GG3A 4XY8A 1FBVA 2AN6A 3LQJA 4CUPA 3ZYQA 4XI1A 2CKLB 3TLPA 3ONIA 4IOOA 5CUGA 2MNYA 5A85A 4CUTA 5EPSA 3N9NA 5KTWA 2KWKA 2I7KA 4CFLA 5J0DA 4N3WA 2LN0A 4WHWA 4YBMA 4FLPA 4UIYA 4Z6HA 3AADA 4Z0RA 2KR4A 5D3LA 5FE5A 5EWWA 5F63A 2B0OE 5ENJA 5HFQA 4BBQA 1HYJA 4PTBA 5D3JA 5LKZA 5DKDA 4Y03A 5LVRA 2DKWA 5C11A 5DW2A 4NUDA 4A4CA 3FKMX 5DYUA 3U5NA 2LV9A 4UYDA 2K1JA 4TZ2A 2QIZA 3PURA 4QF3A 1JSPB 5IG6A 2DVSA 5L99A 5HELA 3ASLA 4UI9B 5SVXA 5AITA 1X0JA 3G0JA 3D7CA 3N9LA 4Z1SA 3UVDA 5I7YA 1E6IA 5FE4A 3FAOA 4MEQA 3DDTA 4QZSA 3LVQE 4YYIA 3N9OA 5E0RA 4UIVA 5FG6A 2CKLA 2KU3A 2ECVA 3MB3A 4MEPA 5LVQA 4NR6A 4YBTA 2JUNA 2XP0A 5A83A 4IOQA 5E74A 5CQ4A 5HENA 4F3IA 1WGMA 2LXHC 3HCUA 3LJUX 2PUYA 1K2FA 4C67A 2KYUA 5CY9A 5DLZA 5HRWA 4LZ2A 2MT5A 2L5UA 2OXQC 4B86C 3L1ZB 3SVHA 4TTEA 4AVXA 2YREA 1LDKC 2ECWA 3K2JA 4KCXA 4LZSA 4O7BA 5AMEA 2EXUA 3FL2A 5J3XA 2H60A 3IU5A 5IBNA 5H9MA 5LJ0A 3JVKA 5D25A 3PUQA 5EK9A 3S91A 5EA1A 1F62A 5CQ3A 4QEVA 4LR6A 5AD2A 2YW8A 4UYFB 5D24A 2VPGA 3G0LA 5HEMA 4QF2A 5HCLA 5C89A 3RPGB 5SVYA 5IGNA 4TT4A 2MUMA 5HRXA 1ZBDB 4HXSA 5EV9A 2XOYA 4GNGA 5CQ7A 2EJNA 5II1A 4A9HA 5LKUA 3HTKC 5G04B 5A5RA 1N87A 2FUUA 5F1HA 3DWYA 4NQNA 4HXNA 4NXJA 5FH7A 4UIUA 1WUGA 2DX8A 2D8SA 4E96A 2RSDA 3ZTGA 4QR3A 4IC3A 5EVAA 2KWOA 1VYXA 2EGPA 3O70A 4LC2A 4MEOA 5DLXA 2YQLA 5I29A 3HMFA 4MVTA 5D3HA 4BW3A 4PS5A 5LJ2A 5FB0A 3UV4A 4HBYA 5KH7A 2D82A 4NYWA 5E9LA 4NRBA 4C9ZA 5IGKA 5EWVA 2DVVA 3RPGC 2CSVA 2YHOA 3O47A 3UVXA 3FEHA 5HQ5A 2LGVA 4ZDTA 2DVQA 2YUCA 2VPEA 5I86A 4ZUXU 3MUKA 2R0VA 4UITA 4QEWA 4QY4A 1FP0A 4A49A 2KKYA 2XB1A 5CS8A 5E3GA 5ACYA 2M85A 2GRCA 5C8GA 2KKXA 4HXOA 5EP7A 3N9PA 2L84A 4ALGA 3FM8C 2VP7A 4L58A 2I50A 3VK6A 5E9KA 4KV4A 4YYMA 3P5OA 4GNEA 2KIZA 4PCIA 4TQNA 3KV5A 2F6NA 4AP4A 4IR4A 5E9MA 5TABA 2JMDA 4TKPB 2EA6A 2L5EA 4AKHA 4UYEA 5B75A 4TT2A 2JMIA 4O7FA 3LQHA 2KGGA 2RNXA 5AMFA 2QICA 5B79A 3M63A 4QC3A 5HQ7A 2YDWA 2DSMA 5EI4A 3DWDA 3GL6A 1HYIA 5F60A 1Z2QA 5EPBA 4FO9A 4AKNA 5FDZA 1VD4A 3GV4A 3UV5A 3D1DA 5SVIA 5I83A 2ZETC 4QUTA 4F1PA 3L1XA 1N72A 3LQIA 3O34A 5DX4A 4WHUA 5ENCA 1WEPA 3ZVYA 4QR5A 1WEOA 4GPJA 4A9JA 5A82A 3U5KA 2E7NA 5KTXA 1G25A 4LYIA 5IIDA 5CU8A 2RS9B 5CQTA 2QJ0A 4LKAA 5CRZA 4CUQA 4H9DA 4QC1A 4IR5A 3MB4A 5A5QA 3HCSA 5TDRA 3RTRB 5C13A 2VJFB 3SUBA 5ENBA 5D26A 2R10A 5TBNA 2N9GA 5D3NA 5D1LB 4IR3A 5CUDA 2KREA 4O62A 5CQ8A 2RFJA 3PHDA 4UIZA 4ZQLA 4QSTA 4NYVA 4CURA 2CT2A 4NR5A 5FH6A 5K3QA 4LRGA 2LSPB 4A9KA 1T1HA 2DJAA 4Z0OA 4CLBA 3FJUB 3IU6A 2FD4A 4LYSA 5A7CA 2H0DB 5KH9A 4ZW1A 4HXMA 5LUUA 5DFBA 3O36A 4FJCA 5TRBA 2M3HA 2FSAA 2MNZA 1MBMA 5EWHA 3SOUA 5ETBA 5ENFA 5EPRA 5F1LA 1XWHA 4O72A 5CUCA 2K4DA 5EYAF 5DKCA 1BORA 1WILA 5F62A 3JVMA 3O33A 4YYHA 2VPDA 5A81A 5BT5A 2Y1MA 5EQ1A 4ALHA 5D3SA 4GNFA 4AI6A 4UP5A 4O64A 2YQDA 5CGPA 2K17A 5DINA 4NR9A 3EB5A 4YC9A 5TCMA 4J0RA 4O7CA 4J3IA 5CQAA 5I7XA 1DCQA 2L75A 2L7PA 2YYRA 5CTLA 4Q0OA 4W4UA 2H0DA 4BW1A 3P1DA 5EU1A 1JOCA 2CSYA 5EWCA 1WFKA 4N4FA 4QSUA 3T9KA 5JI8A 4UP0A 3NG2A 3SOWA 3Q1DA 5H1UA 5KU3A 5F2PA 5LJ1A 3O35A 4YBSA 2F42A 4YYDA 5F5ZA 1Z60A 4YADA 4YH4A 5FE6A 4P5OB 4YY6A 4QSWA 5FE8A 3HMHA 3ZPV1 3UVYA 2ECTA 4A9FA 3KV6A 3O7AA 1PUOA 1X4UA 2RNYA 4S3OC 5LCWB 4O74A 4YATA 4YH3A 3RCWA 3UW9A 4QSSA 5DYCA 3SVGA 5L8UA 3JVLA 1WENA 2M1RA 3QZSA 4HBXA 4O71A 2WP1A 1MM3A 1MM2A 2YSMA 5JWMA 2RO1A 4F52B 3HCTA 4QSRA 3ZYUA 5TB6A 4BHWA 5HJCA 5FE3A 4BW4A 5A5SA 1X4IA 3N9QA 5D1MB 4NUEA 2CRWA 2XEUA 4AYCB 2WP2A 4C66A 5I89A 2NAAA 4FIPA 4O7AA 2LGLA 2L43A 3N9MA 2YURA 5H85A 4N4HA 2D8UA 5FE1A 5H1VA 3P1EA 2KTBB 5ENGA 1CHCA 2EGMA 5E9VA 4UYFA 4BW2A 4LLBA 4NN2A 3QZTA 4LYWA 2L0BA 4UYGA 5DYAA 4MENA 5CPEA 5DFDA 3SVFA 1X4JA 5A5PA 4A4BA 5HFRA 4QUUA 4YABA 4Z6IA 3AQAA 3FANA 4CCGX 4UIWA 2VJEB 5K29A 2G4AA 4YAXA 5DBMA 4CA1A 4YK0A 4PCEA 5BT4A 5HQ6A 5CUBA 5KHMA 1ZKRA 5FE0A 3C6WA 2C2LA 3P1FA 4QEUA 5FB1A 1VFYA 2MIQA 1ZS5A 5DKHA 5L8TA 2YT5A 4YYGA 4R2YA 4X2IA 2IDAA 4Q6FA 5DW1A 4WZ0A 4MR6A 3HMEA 1WUMA 4QQ4A 4TU6A 3MXFA 5II2A 4TYLA 5E73A 1WEQA 5FE2A 4A9IA 5AIUA 5EISA 5H1TA 4A9EA 2OWAA 5DY7A 2ECNA 4HXPA 2E7OA 4V3LC 4O70A 5I3LA 3ZNIA 2C2VS 2RNWA 2YYNA 4TS8A 3MHHA 3UV2A 5LKTA 5D1KB 2YVRA 3DQVR 4NR7A 2R0SA 5EICA 5DKAA 4QBMA 3S92A 4GNDA 2YW5A 2DATA 5E7DA 5L96A 1WEMA 3MDBC 5A5OA 2VJEA 2YU4A 4KV1A 5G0FA 1RMDA 5I40A 2LXPC 5CUEA 4WZ3B 5ENHA 4NQMA 5A5NA 2HYED 2L85A 4HXRA 5FFWA 3UVWA 5CFWA 3JVJA 3U5PA 4OGJA 2FFWA 4OGEA 5I1QA 4CL9A 4V3KC 5D7XA 4LJNA 2G45A 2MD7B 2YSJA 4OUFA 2EODA 4MR5A 5F36A 2MKEA 5D3TA 1WESA 5I88A 5CQ6A 4HBWA 4XUAA 5CP5A 3EB6A 3MHSA 4CFKA 3DAIA 2CRRA 3LXJA 2I8NA 3V43A 4NS5A 4O75A 3LJWA 2F6JA 5E3DA 2OUOA 5C85A 3M99A 4O76A 4YYKA 4PKLA 4PY6A 2VJFA
chains in the Genus database with same CATH topology
