4N3WA

Crystal structure of the bromodomain-phd finger module of human transcriptional co-activator cbp in complex with acetylated histone 4 peptide (h4k20ac).
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
231
structure length
184
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCDDPSQPQTTKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/nuclear protein
molecule keywords CREB-binding protein
publication title Structural Insights into Acetylated-Histone H4 Recognition by the Bromodomain-PHD Finger Module of Human Transcriptional Coactivator CBP.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 184
sequence length 231
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF06001 DUF902 Domain of Unknown Function (DUF902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n3wA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4n3wA02
3AQAA 4R2YA 4Z6HA 4O70A 5LKUA 1WEWA 5FG6A 4HXOA 1WEUA 4MR5A 5EI4A 2CSYA 3MUKA 2RSDA 2MD7B 3MHSA 1JM4B 4CFKA 4UYGA 4QB3A 5ETDA 4AP4A 1JM7A 5JI8A 3UVWA 2ECTA 1WGMA 1G25A 4QSUA 5F60A 3IU6A 5D1KB 4UP5A 4QEWA 5D3TA 2LGGA 4NYXA 4RVRA 3GL6A 4AVXA 4BHWA 4F3IA 3V43A 4ZQLA 4YBSA 5LVRA 1WEEA 3IHPA 4LYSA 4UYFA 2KWJA 5AIUA 5FG4A 1E4UA 5EQ1A 5BT4A 4FLPA 4HXRA 2YDWA 5HJCA 2R0SA 5CQ5A 4A9NA 2L5EA 4O74A 2L75A 2EGPA 3TLPA 1XWHA 2LV9A 2MT5A 4HBWA 2YURA 2L43A 2DVSA 3N9NA 4UI9B 5KH9A 4QUUA 3SOWA 5FBXA 5FFYA 4KV1A 5DYXA 2DKWA 5AMEA 2OUOA 5LJ0A 4QSVA 3EB5A 4YBTA 3N9QA 4WHWA 5C89A 2F6NA 4HXPA 4O76A 5EPSA 2NAAA 5TABA 4HBXA 4WIVA 3P1DA 3KV5A 2YQDA 5FE3A 2LGKA 4Q6FA 1WEQA 5LJ2A 5FH8A 2K16A 4CL9A 2MUMA 4I7CA 4XUBA 2QJ0A 4S3OC 1CHCA 2I50A 4MEOA 2G45A 3HTKC 4MEQA 4YYHA 1RMDA 5I83A 4UP0A 5D26A 5D24A 5LUUA 2VNFA 4MR4A 1WESA 4IOQA 1Z2QA 3O7AA 4TU4A 3ASLA 5EP7A 5DY7A 3NG2A 2JMIA 3HMEA 2G43A 4GB0A 5CRZA 5H85A 4I7BA 5D1MB 3NXBA 4UYHA 