4J0SA 5EM3A 2M6MA 2Y1NA 4LK9A 4PPEA 4QSVA 4Q0NA 2DVRA 1V87A 3NXBA 5C4QA 4TZ8A 5FG5A 5HM0A 4YYNA 3DPLR 4MSXA 2K16A 5IGMA 2L80A 5COIA 2MA5A 3IHPA 4WA6A 5KO4A 2VPBA 1WEVA 2JRJA 5B76A 4J1PA 4N4GA 5L97A 4HXKA 2KWNA 2MA6A 4QSXA 2HDPA 3U5JA 2MD8C 5C87A 2OO1A 5G05B 4LZRA 5CUAA 5BT3A 1WIMA 5ENEA 5FERA 2RI7A 1JM7A 4A9LA 4NYXA 4QYDA 2KGIA 5B78A 4FK5A 4YY4A 5E9IA 1F68A 4OGIA 3I2DA 3I3JA 3ZVZB 2LDRA 3T7LA 4A0CD 4MR3A 4MR4A 4CUUA 3MULA 4IC2A 4QSQA 4UIXA 4UYHA 2YEKA 2MJVB 5G4SA 4ZC9A 4L7XA 4R8PK 2YELA 4Z1QA 5FEYA 4XYAA 3SHBA 2G6QA 2YEMA 2E3KA 5FG4A 4QYLA 1WEUA 2PNXA 2CSZA 4CUSA 5EWDA 5L98A 4IORA 1WE9A 2OSSA 3P1CA 3T6RA 4LADB 4XUBA 5AD3A 5IGLA 1U6GB 3U5MA 1DVPA 4I7BA 1Z6UA 4QSPA 4XY9A 4DONA 5F3AA 2KE1A 1IYMA 5D0CA 3U5OA 1JM7B 5B8DA 2KWJA 5CZGA 3Q2FA 5F25A 4RVRA 5JG6A 3QZVA 1E4UA 4WZ2A 4NUCA 5D3RA 4BJXA 4HXLA 4S3OB 5DYXA 5LKXA 2FUIA 5TDWA 3LRQA 4O78A 4B7YC 1EQFA 5FFYA 4IR6A 4R7EA 4A9MA 4A9OA 2ECIA 3O37A 2LGKA 4NRCA 2KFTA 3SOXA 4X3GA 2E6SA 3KQIA 4QB3A 5DFCA 5I80A 5ENIA 3C5KA 3MQMA 5KH3A 4AYCA 4WIVA 5FFVA 5G4RA 1WEEA 2D9EA 4N4IA 4NR8A 2VNFA 5FE9A 2ECGA 3KNVA 5C7NA 2R0YA 5E9YA 5EGUA 5FH8A 5D3PA 4I7DA 2G43A 5ETDA 1LDJB 5F61A 4O77A 4TU4A 4YYJA 2YQMA 4NRAA 3Q2EA 4O7EA 4LDFA 4TT6A 2YHNA 4AUQB 2BAYA 5HLSA 4QR4A 3U5LA 1WEWA 2UZGA 4NR4A 2JMJA 3ZPVE 4Z93A 5KTUA 3M62A 5FE7A 5CRMA 4GB0A 2NXBA 2DWWA 4QNSA 2Y43A 2ECJA 2LGGA 5B77A 2LQ6A 3L11A 5CQ5A 5FBXA 5HRVA 4I7CA 1JM4B 2E6RA 4HBVA 4A9NA 2LRIC 3GG3A 4XY8A 1FBVA 2AN6A 3LQJA 4CUPA 3ZYQA 4XI1A 2CKLB 3TLPA 3ONIA 4IOOA 5CUGA 2MNYA 5A85A 4CUTA 5EPSA 3N9NA 5KTWA 2KWKA 2I7KA 4CFLA 5J0DA 4N3WA 2LN0A 4WHWA 4YBMA 4FLPA 4UIYA 4Z6HA 3AADA 2KR4A 5D3LA 5FE5A 5EWWA 5F63A 5ENJA 5HFQA 4BBQA 1HYJA 4PTBA 5D3JA 5LKZA 5DKDA 4Y03A 5LVRA 2DKWA 5C11A 5DW2A 4NUDA 4A4CA 3FKMX 5DYUA 3U5NA 2LV9A 4UYDA 2K1JA 4TZ2A 2QIZA 3PURA 4QF3A 1JSPB 5IG6A 2DVSA 5L99A 5HELA 3ASLA 4UI9B 5AITA 1X0JA 3G0JA 3D7CA 3N9LA 4Z1SA 3UVDA 5I7YA 1E6IA 5FE4A 4MEQA 4QZSA 4YYIA 3N9OA 5E0RA 4UIVA 5FG6A 2CKLA 2KU3A 2ECVA 3MB3A 4MEPA 5LVQA 4NR6A 4YBTA 5A83A 4IOQA 5E74A 5CQ4A 5HENA 4F3IA 1WGMA 2LXHC 3HCUA 2PUYA 1K2FA 4C67A 2KYUA 5CY9A 5DLZA 5HRWA 4LZ2A 2MT5A 2L5UA 2OXQC 4B86C 3L1ZB 3SVHA 4TTEA 4AVXA 2YREA 1LDKC 2ECWA 3K2JA 4KCXA 4LZSA 4O7BA 5AMEA 3FL2A 5J3XA 2H60A 3IU5A 5IBNA 5H9MA 5LJ0A 3JVKA 5D25A 3PUQA 5EK9A 3S91A 5EA1A 1F62A 5CQ3A 4QEVA 4LR6A 5AD2A 2YW8A 4UYFB 5D24A 2VPGA 3G0LA 5HEMA 4QF2A 5HCLA 5C89A 3RPGB 5IGNA 4TT4A 2MUMA 5HRXA 1ZBDB 4HXSA 5EV9A 4GNGA 5CQ7A 5II1A 3HTKC 4A9HA 5LKUA 5G04B 5A5RA 1N87A 2FUUA 5F1HA 3DWYA 4NQNA 4HXNA 4NXJA 5FH7A 4UIUA 1WUGA 2DX8A 2D8SA 4E96A 2RSDA 3ZTGA 4QR3A 4IC3A 5EVAA 2KWOA 1VYXA 2EGPA 3O70A 4LC2A 4MEOA 5DLXA 2YQLA 5I29A 3HMFA 4MVTA 5D3HA 4BW3A 4PS5A 5LJ2A 5FB0A 3UV4A 4HBYA 5KH7A 2D82A 4NYWA 5E9LA 4NRBA 4C9ZA 5IGKA 5EWVA 2DVVA 3RPGC 2YHOA 3UVXA 5HQ5A 2LGVA 4ZDTA 2DVQA 2YUCA 2VPEA 5I86A 4ZUXU 3MUKA 2R0VA 4UITA 4QEWA 4QY4A 1FP0A 4A49A 2XB1A 5CS8A 5E3GA 5ACYA 2M85A 2GRCA 5C8GA 3N9PA 4HXOA 5EP7A 2L84A 4ALGA 2VP7A 4L58A 2I50A 3VK6A 5E9KA 4KV4A 4YYMA 3P5OA 4GNEA 2KIZA 4PCIA 4TQNA 3KV5A 2F6NA 4AP4A 4IR4A 5E9MA 5TABA 2JMDA 4TKPB 2EA6A 2L5EA 4UYEA 5B75A 4TT2A 2JMIA 4O7FA 3LQHA 2KGGA 2RNXA 5AMFA 2QICA 5B79A 3M63A 4QC3A 5HQ7A 2YDWA 5EI4A 3GL6A 1HYIA 5F60A 1Z2QA 5EPBA 4FO9A 4AKNA 5FDZA 1VD4A 3GV4A 3UV5A 5I83A 2ZETC 4QUTA 3L1XA 1N72A 3LQIA 3O34A 5DX4A 4WHUA 5ENCA 1WEPA 3ZVYA 4QR5A 1WEOA 4GPJA 4A9JA 5A82A 3U5KA 2E7NA 5KTXA 1G25A 4LYIA 5IIDA 5CU8A 2RS9B 5CQTA 2QJ0A 4LKAA 5CRZA 4CUQA 4QC1A 4IR5A 3MB4A 5A5QA 3HCSA 5TDRA 3RTRB 5C13A 2VJFB 5ENBA 5D26A 2R10A 5TBNA 2N9GA 5D3NA 5D1LB 4IR3A 5CUDA 2KREA 5CQ8A 2RFJA 3PHDA 4UIZA 4ZQLA 4QSTA 4NYVA 4CURA 2CT2A 4NR5A 5FH6A 4LRGA 2LSPB 4A9KA 1T1HA 4CLBA 3IU6A 4LYSA 5A7CA 2H0DB 5KH9A 4ZW1A 4HXMA 5LUUA 5DFBA 3O36A 4FJCA 5TRBA 2M3HA 2FSAA 2MNZA 5EWHA 3SOUA 5ETBA 5ENFA 5EPRA 5F1LA 1XWHA 4O72A 5CUCA 2K4DA 5EYAF 5DKCA 1BORA 1WILA 5F62A 3JVMA 3O33A 4YYHA 2VPDA 5A81A 5BT5A 2Y1MA 5EQ1A 4ALHA 5D3SA 4GNFA 4UP5A 4O64A 2YQDA 5CGPA 2K17A 5DINA 4NR9A 3EB5A 4YC9A 5TCMA 4J0RA 4O7CA 4J3IA 5CQAA 5I7XA 2L75A 2YYRA 5CTLA 4Q0OA 4W4UA 2H0DA 4BW1A 3P1DA 5EU1A 1JOCA 2CSYA 5EWCA 1WFKA 4N4FA 4QSUA 5JI8A 4UP0A 3NG2A 3SOWA 5H1UA 5KU3A 5F2PA 5LJ1A 3O35A 4YBSA 2F42A 4YYDA 5F5ZA 1Z60A 4YADA 4YH4A 5FE6A 4P5OB 4YY6A 4QSWA 5FE8A 3HMHA 3ZPV1 3UVYA 2ECTA 4A9FA 3KV6A 3O7AA 1X4UA 2RNYA 4S3OC 5LCWB 4O74A 4YATA 4YH3A 3RCWA 3UW9A 4QSSA 5DYCA 3SVGA 5L8UA 3JVLA 1WENA 2M1RA 3QZSA 4HBXA 4O71A 2WP1A 1MM3A 1MM2A 2YSMA 5JWMA 2RO1A 4F52B 3HCTA 4QSRA 3ZYUA 5TB6A 4BHWA 5HJCA 5FE3A 4BW4A 5A5SA 1X4IA 3N9QA 5D1MB 4NUEA 2XEUA 4AYCB 2WP2A 4C66A 5I89A 2NAAA 4FIPA 4O7AA 2LGLA 2L43A 3N9MA 2YURA 5H85A 4N4HA 5FE1A 5H1VA 3P1EA 2KTBB 5ENGA 1CHCA 5E9VA 4UYFA 4BW2A 4LLBA 4NN2A 3QZTA 4LYWA 2L0BA 4UYGA 5DYAA 4MENA 5CPEA 5DFDA 3SVFA 1X4JA 5A5PA 4A4BA 5HFRA 4QUUA 4YABA 4Z6IA 3AQAA 4CCGX 4UIWA 2VJEB 5K29A 2G4AA 4YAXA 5DBMA 4CA1A 4YK0A 4PCEA 5BT4A 5HQ6A 5CUBA 5KHMA 5FE0A 3C6WA 2C2LA 3P1FA 4QEUA 5FB1A 1VFYA 2MIQA 1ZS5A 5DKHA 5L8TA 2YT5A 4YYGA 4R2YA 4X2IA 2IDAA 4Q6FA 5DW1A 4WZ0A 4MR6A 3HMEA 1WUMA 4TU6A 3MXFA 5II2A 4TYLA 5E73A 1WEQA 5FE2A 4A9IA 5AIUA 5EISA 5H1TA 4A9EA 5DY7A 2ECNA 4HXPA 2E7OA 4V3LC 4O70A 5I3LA 3ZNIA 2C2VS 2RNWA 2YYNA 4TS8A 3MHHA 3UV2A 5LKTA 5D1KB 3DQVR 4NR7A 2R0SA 5EICA 5DKAA 4QBMA 3S92A 4GNDA 2YW5A 2DATA 5E7DA 5L96A 1WEMA 5A5OA 2VJEA 2YU4A 4KV1A 5G0FA 1RMDA 5I40A 2LXPC 5CUEA 4WZ3B 5ENHA 4NQMA 5A5NA 2HYED 2L85A 4HXRA 5FFWA 3UVWA 5CFWA 3JVJA 3U5PA 4OGJA 5I1QA 4CL9A 4V3KC 5D7XA 4LJNA 2G45A 2MD7B 2YSJA 4OUFA 2EODA 4MR5A 5F36A 5D3TA 1WESA 5I88A 5CQ6A 4HBWA 4XUAA 5CP5A 3EB6A 3MHSA 4CFKA 3DAIA 3LXJA 2I8NA 3V43A 4NS5A 4O75A 3LJWA 2F6JA 5E3DA 2OUOA 5C85A 3M99A 4O76A 4YYKA 4PKLA 4PY6A 2VJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J0S A;  5EM3 A;  2M6M A;  2Y1N A;  4LK9 A;  4PPE A;  4QSV A;  4Q0N A;  2DVR A;  1V87 A;  3NXB A;  5C4Q A;  4TZ8 A;  5FG5 A;  5HM0 A;  4YYN A;  3DPL R;  4MSX A;  2K16 A;  5IGM A;  2L80 A;  5COI A;  2MA5 A;  3IHP A;  4WA6 A;  5KO4 A;  2VPB A;  1WEV A;  2JRJ A;  5B76 A;  4J1P A;  4N4G A;  5L97 A;  4HXK A;  2KWN A;  2MA6 A;  4QSX A;  2HDP A;  3U5J A;  2MD8 C;  5C87 A;  2OO1 A;  5G05 B;  4LZR A;  5CUA A;  5BT3 A;  1WIM A;  5ENE A;  5FER A;  2RI7 A;  1JM7 A;  4A9L A;  4NYX A;  4QYD A;  2KGI A;  5B78 A;  4FK5 A;  4YY4 A;  5E9I A;  1F68 A;  4OGI A;  3I2D A;  3I3J A;  3ZVZ B;  2LDR A;  3T7L A;  4A0C D;  4MR3 A;  4MR4 A;  4CUU A;  3MUL A;  4IC2 A;  4QSQ A;  4UIX A;  4UYH A;  2YEK A;  2MJV B;  5G4S A;  4ZC9 A;  4L7X A;  4R8P K;  2YEL A;  4Z1Q A;  5FEY A;  4XYA A;  3SHB A;  2G6Q A;  2YEM A;  2E3K A;  5FG4 A;  4QYL A;  1WEU A;  2PNX A;  2CSZ A;  4CUS A;  5EWD A;  5L98 A;  4IOR A;  1WE9 A;  2OSS A;  3P1C A;  3T6R A;  4LAD B;  4XUB A;  5AD3 A;  5IGL A;  1U6G B;  3U5M A;  1DVP A;  4I7B A;  1Z6U A;  4QSP A;  4XY9 A;  4DON A;  5F3A A;  2KE1 A;  1IYM A;  5D0C A;  3U5O A;  1JM7 B;  5B8D A;  2KWJ A;  5CZG A;  3Q2F A;  5F25 A;  4RVR A;  5JG6 A;  3QZV A;  1E4U A;  4WZ2 A;  4NUC A;  5D3R A;  4BJX A;  4HXL A;  4S3O B;  5DYX A;  5LKX A;  2FUI A;  5TDW A;  3LRQ A;  4O78 A;  4B7Y C;  1EQF A;  5FFY A;  4IR6 A;  4R7E A;  4A9M A;  4A9O A;  2ECI A;  3O37 A;  2LGK A;  4NRC A;  2KFT A;  3SOX A;  4X3G A;  2E6S A;  3KQI A;  4QB3 A;  5DFC A;  5I80 A;  5ENI A;  3C5K A;  3MQM A;  5KH3 A;  4AYC A;  4WIV A;  5FFV A;  5G4R A;  1WEE A;  2D9E A;  4N4I A;  4NR8 A;  2VNF A;  5FE9 A;  2ECG A;  3KNV A;  5C7N A;  2R0Y A;  5E9Y A;  5EGU A;  5FH8 A;  5D3P A;  4I7D A;  2G43 A;  5ETD A;  1LDJ B;  5F61 A;  4O77 A;  4TU4 A;  4YYJ A;  2YQM A;  4NRA A;  3Q2E A;  4O7E A;  4LDF A;  4TT6 A;  2YHN A;  4AUQ B;  2BAY A;  5HLS A;  4QR4 A;  3U5L A;  1WEW A;  2UZG A;  4NR4 A;  2JMJ A;  3ZPV E;  4Z93 A;  5KTU A;  3M62 A;  5FE7 A;  5CRM A;  4GB0 A;  2NXB A;  2DWW A;  4QNS A;  2Y43 A;  2ECJ A;  2LGG A;  5B77 A;  2LQ6 A;  3L11 A;  5CQ5 A;  5FBX A;  5HRV A;  4I7C A;  1JM4 B;  2E6R A;  4HBV A;  4A9N A;  2LRI C;  3GG3 A;  4XY8 A;  1FBV A;  2AN6 A;  3LQJ A;  4CUP A;  3ZYQ A;  4XI1 A;  2CKL B;  3TLP A;  3ONI A;  4IOO A;  5CUG A;  2MNY A;  5A85 A;  4CUT A;  5EPS A;  3N9N A;  5KTW A;  2KWK A;  2I7K A;  4CFL A;  5J0D A;  4N3W A;  2LN0 A;  4WHW A;  4YBM A;  4FLP A;  4UIY A;  4Z6H A;  3AAD A;  2KR4 A;  5D3L A;  5FE5 A;  5EWW A;  5F63 A;  5ENJ A;  5HFQ A;  4BBQ A;  1HYJ A;  4PTB A;  5D3J A;  5LKZ A;  5DKD A;  4Y03 A;  5LVR A;  2DKW A;  5C11 A;  5DW2 A;  4NUD A;  4A4C A;  3FKM X;  5DYU A;  3U5N A;  2LV9 A;  4UYD A;  2K1J A;  4TZ2 A;  2QIZ A;  3PUR A;  4QF3 A;  1JSP B;  5IG6 A;  2DVS A;  5L99 A;  5HEL A;  3ASL A;  4UI9 B;  5AIT A;  1X0J A;  3G0J A;  3D7C A;  3N9L A;  4Z1S A;  3UVD A;  5I7Y A;  1E6I A;  5FE4 A;  4MEQ A;  4QZS A;  4YYI A;  3N9O A;  5E0R A;  4UIV A;  5FG6 A;  2CKL A;  2KU3 A;  2ECV A;  3MB3 A;  4MEP A;  5LVQ A;  4NR6 A;  4YBT A;  5A83 A;  4IOQ A;  5E74 A;  5CQ4 A;  5HEN A;  4F3I A;  1WGM A;  2LXH C;  3HCU A;  2PUY A;  1K2F A;  4C67 A;  2KYU A;  5CY9 A;  5DLZ A;  5HRW A;  4LZ2 A;  2MT5 A;  2L5U A;  2OXQ C;  4B86 C;  3L1Z B;  3SVH A;  4TTE A;  4AVX A;  2YRE A;  1LDK C;  2ECW A;  3K2J A;  4KCX A;  4LZS A;  4O7B A;  5AME A;  3FL2 A;  5J3X A;  2H60 A;  3IU5 A;  5IBN A;  5H9M A;  5LJ0 A;  3JVK A;  5D25 A;  3PUQ A;  5EK9 A;  