5EPRA 2MNZA 2EA6A 1VFYA 3N9PA 2MJVB 4Q0NA 2KGGA 5CQ8A 2D9EA 2L0BA 5AITA 4BW3A 5EV9A 5FFVA 3U5JA 4A4BA 5D3LA 5ENFA 2M85A 4QR5A 3FL2A 2FUIA 4FK5A 5AD2A 4WZ3B 3HMFA 2GRCA 5ENEA 2DVRA 5HQ6A 1N87A 5ENHA 3RTRB 1F62A 4HBYA 5C7NA 5ENBA 2L5UA 5CUAA 5TDWA 4B7YC 5H1VA 5HEMA 3ZNIA 4R8PK 2ECWA 2E6SA 5BT3A 3UVYA 5LKZA 5FE2A 3Q2FA 5CQAA 5HELA 3IU5A 5DYAA 1Z6UA 3O33A 5EU1A 4A9EA 2FUUA 2VJEB 3S91A 5HCLA 4MSXA 3M63A 4YYDA 5I7YA 3P5OA 5E9LA 2JMJA 4ALGA 3ZYQA 3RPGC 1U6GB 5D1LB 2LXPC 3L1XA 1BORA 5A83A 4YYIA 1LDKC 2CSZA 5D3HA 5C87A 3O70A 5CQ6A 5HRWA 3PUQA 5KH3A 4FO9A 3LQHA 3G0LA 5DYUA 4YC9A 5F2PA 3L11A 1ZS5A 5C85A 5IGNA 2JMDA 5CQTA 4CUSA 4IR5A 2LSPB 4TT4A 3U5MA 4NR9A 4NRBA 5ENGA 4CUUA 2EODA 3AADA 2KWOA 5D7XA 4NR4A 2H60A 4QBMA 5LJ1A 4O7EA 4UIUA 3HCSA 2G4AA 4IR3A 1V87A 2I8NA 2OO1A 5F63A 4GPJA 4OGJA 2ZETC 4O72A 2MA6A 5E9IA 2VP7A 2YHOA 2RS9B 4O7CA 4PPEA 4WZ0A 5C11A 4TU6A 3N9OA 3O36A 4N3WA 5D3NA 5EWDA 5HM0A 4ZDTA 4Z93A 5DKDA 3DWYA 5I29A 4LYIA 4TYLA 3UVDA 2KU3A 2LN0A 4V3KC 4A0CD 3P1CA 4UIZA 4BW2A 4QSPA 4MEPA 3PHDA 1FP0A 4A9MA 5HLSA 5B78A 4Z1QA 1MM2A 1IYMA 3D7CA 2YELA 5KTXA 2ECIA 2YQMA 4P5OB 3T6RA 5FE8A 5CUCA 3ZVYA 5J3XA 4NQMA 2KWNA 4YYKA 2KYUA 5A7CA 5DW1A 4QSXA 5ENJA 5FE7A 2Y43A 3ZPVE 1WILA 4N4GA 4O75A 4QSWA 2DVVA 4TTEA 4ALHA 4A49A 1WE9A 3QZVA 5CQ3A 1DVPA 3I3JA 5DFCA 4V3LC 5L99A 4HXLA 4IORA 4L7XA 3U5OA 4MR6A 3QZSA 5F25A 5L98A 2VJEA 4NR8A 5DYCA 2L84A 5HQ7A 2OSSA 2NXBA 3P1EA 3RPGB 4GNFA 5IBNA 4NR7A 4A9HA 4BW1A 5FDZA 4Y03A 2C2VS 5D3PA 2QIZA 4OGIA 4N4FA 4QUTA 5IGLA 3M62A 4PY6A 2QICA 4YYJA 4NR6A 4TT6A 5E73A 4WA6A 5DLZA 5TCMA 4IC2A 4F52B 2D82A 2YREA 2M3HA 3FKMX 1WEVA 4PS5A 4YK0A 3JVMA 1ZBDB 4AKNA 2YUCA 2E6RA 2LQ6A 4LKAA 2ECNA 5F36A 3SVHA 3SOUA 5A5RA 4J0SA 5G05B 5FB1A 4PKLA 5FE4A 4UIVA 4BJXA 4A4CA 4XUAA 2MIQA 4CLBA 4XI1A 2RNXA 5IG6A 4YY6A 4LJNA 3SVFA 1E6IA 4YABA 3MXFA 3RCWA 3UV5A 