3S91 A;  5EA1 A;  1F62 A;  5CQ3 A;  4QEV A;  4LR6 A;  5AD2 A;  2YW8 A;  4UYF B;  5D24 A;  2VPG A;  3G0L A;  5HEM A;  4QF2 A;  5HCL A;  5C89 A;  3RPG B;  5IGN A;  4TT4 A;  2MUM A;  5HRX A;  1ZBD B;  4HXS A;  5EV9 A;  4GNG A;  5CQ7 A;  5II1 A;  3HTK C;  4A9H A;  5LKU A;  5G04 B;  5A5R A;  1N87 A;  2FUU A;  5F1H A;  3DWY A;  4NQN A;  4HXN A;  4NXJ A;  5FH7 A;  4UIU A;  1WUG A;  2DX8 A;  2D8S A;  4E96 A;  2RSD A;  3ZTG A;  4QR3 A;  4IC3 A;  5EVA A;  2KWO A;  1VYX A;  2EGP A;  3O70 A;  4LC2 A;  4MEO A;  5DLX A;  2YQL A;  5I29 A;  3HMF A;  4MVT A;  5D3H A;  4BW3 A;  4PS5 A;  5LJ2 A;  5FB0 A;  3UV4 A;  4HBY A;  5KH7 A;  2D82 A;  4NYW A;  5E9L A;  4NRB A;  4C9Z A;  5IGK A;  5EWV A;  2DVV A;  3RPG C;  2YHO A;  3UVX A;  5HQ5 A;  2LGV A;  4ZDT A;  2DVQ A;  2YUC A;  2VPE A;  5I86 A;  4ZUX U;  3MUK A;  2R0V A;  4UIT A;  4QEW A;  4QY4 A;  1FP0 A;  4A49 A;  2XB1 A;  5CS8 A;  5E3G A;  5ACY A;  2M85 A;  2GRC A;  5C8G A;  3N9P A;  4HXO A;  5EP7 A;  2L84 A;  4ALG A;  2VP7 A;  4L58 A;  2I50 A;  3VK6 A;  5E9K A;  4KV4 A;  4YYM A;  3P5O A;  4GNE A;  2KIZ A;  4PCI A;  4TQN A;  3KV5 A;  2F6N A;  4AP4 A;  4IR4 A;  5E9M A;  5TAB A;  2JMD A;  4TKP B;  2EA6 A;  2L5E A;  4UYE A;  5B75 A;  4TT2 A;  2JMI A;  4O7F A;  3LQH A;  2KGG A;  2RNX A;  5AMF A;  2QIC A;  5B79 A;  3M63 A;  4QC3 A;  5HQ7 A;  2YDW A;  5EI4 A;  3GL6 A;  1HYI A;  5F60 A;  1Z2Q A;  5EPB A;  4FO9 A;  4AKN A;  5FDZ A;  1VD4 A;  3GV4 A;  3UV5 A;  5I83 A;  2ZET C;  4QUT A;  3L1X A;  1N72 A;  3LQI A;  3O34 A;  5DX4 A;  4WHU A;  5ENC A;  1WEP A;  3ZVY A;  4QR5 A;  1WEO A;  4GPJ A;  4A9J A;  5A82 A;  3U5K A;  2E7N A;  5KTX A;  1G25 A;  4LYI A;  5IID A;  5CU8 A;  2RS9 B;  5CQT A;  2QJ0 A;  4LKA A;  5CRZ A;  4CUQ A;  4QC1 A;  4IR5 A;  3MB4 A;  5A5Q A;  3HCS A;  5TDR A;  3RTR B;  5C13 A;  2VJF B;  5ENB A;  5D26 A;  2R10 A;  5TBN A;  2N9G A;  5D3N A;  5D1L B;  4IR3 A;  5CUD A;  2KRE A;  5CQ8 A;  2RFJ A;  3PHD A;  4UIZ A;  4ZQL A;  4QST A;  4NYV A;  4CUR A;  2CT2 A;  4NR5 A;  5FH6 A;  4LRG A;  2LSP B;  4A9K A;  1T1H A;  4CLB A;  3IU6 A;  4LYS A;  5A7C A;  2H0D B;  5KH9 A;  4ZW1 A;  4HXM A;  5LUU A;  5DFB A;  3O36 A;  4FJC A;  5TRB A;  2M3H A;  2FSA A;  2MNZ A;  5EWH A;  3SOU A;  5ETB A;  5ENF A;  5EPR A;  5F1L A;  1XWH A;  4O72 A;  5CUC A;  2K4D A;  5EYA F;  5DKC A;  1BOR A;  1WIL A;  5F62 A;  3JVM A;  3O33 A;  4YYH A;  2VPD A;  5A81 A;  5BT5 A;  2Y1M A;  5EQ1 A;  4ALH A;  5D3S A;  4GNF A;  4UP5 A;  4O64 A;  2YQD A;  5CGP A;  2K17 A;  5DIN A;  4NR9 A;  3EB5 A;  4YC9 A;  5TCM A;  4J0R A;  4O7C A;  4J3I A;  5CQA A;  5I7X A;  2L75 A;  2YYR A;  5CTL A;  4Q0O A;  4W4U A;  2H0D A;  4BW1 A;  3P1D A;  5EU1 A;  1JOC A;  2CSY A;  5EWC A;  1WFK A;  4N4F A;  4QSU A;  5JI8 A;  4UP0 A;  3NG2 A;  3SOW A;  5H1U A;  5KU3 A;  5F2P A;  5LJ1 A;  3O35 A;  4YBS A;  2F42 A;  4YYD A;  5F5Z A;  1Z60 A;  4YAD A;  4YH4 A;  5FE6 A;  4P5O B;  4YY6 A;  4QSW A;  5FE8 A;  3HMH A;  3ZPV 1;  3UVY A;  2ECT A;  4A9F A;  3KV6 A;  3O7A A;  1X4U A;  2RNY A;  4S3O C;  5LCW B;  4O74 A;  4YAT A;  4YH3 A;  3RCW A;  3UW9 A;  4QSS A;  5DYC A;  3SVG A;  5L8U A;  3JVL A;  1WEN A;  2M1R A;  3QZS A;  4HBX A;  4O71 A;  2WP1 A;  1MM3 A;  1MM2 A;  2YSM A;  5JWM A;  2RO1 A;  4F52 B;  3HCT A;  4QSR A;  3ZYU A;  5TB6 A;  4BHW A;  5HJC A;  5FE3 A;  4BW4 A;  5A5S A;  1X4I A;  3N9Q A;  5D1M B;  4NUE A;  2XEU A;  4AYC B;  2WP2 A;  4C66 A;  5I89 A;  2NAA A;  4FIP A;  4O7A A;  2LGL A;  2L43 A;  3N9M A;  2YUR A;  5H85 A;  4N4H A;  5FE1 A;  5H1V A;  3P1E A;  2KTB B;  5ENG A;  1CHC A;  5E9V A;  4UYF A;  4BW2 A;  4LLB A;  4NN2 A;  3QZT A;  4LYW A;  2L0B A;  4UYG A;  5DYA A;  4MEN A;  5CPE A;  5DFD A;  3SVF A;  1X4J A;  5A5P A;  4A4B A;  5HFR A;  4QUU A;  4YAB A;  4Z6I A;  3AQA A;  4CCG X;  4UIW A;  2VJE B;  5K29 A;  2G4A A;  4YAX A;  5DBM A;  4CA1 A;  4YK0 A;  4PCE A;  5BT4 A;  5HQ6 A;  5CUB A;  5KHM A;  5FE0 A;  3C6W A;  2C2L A;  3P1F A;  4QEU A;  5FB1 A;  1VFY A;  2MIQ A;  1ZS5 A;  5DKH A;  5L8T A;  2YT5 A;  4YYG A;  4R2Y A;  4X2I A;  2IDA A;  4Q6F A;  5DW1 A;  4WZ0 A;  4MR6 A;  3HME A;  1WUM A;  4TU6 A;  3MXF A;  5II2 A;  4TYL A;  5E73 A;  1WEQ A;  5FE2 A;  4A9I A;  5AIU A;  5EIS A;  5H1T A;  4A9E A;  5DY7 A;  2ECN A;  4HXP A;  2E7O A;  4V3L C;  4O70 A;  5I3L A;  3ZNI A;  2C2V S;  2RNW A;  2YYN A;  4TS8 A;  3MHH A;  3UV2 A;  5LKT A;  5D1K B;  3DQV R;  4NR7 A;  2R0S A;  5EIC A;  5DKA A;  4QBM A;  3S92 A;  4GND A;  2YW5 A;  2DAT A;  5E7D A;  5L96 A;  1WEM A;  5A5O A;  2VJE A;  2YU4 A;  4KV1 A;  5G0F A;  1RMD A;  5I40 A;  2LXP C;  5CUE A;  4WZ3 B;  5ENH A;  4NQM A;  5A5N A;  2HYE D;  2L85 A;  4HXR A;  5FFW A;  3UVW A;  5CFW A;  3JVJ A;  3U5P A;  4OGJ A;  5I1Q A;  4CL9 A;  4V3K C;  5D7X A;  4LJN A;  2G45 A;  2MD7 B;  2YSJ A;  4OUF A;  2EOD A;  4MR5 A;  5F36 A;  5D3T A;  1WES A;  5I88 A;  5CQ6 A;  4HBW A;  4XUA A;  5CP5 A;  3EB6 A;  3MHS A;  4CFK A;  3DAI A;  3LXJ A;  2I8N A;  3V43 A;  4NS5 A;  4O75 A;  3LJW A;  2F6J A;  5E3D A;  2OUO A;  5C85 A;  3M99 A;  4O76 A;  4YYK A;  4PKL A;  4PY6 A;  2VJF A; 