2LXHC 5CZGA 4R7EA 5B8DA 2YEMA 3LQJA 2YQLA 2Y1MA 3GG3A 5CRMA 3N9MA 4YY4A 3KQIA 5JG6A 4FJCA 2F6JA 3U5KA 5ACYA 4C66A 4CCGX 4J3IA 5J0DA 1WIMA 5DKHA 5G4RA 5HRVA 4L58A 2KREA 5D3SA 5EICA 3KV6A 5A81A 2K4DA 2PUYA 4HXNA 1X0JA 3MB3A 5KTWA 2VJFB 5IGKA 5F61A 4NUEA 3SOXA 2VPEA 4UYEA 5HFRA 5TBNA 4PTBA 3S92A 2UZGA 4X3GA 5CUGA 5D3RA 2CKLB 5KH7A 3L1ZB 5E9VA 5DKCA 4UYDA 5A5QA 4NXJA 4HBVA 3O37A 1X4IA 3DQVR 3MB4A 2I7KA 2XEUA 4WZ2A 2VPGA 4YYMA 4QY4A 1X4UA 4QC1A 5D25A 2K1JA 2RO1A 5EWWA 4IC3A 5FH7A 4N4HA 4NR5A 5E0RA 4E96A 5LVQA 2E3KA 4KV4A 3JVJA 5A82A 2Y1NA 2YU4A 3MHHA 3MQMA 1EQFA 5CU8A 5CQ7A 3LXJA 5H1TA 5KU3A 4S3OB 4UITA 1JSPB 4LLBA 3M99A 2HDPA 3K2JA 2L85A 1VYXA 2DATA 4O7FA 1F68A 5G4SA 4LDFA 4LZRA 4QZSA 3JVKA 4A9JA 2AN6A 4LADB 4IOOA 5E9YA 4NQNA 4A9KA 4YH4A 4O77A 5EISA 5D0CA 2C2LA 2H0DB 4AYCB 4C9ZA 4PCIA 5EWHA 2ECVA 2HYED 2MA5A 2LDRA 2YW5A 5F3AA 3Q2EA 4NUDA 5I88A 4UIXA 5FE1A 1WEMA 4MVTA 5FERA 3HCUA 2LGVA 3C5KA 3GV4A 2K17A 5A5NA 5KTUA 5AMFA 5CUEA 5C8GA 5L8TA 2DX8A 5C13A 2PNXA 2M6MA 4UIWA 5CY9A 4CA1A 2KR4A 3U5NA 5EWCA 2KGIA 4QF2A 3G0JA 4QC3A 4LC2A 3T7LA 3I2DA 1WUGA 5HRXA 4B86C 4QSTA 2VJFA 1HYJA 4TZ8A 4YYGA 5FE5A 5II1A 4C67A 5I3LA 2R10A 3ZPV1 5FG5A 3LJWA 2JRJA 2YHNA 4A9IA 4LK9A 3DAIA 2CKLA 1X4JA 4HXSA 4CURA 4LYWA 5DINA 4YAXA 4LRGA 5TDRA 4AUQB 2CT2A 3U5PA 5G04B 4ZC9A 4UIYA 5HENA 5E3GA 2YYNA 2L80A 4Z6IA 5EWVA 2N9GA 3UV4A 5LCWB 3KNVA 1FBVA 1VD4A 3O34A 2RNYA 2IDAA 1T1HA 5A5SA 3N9LA 4LZ2A 4QYDA 2RI7A 3U5LA 5EM3A 5CUDA 4A9OA 5II2A 5LKXA 5CTLA 1WENA 2KFTA 5EA1A 4TS8A 2F42A 2KTBB 4DONA 5F1LA 2MNYA 4YYNA 3C6WA 4LZSA 5CQ4A 5DFDA 4QSSA 4ZW1A 3UV2A 2MD8C 4TKPB 2BAYA 5BT5A 5H9MA 5E7DA 3MULA 4CFLA 3UVXA 2VPBA 2VPDA 5A5PA 5AD3A 5DW2A 5B75A 5F62A 4Z1SA 5G0FA 1WUMA 5L8UA 2H0DA 2FSAA 5CFWA 4AYCA 4HXKA 3ZVZB 5B79A 2YT5A 4A9FA 2D8SA 5EVAA 4MENA 4CUTA 4TZ2A 4ZUXU 3LQIA 5LKTA 2KWKA 4QNSA 5FFWA 5JWMA 4IR4A 1MM3A 5CUBA 5K29A 3UW9A 5H1UA 3SHBA 5DX4A 5L96A 4GNDA 5EYAF 5EPBA 5I89A 4PCEA 4QR4A 4O7BA 5DLXA 4CUQA 4WHUA 2DWWA 5ENCA 1WEPA 4I7DA 2YSJA 2KIZA 3PURA 5EGUA 2YYRA 1WEOA 1Z60A 5CS8A 2WP2A 4XYAA 4Q0OA 3SVGA 2R0YA 4O78A 4TT2A 5E3DA 5CGPA 5ENIA 5CP5A 4GNEA 1N72A 4QYLA 1JM7B 4W4UA 2R0VA 5KO4A 5HFQA 5FEYA 4O64A 5I80A 2OXQC 4O71A 3ONIA 3P1FA 4YADA 5I7XA 4QSRA 2LGLA 4QR3A 4A9LA 5FE9A 4GNGA 4BBQA 4J0RA 4UYFB 4O7AA 5DFBA 4OUFA 5KHMA 4TQNA 4XY9A 4HXMA 5CPEA 5IGMA 2XB1A 5COIA 5ETBA 4IR6A 4YH3A 3JVLA 5EK9A 4BW4A 2ECJA 1HYIA 4LR6A 5B77A 4NUCA 4YATA 4QF3A 5TB6A 5FH6A 5FE0A 5FE6A 4YBMA 4CUPA 4FIPA 3DPLR 4NRAA 5E9MA 1JOCA 3ZTGA 3HMHA 5D3JA 2YW8A 4J1PA 5I1QA 4N4IA 3O35A 2RNWA 4KCXA 1WFKA 3HCTA 2E7NA 5A5OA 4MR3A 4X2IA 5HQ5A 4QSQA 2DVQA 4NN2A 5C4QA 5I86A 2YSMA 5DBMA 4NYWA 5FB0A 4NYVA 5F1HA 2E7OA 2G6QA 3VK6A 5E74A 3ZYUA 1K2FA 5E9KA 5IIDA 2LRIC 3QZTA 4NS5A 2ECGA 2KE1A 5L97A 2WP1A 5B76A 2M1RA 5I40A 4NRCA 4QEVA 4XY8A 3LRQA 2YEKA 4QEUA 3EB6A 2RFJA 5DKAA 5TRBA 1LDJB 5F5ZA 5A85A
chains in the Genus database with same CATH superfamily
3DWDA 3AQAA 4R2YA 4Z6HA 4O70A 5LKUA 1WEWA 5FG6A 4HXOA 1WEUA 4MR5A 5EI4A 2CSYA 3MUKA 2RSDA 2MD7B 3MHSA 1JM4B 4CFKA 4UYGA 4QB3A 5ETDA 4AP4A 1JM7A 5JI8A 3UVWA 2ECTA 1WGMA 1G25A 4QSUA 5F60A 3IU6A 5D1KB 4UP5A 4QEWA 2RR4A 4Z0RA 5D3TA 2LGGA 4NYXA 4RVRA 3GL6A 4AVXA 4BHWA 4F3IA 3V43A 4ZQLA 4YBSA 5LVRA 1WEEA 3IHPA 4LYSA 4UYFA 2KWJA 5AIUA 5FG4A 1E4UA 5EQ1A 5BT4A 4FLPA 4HXRA 2YDWA 5HJCA 2R0SA 5CQ5A 4A9NA 2L5EA 4O74A 2L75A 2EGPA 3TLPA 1XWHA 2LV9A 2MT5A 4HBWA 2YURA 2L43A 2DVSA 3N9NA 4UI9B 5KH9A 4QUUA 3SOWA 5FBXA 5FFYA 4KV1A 5DYXA 2DKWA 5AMEA 2OUOA 5LJ0A 4QSVA 2EGMA 4YBTA 3EB5A 3N9QA 5K3QA 4WHWA 5C89A 2F6NA 4HXPA 4O76A 5EPSA 2NAAA 5TABA 4HBXA 4WIVA 3P1DA 3KV5A 2YQDA 5FE3A 2LGKA 4Q6FA 1WEQA 5LJ2A 5FH8A 2K16A 4CL9A 2MUMA 4I7CA 4XUBA 2P57A 2QJ0A 4S3OC 