#chains in the Genus database with same CATH topology
 4J0S A;  5EM3 A;  3VKG A;  4AKG A;  2M6M A;  2Y1N A;  4QSV A;  4Q0N A;  2DVR A;  1V87 A;  3NXB A;  5C4Q A;  4LK9 A;  4TZ8 A;  5FG5 A;  5HM0 A;  4YYN A;  2LAU A;  3KDE C;  3DPL R;  4MSX A;  2K16 A;  5IGM A;  2L80 A;  2E61 A;  5COI A;  2MA5 A;  3IHP A;  4WA6 A;  5KO4 A;  2VPB A;  1WEV A;  2JRJ A;  5B76 A;  4J1P A;  4OGC A;  4N4G A;  2M13 A;  5L97 A;  4HXK A;  2KWN A;  5SVI B;  2MA6 A;  2IQJ A;  4QSX A;  2HDP A;  3U5J A;  2MD8 C;  5C87 A;  2OO1 A;  5G05 B;  4LZR A;  5CUA A;  5BT3 A;  3LVR E;  1WIM A;  5ENE A;  3H7H A;  2RI7 A;  5FER A;  1JM7 A;  4A9L A;  4NYX A;  4QYD A;  2KGI A;  5B78 A;  4FK5 A;  4YY4 A;  5E9I A;  1F68 A;  4OGI A;  3I2D A;  3I3J A;  3ZVZ B;  2LDR A;  3PLW A;  3T7L A;  4A0C D;  4MR3 A;  4MR4 A;  4CUU A;  3MUL A;  3LDY A;  4IC2 A;  4QSQ A;  4UIX A;  4UYH A;  2YEK A;  2MJV B;  5G4S A;  4ZC9 A;  4L7X A;  4R8P K;  2YEL A;  4Z1Q A;  5FEY A;  4XYA A;  3SHB A;  2G6Q A;  3ERR A;  2YEM A;  2E3K A;  5FG4 A;  4QYL A;  1WEU A;  2PNX A;  2CSZ A;  4CUS A;  5EWD A;  5L98 A;  4IOR A;  2RR4 A;  1WE9 A;  2OSS A;  3P1C A;  3T6R A;  4LAD B;  4XUB A;  5AD3 A;  5IGL A;  1U6G B;  3U5M A;  1DVP A;  4I7B A;  1Z6U A;  4QSP A;  4XY9 A;  4DON A;  5F3A A;  2KE1 A;  1IYM A;  2JM3 A;  5D0C A;  3U5O A;  1JM7 B;  5B8D A;  2KWJ A;  3VKH A;  5CZG A;  2XOZ A;  2CON A;  3Q2F A;  5F25 A;  4RVR A;  5JG6 A;  3QZV A;  1E4U A;  4AKI A;  4WZ2 A;  4NUC A;  5D3R A;  4BJX A;  4HXL A;  4S3O B;  5DYX A;  5LKX A;  2FUI A;  5TDW A;  3LRQ A;  4O78 A;  4B7Y C;  1EQF A;  5FFY A;  4IR6 A;  4R7E A;  3D1B A;  4A9M A;  4A9O A;  2ECI A;  3O37 A;  2LGK A;  4NRC A;  2KFT A;  3SOX A;  4X3G A;  2E6S A;  3KQI A;  4QB3 A;  5DFC A;  5I80 A;  5ENI A;  3C5K A;  3MQM A;  5KH3 A;  4AYC A;  4WIV A;  5FFV A;  5G4R A;  1WEE A;  2D9E A;  4N4I A;  4NR8 A;  2VNF A;  3E2D A;  5FE9 A;  2ECG A;  3KNV A;  5C7N A;  2R0Y A;  5E9Y A;  4PPE A;  5EGU A;  5FH8 A;  5D3P A;  4I7D A;  2G43 A;  5ETD A;  1LDJ B;  2XOC A;  5F61 A;  3JUE A;  4O77 A;  4TU4 A;  4YYJ A;  2YQM A;  4NRA A;  3Q2E A;  4O7E A;  4LDF A;  4TT6 A;  2YHN A;  4AUQ B;  3M7K A;  2BAY A;  5HLS A;  4QR4 A;  3U5L A;  1WEW A;  2P57 A;  2UZG A;  4NR4 A;  2JMJ A;  3ZPV E;  4Z93 A;  5KTU A;  3M62 A;  5FE7 A;  5CRM A;  4GB0 A;  2NXB A;  2DWW A;  4QNS A;  2Y43 A;  2ECJ A;  2LGG A;  5B77 A;  2LQ6 A;  3L11 A;  5CQ5 A;  5FBX A;  5HRV A;  4I7C A;  1JM4 B;  2E6R A;  4HBV A;  4A9N A;  2LRI C;  3GG3 A;  4XY8 A;  1FBV A;  2AN6 A;  3LQJ A;  4CUP A;  3ZYQ A;  4XI1 A;  2CKL B;  3TLP A;  3ONI A;  4IOO A;  5CUG A;  2MNY A;  5A85 A;  4CUT A;  5EPS A;  3N9N A;  5KTW A;  2KWK A;  2I7K A;  4CFL A;  5J0D A;  4N3W A;  2LN0 A;  4WHW A;  4YBM A;  4FLP A;  4UIY A;  4Z6H A;  3AAD A;  4Z0R A;  2KR4 A;  5D3L A;  5FE5 A;  5EWW A;  5F63 A;  2B0O E;  5ENJ A;  5HFQ A;  4BBQ A;  1HYJ A;  4PTB A;  5D3J A;  5LKZ A;  5DKD A;  4Y03 A;  5LVR A;  2DKW A;  5C11 A;  5DW2 A;  4NUD A;  4A4C A;  3FKM X;  5DYU A;  3U5N A;  2LV9 A;  4UYD A;  2K1J A;  4TZ2 A;  2QIZ A;  3PUR A;  4QF3 A;  1JSP B;  5IG6 A;  2DVS A;  5L99 A;  5HEL A;  3ASL A;  4UI9 B;  5SVX A;  5AIT A;  1X0J A;  3G0J A;  3D7C A;  3N9L A;  4Z1S A;  3UVD A;  5I7Y A;  1E6I A;  5FE4 A;  3FAO A;  4MEQ A;  3DDT A;  4QZS A;  3LVQ E;  4YYI A;  3N9O A;  5E0R A;  4UIV A;  5FG6 A;  2CKL A;  2KU3 A;  2ECV A;  3MB3 A;  4MEP A;  5LVQ A;  4NR6 A;  4YBT A;  2JUN A;  2XP0 A;  5A83 A;  4IOQ A;  5E74 A;  5CQ4 A;  5HEN A;  4F3I A;  1WGM A;  2LXH C;  3HCU A;  3LJU X;  2PUY A;  1K2F A;  4C67 A;  2KYU A;  5CY9 A;  5DLZ A;  5HRW A;  4LZ2 A;  2MT5 A;  2L5U A;  2OXQ C;  4B86 C;  3L1Z B;  3SVH A;  4TTE A;  4AVX A;  2YRE A;  1LDK C;  2ECW A;  3K2J A;  4KCX A;  4LZS A;  4O7B A;  5AME A;  2EXU A;  3FL2 A;  5J3X A;  2H60 A;  3IU5 A;  5IBN A;  5H9M A;  5LJ0 A;  3JVK A;  5D25 A;  3PUQ A;  5EK9 A;  3S91 A;  5EA1 A;  1F62 A;  5CQ3 A;  4QEV A;  4LR6 A;  5AD2 A;  2YW8 A;  4UYF B;  5D24 A;  2VPG A;  3G0L A;  5HEM A;  4QF2 A;  5HCL A;  5C89 A;  3RPG B;  5SVY A;  5IGN A;  4TT4 A;  2MUM A;  5HRX A;  1ZBD B;  4HXS A;  5EV9 A;  2XOY A;  4GNG A;  5CQ7 A;  2EJN A;  5II1 A;  4A9H A;  