1CHCA 2I50A 4MEOA 2G45A 3HTKC 4MEQA 2DJAA 4YYHA 1RMDA 5I83A 4UP0A 5D26A 5D24A 5LUUA 2VNFA 4MR4A 1WESA 4IOQA 1Z2QA 3O7AA 4TU4A 3ASLA 5EP7A 5DY7A 3NG2A 3LVRE 2JMIA 2XOYA 3HMEA 4QQ4A 2G43A 3FAOA 5CRZA 4GB0A 3KDEC 5H85A 4I7BA 5D1MB 3NXBA 4UYHA 2L7PA 5EPRA 3JUEA 2MNZA 2EA6A 1VFYA 3N9PA 2MJVB 2KKYA 4Q0NA 2KGGA 5CQ8A 2D9EA 2L0BA 3FM8C 5AITA 4BW3A 5EV9A 5FFVA 3U5JA 4A4BA 5D3LA 5ENFA 2M85A 4QR5A 3FL2A 2FUIA 4FK5A 5AD2A 4WZ3B 3HMFA 2GRCA 5ENEA 2DVRA 5HQ6A 1N87A 5ENHA 3RTRB 1F62A 4HBYA 5C7NA 5ENBA 2L5UA 4O62A 5CUAA 5TDWA 3FEHA 4B7YC 5H1VA 5HEMA 3ZNIA 4R8PK 2ECWA 2E6SA 5BT3A 3UVYA 2KKXA 5LKZA 5FE2A 3Q2FA 5CQAA 5HELA 3IU5A 5DYAA 1Z6UA 3O33A 5EU1A 4A9EA 2FUUA 2VJEB 4AKHA 3S91A 3PLWA 5HCLA 4MSXA 3M63A 4YYDA 5I7YA 3P5OA 5E9LA 2JMJA 4ALGA 3H7HA 3RPGC 3ZYQA 1U6GB 5D1LB 2LXPC 3L1XA 3SUBA 1BORA 5A83A 4YYIA 1LDKC 2CSZA 3E2DA 5D3HA 5C87A 3O70A 4H9DA 5CQ6A 5HRWA 3PUQA 5KH3A 4FO9A 3LQHA 3G0LA 5DYUA 4YC9A 5F2PA 3L11A 1ZS5A 5C85A 5IGNA 2JMDA 5CQTA 4CUSA 4IR5A 2LSPB 4TT4A 3U5MA 4NR9A 4NRBA 5ENGA 4CUUA 4AKIA 2EODA 3AADA 2KWOA 5D7XA 4NR4A 2H60A 4QBMA 5LJ1A 4O7EA 4UIUA 3HCSA 2G4AA 4IR3A 1V87A 2I8NA 2OO1A 5F63A 4GPJA 4OGJA 3ERRA 4O72A 2ZETC 2MA6A 5E9IA 2VP7A 2YHOA 2RS9B 4O7CA 2XOZA 4PPEA 4WZ0A 5C11A 4TU6A 3N9OA 3O36A 4N3WA 5D3NA 5EWDA 5HM0A 4ZDTA 4Z93A 5DKDA 3DWYA 5I29A 4LYIA 4TYLA 3UVDA 2KU3A 2LN0A 2OWAA 4V3KC 4A0CD 3P1CA 4UIZA 4BW2A 4QSPA 3T9KA 4MEPA 3PHDA 1FP0A 4A9MA 5HLSA 5B78A 4Z1QA 1MM2A 1IYMA 3D7CA 2YELA 5KTXA 2ECIA 2YQMA 4P5OB 3T6RA 5FE8A 5CUCA 3ZVYA 5J3XA 4NQMA 2KWNA 4YYKA 2KYUA 5A7CA 5DW1A 4QSXA 5ENJA 5FE7A 2Y43A 2DSMA 3LJUX 1WILA 3ZPVE 4N4GA 4O75A 4QSWA 2DVVA 4TTEA 4ALHA 4A49A 1WE9A 3QZVA 5CQ3A 1DVPA 3I3JA 5DFCA 4V3LC 5L99A 4HXLA 4IORA 4L7XA 3U5OA 4MR6A 3QZSA 5F25A 5L98A 2VJEA 4NR8A 5DYCA 2L84A 5HQ7A 2OSSA 2NXBA 3P1EA 3RPGB 4GNFA 5IBNA 4NR7A 4A9HA 4BW1A 5FDZA 4Y03A 