5LKU A;  3HTK C;  5G04 B;  5A5R A;  1N87 A;  2FUU A;  5F1H A;  3DWY A;  4NQN A;  4HXN A;  4NXJ A;  5FH7 A;  4UIU A;  1WUG A;  2DX8 A;  2D8S A;  4E96 A;  2RSD A;  3ZTG A;  4QR3 A;  4IC3 A;  5EVA A;  2KWO A;  1VYX A;  2EGP A;  3O70 A;  4LC2 A;  4MEO A;  5DLX A;  2YQL A;  5I29 A;  3HMF A;  4MVT A;  5D3H A;  4BW3 A;  4PS5 A;  5LJ2 A;  5FB0 A;  3UV4 A;  4HBY A;  5KH7 A;  2D82 A;  4NYW A;  5E9L A;  4NRB A;  4C9Z A;  5IGK A;  5EWV A;  2DVV A;  3RPG C;  2CSV A;  2YHO A;  3O47 A;  3UVX A;  3FEH A;  5HQ5 A;  2LGV A;  4ZDT A;  2DVQ A;  2YUC A;  2VPE A;  5I86 A;  4ZUX U;  3MUK A;  2R0V A;  4UIT A;  4QEW A;  4QY4 A;  1FP0 A;  4A49 A;  2KKY A;  2XB1 A;  5CS8 A;  5E3G A;  5ACY A;  2M85 A;  2GRC A;  5C8G A;  2KKX A;  4HXO A;  5EP7 A;  3N9P A;  2L84 A;  4ALG A;  3FM8 C;  2VP7 A;  4L58 A;  2I50 A;  3VK6 A;  5E9K A;  4KV4 A;  4YYM A;  3P5O A;  4GNE A;  2KIZ A;  4PCI A;  4TQN A;  3KV5 A;  2F6N A;  4AP4 A;  4IR4 A;  5E9M A;  5TAB A;  2JMD A;  4TKP B;  2EA6 A;  2L5E A;  4AKH A;  4UYE A;  5B75 A;  4TT2 A;  2JMI A;  4O7F A;  3LQH A;  2KGG A;  2RNX A;  5AMF A;  2QIC A;  5B79 A;  3M63 A;  4QC3 A;  5HQ7 A;  2YDW A;  2DSM A;  5EI4 A;  3DWD A;  3GL6 A;  1HYI A;  5F60 A;  1Z2Q A;  5EPB A;  4FO9 A;  4AKN A;  5FDZ A;  1VD4 A;  3GV4 A;  3UV5 A;  3D1D A;  5SVI A;  5I83 A;  2ZET C;  4QUT A;  4F1P A;  3L1X A;  1N72 A;  3LQI A;  3O34 A;  5DX4 A;  4WHU A;  5ENC A;  1WEP A;  3ZVY A;  4QR5 A;  1WEO A;  4GPJ A;  4A9J A;  5A82 A;  3U5K A;  2E7N A;  5KTX A;  1G25 A;  4LYI A;  5IID A;  5CU8 A;  2RS9 B;  5CQT A;  2QJ0 A;  4LKA A;  5CRZ A;  4CUQ A;  4H9D A;  4QC1 A;  4IR5 A;  3MB4 A;  5A5Q A;  3HCS A;  5TDR A;  3RTR B;  5C13 A;  2VJF B;  3SUB A;  5ENB A;  5D26 A;  2R10 A;  5TBN A;  2N9G A;  5D3N A;  5D1L B;  4IR3 A;  5CUD A;  2KRE A;  4O62 A;  5CQ8 A;  2RFJ A;  3PHD A;  4UIZ A;  4ZQL A;  4QST A;  4NYV A;  4CUR A;  2CT2 A;  4NR5 A;  5FH6 A;  5K3Q A;  4LRG A;  2LSP B;  4A9K A;  1T1H A;  2DJA A;  4Z0O A;  4CLB A;  3FJU B;  3IU6 A;  2FD4 A;  4LYS A;  5A7C A;  2H0D B;  5KH9 A;  4ZW1 A;  4HXM A;  5LUU A;  5DFB A;  3O36 A;  4FJC A;  5TRB A;  2M3H A;  2FSA A;  2MNZ A;  1MBM A;  5EWH A;  3SOU A;  5ETB A;  5ENF A;  5EPR A;  5F1L A;  1XWH A;  4O72 A;  5CUC A;  2K4D A;  5EYA F;  5DKC A;  1BOR A;  1WIL A;  5F62 A;  3JVM A;  3O33 A;  4YYH A;  2VPD A;  5A81 A;  5BT5 A;  2Y1M A;  5EQ1 A;  4ALH A;  5D3S A;  4GNF A;  4AI6 A;  4UP5 A;  4O64 A;  2YQD A;  5CGP A;  2K17 A;  5DIN A;  4NR9 A;  3EB5 A;  4YC9 A;  5TCM A;  4J0R A;  4O7C A;  4J3I A;  5CQA A;  5I7X A;  1DCQ A;  2L75 A;  2L7P A;  2YYR A;  5CTL A;  4Q0O A;  4W4U A;  2H0D A;  4BW1 A;  3P1D A;  5EU1 A;  1JOC A;  2CSY A;  5EWC A;  1WFK A;  4N4F A;  4QSU A;  3T9K A;  5JI8 A;  4UP0 A;  3NG2 A;  3SOW A;  3Q1D A;  5H1U A;  5KU3 A;  5F2P A;  5LJ1 A;  3O35 A;  4YBS A;  2F42 A;  4YYD A;  5F5Z A;  1Z60 A;  4YAD A;  4YH4 A;  5FE6 A;  4P5O B;  4YY6 A;  4QSW A;  5FE8 A;  3HMH A;  3ZPV 1;  3UVY A;  2ECT A;  4A9F A;  3KV6 A;  3O7A A;  1PUO A;  1X4U A;  2RNY A;  4S3O C;  5LCW B;  4O74 A;  4YAT A;  4YH3 A;  3RCW A;  3UW9 A;  4QSS A;  5DYC A;  3SVG A;  5L8U A;  3JVL A;  1WEN A;  2M1R A;  3QZS A;  4HBX A;  4O71 A;  2WP1 A;  1MM3 A;  1MM2 A;  2YSM A;  5JWM A;  2RO1 A;  4F52 B;  3HCT A;  4QSR A;  3ZYU A;  5TB6 A;  4BHW A;  5HJC A;  5FE3 A;  4BW4 A;  5A5S A;  1X4I A;  3N9Q A;  5D1M B;  4NUE A;  2CRW A;  2XEU A;  4AYC B;  2WP2 A;  4C66 A;  5I89 A;  2NAA A;  4FIP A;  4O7A A;  2LGL A;  2L43 A;  3N9M A;  2YUR A;  5H85 A;  4N4H A;  2D8U A;  5FE1 A;  5H1V A;  3P1E A;  2KTB B;  5ENG A;  1CHC A;  2EGM A;  5E9V A;  4UYF A;  4BW2 A;  4LLB A;  4NN2 A;  3QZT A;  4LYW A;  2L0B A;  4UYG A;  5DYA A;  4MEN A;  5CPE A;  5DFD A;  3SVF A;  1X4J A;  5A5P A;  4A4B A;  5HFR A;  4QUU A;  4YAB A;  4Z6I A;  3AQA A;  3FAN A;  4CCG X;  4UIW A;  2VJE B;  5K29 A;  2G4A A;  4YAX A;  5DBM A;  4CA1 A;  4YK0 A;  4PCE A;  5BT4 A;  5HQ6 A;  5CUB A;  5KHM A;  1ZKR A;  5FE0 A;  3C6W A;  2C2L A;  3P1F A;  4QEU A;  5FB1 A;  1VFY A;  2MIQ A;  1ZS5 A;  5DKH A;  5L8T A;  2YT5 A;  4YYG A;  4R2Y A;  4X2I A;  2IDA A;  4Q6F A;  5DW1 A;  4WZ0 A;  4MR6 A;  3HME A;  1WUM A;  4QQ4 A;  4TU6 A;  3MXF A;  5II2 A;  4TYL A;  5E73 A;  1WEQ A;  5FE2 A;  4A9I A;  5AIU A;  5EIS A;  5H1T A;  4A9E A;  2OWA A;  5DY7 A;  2ECN A;  4HXP A;  2E7O A;  4V3L C;  4O70 A;  5I3L A;  3ZNI A;  2C2V S;  2RNW A;  2YYN A;  4TS8 A;  3MHH A;  3UV2 A;  5LKT A;  5D1K B;  2YVR A;  3DQV R;  4NR7 A;  2R0S A;  5EIC A;  5DKA A;  4QBM A;  3S92 A;  4GND A;  2YW5 A;  2DAT A;  5E7D A;  5L96 A;  1WEM A;  3MDB C;  5A5O A;  2VJE A;  2YU4 A;  4KV1 A;  5G0F A;  1RMD A;  5I40 A;  2LXP C;  5CUE A;  4WZ3 B;  5ENH A;  4NQM A;  5A5N A;  2HYE D;  2L85 A;  4HXR A;  5FFW A;  3UVW A;  5CFW A;  3JVJ A;  3U5P A;  4OGJ A;  2FFW A;  4OGE A;  5I1Q A;  4CL9 A;  4V3K C;  5D7X A;  4LJN A;  2G45 A;  2MD7 B;  2YSJ A;  4OUF A;  2EOD A;  4MR5 A;  5F36 A;  2MKE A;  5D3T A;  1WES A;  5I88 A;  5CQ6 A;  4HBW A;  4XUA A;  5CP5 A;  3EB6 A;  3MHS A;  4CFK A;  3DAI A;  2CRR A;  3LXJ A;  2I8N A;  3V43 A;  4NS5 A;  4O75 A;  3LJW A;  2F6J A;  5E3D A;  2OUO A;  5C85 A;  3M99 A;  4O76 A;  4YYK A;  4PKL A;  4PY6 A;  2VJF A; 
#chains in the Genus database with same CATH homology
 4J0S A;  5EM3 A;  2M6M A;  2Y1N A;  4LK9 A;  4PPE A;  4QSV A;  4Q0N A;  2DVR A;  1V87 A;  3NXB A;  5C4Q A;  4TZ8 A;  5FG5 A;  5HM0 A;  4YYN A;  3DPL R;  4MSX A;  2K16 A;  5IGM A;  2L80 A;  5COI A;  2MA5 A;  3IHP A;  4WA6 A;  5KO4 A;  2VPB A;  1WEV A;  2JRJ A;  5B76 A;  4J1P A;  4N4G A;  5L97 A;  4HXK A;  2KWN A;  2MA6 A;  4QSX A;  2HDP A;  3U5J A;  2MD8 C;  5C87 A;  2OO1 A;  5G05 B;  4LZR A;  5CUA A;  5BT3 A;  1WIM A;  5ENE A;  5FER A;  2RI7 A;  1JM7 A;  4A9L A;  4NYX A;  4QYD A;  2KGI A;  5B78 A;  4FK5 A;  4YY4 A;  5E9I A;  1F68 A;  4OGI A;  3I2D A;  3I3J A;  3ZVZ B;  2LDR A;  3T7L A;  4A0C D;  4MR3 A;  4MR4 A;  4CUU A;  3MUL A;  4IC2 A;  4QSQ A;  4UIX A;  4UYH A;  2YEK A;  2MJV B;  5G4S A;  4ZC9 A;  4L7X A;  4R8P K;  2YEL A;  4Z1Q A;  5FEY A;  4XYA A;  3SHB A;  2G6Q A;  2YEM A;  2E3K A;  5FG4 A;  4QYL A;  1WEU A;  2PNX A;  2CSZ A;  4CUS A;  5EWD A;  5L98 A;  4IOR A;  1WE9 A;  2OSS A;  3P1C A;  3T6R A;  4LAD B;  4XUB A;  5AD3 A;  5IGL A;  1U6G B;  3U5M A;  1DVP A;  4I7B A;  1Z6U A;  4QSP A;  4XY9 A;  4DON A;  5F3A A;  2KE1 A;  1IYM A;  5D0C A;  3U5O A;  1JM7 B;  5B8D A;  2KWJ A;  5CZG A;  3Q2F A;  5F25 A;  4RVR A;  5JG6 A;  3QZV A;  1E4U A;  4WZ2 A;  4NUC A;  5D3R A;  4BJX A;  4HXL A;  4S3O B;  5DYX A;  5LKX A;  2FUI A;  5TDW A;  3LRQ A;  4O78 A;  4B7Y C;  1EQF A;  5FFY A;  4IR6 A;  4R7E A;  4A9M A;  4A9O A;  2ECI A;  3O37 A;  2LGK A;  4NRC A;  2KFT A;  3SOX A;  4X3G A;  2E6S A;  3KQI A;  4QB3 A;  5DFC A;  5I80 A;  5ENI A;  3C5K A;  3MQM A;  5KH3 A;  4AYC A;  4WIV A;  5FFV A;  5G4R A;  1WEE A;  2D9E A;  4N4I A;  4NR8 A;  2VNF A;  5FE9 A;  2ECG A;  3KNV A;  5C7N A;  2R0Y A;  5E9Y A;  5EGU A;  5FH8 A;  5D3P A;  4I7D A;  2G43 A;  5ETD A;  1LDJ B;  5F61 A;  4O77 A;  4TU4 A;  4YYJ A;  2YQM A;  4NRA A;  3Q2E A;  4O7E A;  4LDF A;  4TT6 A;  2YHN A;  4AUQ B;  2BAY A;  5HLS A;  4QR4 A;  3U5L A;  1WEW A;  2UZG A;  4NR4 A;  2JMJ A;  3ZPV E;  4Z93 A;  5KTU A;  3M62 A;  5FE7 A;  5CRM A;  4GB0 A;  2NXB A;  2DWW A;  4QNS A;  2Y43 A;  2ECJ A;  2LGG A;  5B77 A;  2LQ6 A;  3L11 A;  5CQ5 A;  5FBX A;  5HRV A;  4I7C A;  1JM4 B;  2E6R A;  4HBV A;  4A9N A;  2LRI C;  3GG3 A;  4XY8 A;  1FBV A;  2AN6 A;  3LQJ A;  4CUP A;  3ZYQ A;  4XI1 A;  2CKL B;  3TLP A;  3ONI A;  4IOO A;  5CUG A;  2MNY A;  5A85 A;  4CUT A;  5EPS A;  3N9N A;  5KTW A;  2KWK A;  2I7K A;  4CFL A;  5J0D A;  4N3W A;  2LN0 A;  4WHW A;  4YBM A;  4FLP A;  4UIY A;  4Z6H A;  3AAD A;  2KR4 A;  5D3L A;  5FE5 A;  5EWW A;  5F63 A;  5ENJ A;  5HFQ A;  4BBQ A;  1HYJ A;  4PTB A;  5D3J A;  5LKZ A;  5DKD A;  4Y03 A;  5LVR A;  2DKW A;  5C11 A;  5DW2 A;  4NUD A;  4A4C A;  3FKM X;  5DYU A;  3U5N A;  2LV9 A;  4UYD A;  2K1J A;  4TZ2 A;  2QIZ A;  3PUR A;  4QF3 A;  1JSP B;  5IG6 A;  2DVS A;  5L99 A;  5HEL A;  3ASL A;  4UI9 B;  5AIT A;  1X0J A;  3G0J A;  3D7C A;  3N9L A;  4Z1S A;  3UVD A;  5I7Y A;  1E6I A;  5FE4 A;  4MEQ A;  4QZS A;  4YYI A;  3N9O A;  5E0R A;  4UIV A;  5FG6 A;  2CKL A;  2KU3 A;  2ECV A;  3MB3 A;  4MEP A;  5LVQ A;  4NR6 A;  4YBT A;  5A83 A;  4IOQ A;  5E74 A;  5CQ4 A;  5HEN A;  4F3I A;  1WGM A;  2LXH C;  3HCU A;  2PUY A;  1K2F A;  4C67 A;  2KYU A;  5CY9 A;  5DLZ A;  5HRW A;  4LZ2 A;  2MT5 A;  2L5U A;  2OXQ C;  4B86 C;  3L1Z B;  3SVH A;  4TTE A;  4AVX A;  2YRE A;  1LDK C;  2ECW A;  3K2J A;  4KCX A;  4LZS A;  4O7B A;  5AME A;  3FL2 A;  5J3X A;  2H60 A;  3IU5 A;  5IBN A;  5H9M A;  5LJ0 A;  3JVK A;  5D25 A;  3PUQ A;  5EK9 A;  3S91 A;  5EA1 A;  1F62 A;  5CQ3 A;  4QEV A;  4LR6 A;  5AD2 A;  2YW8 A;  4UYF B;  5D24 A;  2VPG A;  3G0L A;  5HEM A;  4QF2 A;  5HCL A;  5C89 A;  3RPG B;  5IGN A;  4TT4 A;  2MUM A;  5HRX A;  1ZBD B;  4HXS A;  5EV9 A;  4GNG A;  5CQ7 A;  5II1 A;  3HTK C;  4A9H A;  5LKU A;  5G04 B;  5A5R A;  1N87 A;  2FUU A;  5F1H A;  3DWY A;  4NQN A;  4HXN A;  4NXJ A;  5FH7 A;  4UIU A;  1WUG A;  2DX8 A;  2D8S A;  4E96 A;  2RSD A;  3ZTG A;  4QR3 A;  4IC3 A;  5EVA A;  2KWO A;  1VYX A;  2EGP A;  3O70 A;  4LC2 A;  4MEO A;  5DLX A;  2YQL A;  5I29 A;  3HMF A;  4MVT A;  5D3H A;  4BW3 A;  4PS5 A;  5LJ2 A;  5FB0 A;  3UV4 A;  4HBY A;  5KH7 A;  2D82 A;  4NYW A;  5E9L A;  4NRB A;  4C9Z A;  5IGK A;  5EWV A;  2DVV A;  3RPG C;  2YHO A;  3UVX A;  5HQ5 A;  2LGV A;  4ZDT A;  2DVQ A;  2YUC A;  2VPE A;  5I86 A;  4ZUX U;  3MUK A;  2R0V A;  4UIT A;  4QEW A;  4QY4 A;  1FP0 A;  4A49 A;  2XB1 A;  5CS8 A;  5E3G A;  5ACY A;  2M85 A;  2GRC A;  5C8G A;  3N9P A;  4HXO A;  5EP7 A;  2L84 A;  4ALG A;  2VP7 A;  4L58 A;  2I50 A;  3VK6 A;  5E9K A;  4KV4 A;  4YYM A;  3P5O A;  4GNE A;  2KIZ A;  4PCI A;  4TQN A;  3KV5 A;  2F6N A;  4AP4 A;  4IR4 A;  5E9M A;  5TAB A;  2JMD A;  4TKP B;  2EA6 A;  2L5E A;  4UYE A;  5B75 A;  4TT2 A;  2JMI A;  4O7F A;  3LQH A;  2KGG A;  2RNX A;  5AMF A;  2QIC A;  5B79 A;  3M63 A;  4QC3 A;  5HQ7 A;  2YDW A;  5EI4 A;  3GL6 A;  1HYI A;  5F60 A;  1Z2Q A;  5EPB A;  4FO9 A;  4AKN A;  5FDZ A;  1VD4 A;  3GV4 A;  3UV5 A;  5I83 A;  2ZET C;  4QUT A;  3L1X A;  1N72 A;  3LQI A;  3O34 A;  5DX4 A;  4WHU A;  5ENC A;  1WEP A;  3ZVY A;  4QR5 A;  1WEO A;  4GPJ A;  4A9J A;  5A82 A;  3U5K A;  2E7N A;  5KTX A;  1G25 A;  4LYI A;  5IID A;  5CU8 A;  2RS9 B;  5CQT A;  2QJ0 A;  4LKA A;  5CRZ A;  4CUQ A;  4QC1 A;  4IR5 A;  3MB4 A;  5A5Q A;  3HCS A;  5TDR A;  3RTR B;  5C13 A;  2VJF B;  5ENB A;  5D26 A;  2R10 A;  5TBN A;  2N9G A;  5D3N A;  5D1L B;  4IR3 A;  5CUD A;  2KRE A;  5CQ8 A;  2RFJ A;  3PHD A;  4UIZ A;  4ZQL A;  4QST A;  4NYV A;  4CUR A;  2CT2 A;  4NR5 A;  5FH6 A;  4LRG A;  2LSP B;  4A9K A;  1T1H A;  4CLB A;  3IU6 A;  4LYS A;  5A7C A;  2H0D B;  5KH9 A;  4ZW1 A;  4HXM A;  5LUU A;  5DFB A;  3O36 A;  4FJC A;  5TRB A;  2M3H A;  2FSA A;  2MNZ A;  5EWH A;  3SOU A;  5ETB A;  5ENF A;  5EPR A;  5F1L A;  1XWH A;  4O72 A;  5CUC A;  2K4D A;  5EYA F;  5DKC A;  1BOR A;  1WIL A;  5F62 A;  3JVM A;  3O33 A;  4YYH A;  2VPD A;  5A81 A;  5BT5 A;  2Y1M A;  5EQ1 A;  4ALH A;  5D3S A;  4GNF A;  4UP5 A;  4O64 A;  2YQD A;  5CGP A;  2K17 A;  5DIN A;  4NR9 A;  3EB5 A;  4YC9 A;  5TCM A;  4J0R A;  4O7C A;  4J3I A;  5CQA A;  5I7X A;  2L75 A;  2YYR A;  5CTL A;  4Q0O A;  4W4U A;  2H0D A;  4BW1 A;  3P1D A;  5EU1 A;  1JOC A;  2CSY A;  5EWC A;  1WFK A;  4N4F A;  4QSU A;  5JI8 A;  4UP0 A;  3NG2 A;  3SOW A;  5H1U A;  5KU3 A;  5F2P A;  5LJ1 A;  3O35 A;  4YBS A;  2F42 A;  4YYD A;  5F5Z A;  1Z60 A;  4YAD A;  4YH4 A;  5FE6 A;  4P5O B;  4YY6 A;  4QSW A;  5FE8 A;  3HMH A;  3ZPV 1;  3UVY A;  2ECT A;  4A9F A;  3KV6 A;  3O7A A;  1X4U A;  2RNY A;  4S3O C;  5LCW B;  4O74 A;  4YAT A;  4YH3 A;  3RCW A;  3UW9 A;  4QSS A;  5DYC A;  3SVG A;  5L8U A;  3JVL A;  1WEN A;  2M1R A;  3QZS A;  4HBX A;  4O71 A;  2WP1 A;  1MM3 A;  1MM2 A;  2YSM A;  5JWM A;  2RO1 A;  4F52 B;  3HCT A;  4QSR A;  3ZYU A;  5TB6 A;  4BHW A;  5HJC A;  5FE3 A;  4BW4 A;  5A5S A;  1X4I A;  3N9Q A;  5D1M B;  4NUE A;  2XEU A;  4AYC B;  2WP2 A;  4C66 A;  5I89 A;  2NAA A;  4FIP A;  4O7A A;  2LGL A;  2L43 A;  3N9M A;  2YUR A;  5H85 A;  4N4H A;  5FE1 A;  5H1V A;  3P1E A;  2KTB B;  5ENG A;  1CHC A;  5E9V A;  4UYF A;  4BW2 A;  4LLB A;  4NN2 A;  3QZT A;  4LYW A;  2L0B A;  4UYG A;  5DYA A;  4MEN A;  5CPE A;  5DFD A;  3SVF A;  1X4J A;  5A5P A;  4A4B A;  5HFR A;  4QUU A;  4YAB A;  4Z6I A;  3AQA A;  4CCG X;  4UIW A;  2VJE B;  5K29 A;  2G4A A;  4YAX A;  5DBM A;  4CA1 A;  4YK0 A;  4PCE A;  5BT4 A;  5HQ6 A;  5CUB A;  5KHM A;  5FE0 A;  3C6W A;  2C2L A;  3P1F A;  4QEU A;  5FB1 A;  1VFY A;  2MIQ A;  1ZS5 A;  5DKH A;  5L8T A;  2YT5 A;  4YYG A;  4R2Y A;  4X2I A;  2IDA A;  4Q6F A;  5DW1 A;  4WZ0 A;  4MR6 A;  3HME A;  1WUM A;  4TU6 A;  3MXF A;  5II2 A;  4TYL A;  5E73 A;  1WEQ A;  5FE2 A;  4A9I A;  5AIU A;  5EIS A;  5H1T A;  4A9E A;  5DY7 A;  2ECN A;  4HXP A;  2E7O A;  4V3L C;  4O70 A;  5I3L A;  3ZNI A;  2C2V S;  2RNW A;  2YYN A;  4TS8 A;  3MHH A;  3UV2 A;  5LKT A;  5D1K B;  3DQV R;  4NR7 A;  2R0S A;  5EIC A;  5DKA A;  4QBM A;  3S92 A;  4GND A;  2YW5 A;  2DAT A;  5E7D A;  5L96 A;  1WEM A;  5A5O A;  2VJE A;  2YU4 A;  4KV1 A;  5G0F A;  1RMD A;  5I40 A;  2LXP C;  5CUE A;  4WZ3 B;  5ENH A;  4NQM A;  5A5N A;  2HYE D;  2L85 A;  4HXR A;  5FFW A;  3UVW A;  5CFW A;  3JVJ A;  3U5P A;  4OGJ A;  5I1Q A;  4CL9 A;  4V3K C;  5D7X A;  4LJN A;  2G45 A;  2MD7 B;  2YSJ A;  4OUF A;  2EOD A;  4MR5 A;  5F36 A;  5D3T A;  1WES A;  5I88 A;  5CQ6 A;  4HBW A;  4XUA A;  5CP5 A;  3EB6 A;  3MHS A;  4CFK A;  3DAI A;  3LXJ A;  2I8N A;  3V43 A;  4NS5 A;  4O75 A;  3LJW A;  2F6J A;  5E3D A;  2OUO A;  5C85 A;  3M99 A;  4O76 A;  4YYK A;  4PKL A;  4PY6 A;  2VJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...