2C2VS 5D3PA 2QIZA 4OGIA 4N4FA 4QUTA 5IGLA 3M62A 4PY6A 2QICA 4YYJA 4NR6A 4TT6A 3VKHA 3D1BA 5E73A 4WA6A 5DLZA 5TCMA 4IC2A 4F52B 2EJNA 2D82A 2YREA 2M3HA 3FKMX 1WEVA 4PS5A 4YK0A 3JVMA 1ZBDB 4AKNA 2YUCA 4AKGA 2E6RA 2LQ6A 4LKAA 2ECNA 5F36A 3SVHA 3SOUA 5A5RA 4J0SA 5G05B 5FB1A 4OGEA 4PKLA 5FE4A 4UIVA 4BJXA 4A4CA 4XUAA 2MIQA 4CLBA 4XI1A 2RNXA 5IG6A 4YY6A 3FJUB 4LJNA 3SVFA 1E6IA 4YABA 3MXFA 3RCWA 3UV5A 2LXHC 5CZGA 4R7EA 5B8DA 2YEMA 3LQJA 2YQLA 2Y1MA 3GG3A 5CRMA 3N9MA 4YY4A 3KQIA 5JG6A 4FJCA 2F6JA 3U5KA 5ACYA 4C66A 4CCGX 4J3IA 5J0DA 1WIMA 5DKHA 5G4RA 5HRVA 4L58A 2KREA 5D3SA 5EICA 3KV6A 5A81A 2K4DA 1PUOA 2PUYA 4HXNA 1X0JA 3MB3A 5KTWA 2VJFB 5IGKA 5F61A 4NUEA 3SOXA 2VPEA 4UYEA 5HFRA 1MBMA 5TBNA 4PTBA 3S92A 2UZGA 4X3GA 5CUGA 5D3RA 2CKLB 5KH7A 3L1ZB 5E9VA 5DKCA 4UYDA 5A5QA 4NXJA 4HBVA 3O37A 1X4IA 3DQVR 2FFWA 3MB4A 2I7KA 2XEUA 4WZ2A 2VPGA 3LDYA 4YYMA 4QY4A 1X4UA 4QC1A 5D25A 2K1JA 2RO1A 5EWWA 4IC3A 5FH7A 4N4HA 4NR5A 5E0RA 3M7KA 4E96A 5LVQA 3LVQE 2E3KA 4KV4A 3FANA 2B0OE 3JVJA 5A82A 2Y1NA 2YU4A 3MHHA 3MQMA 1EQFA 5CU8A 5CQ7A 3LXJA 5H1TA 5KU3A 4S3OB 2XOCA 4UITA 1JSPB 4LLBA 3M99A 2HDPA 3K2JA 2L85A 1VYXA 2DATA 4O7FA 1F68A 5G4SA 4LDFA 4LZRA 4QZSA 3JVKA 4A9JA 2AN6A 4LADB 4IOOA 5E9YA 4NQNA 4A9KA 4YH4A 4O77A 5EISA 5D0CA 2C2LA 2H0DB 4AYCB 4C9ZA 4PCIA 5EWHA 2ECVA 2HYED 2MA5A 2LDRA 2YW5A 5F3AA 3Q2EA 4NUDA 5I88A 4UIXA 5FE1A 1WEMA 4MVTA 5FERA 3HCUA 2LGVA 3Q1DA 3C5KA 3GV4A 2K17A 5A5NA 5KTUA 5AMFA 5CUEA 5C8GA 5L8TA 2DX8A 5C13A 2PNXA 2XP0A 2M6MA 4UIWA 5CY9A 5SVIB 4CA1A 2KR4A 3U5NA 5EWCA 2KGIA 4QF2A 3G0JA 2M13A 4QC3A 4LC2A 3T7LA 2EXUA 3I2DA 1WUGA 5HRXA 4B86C 4QSTA 2VJFA 1HYJA 4TZ8A 4YYGA 5FE5A 5II1A 4C67A 5I3LA 2R10A 3ZPV1 5FG5A 3LJWA 3VKGA 2JRJA 2YHNA 4A9IA 4LK9A 3DAIA 2CKLA 1X4JA 4HXSA 4CURA 4LYWA 5DINA 4YAXA 4LRGA 2CRRA 5TDRA 2CT2A 4AUQB 3U5PA 5G04B 4ZC9A 4UIYA 5HENA 5E3GA 2YYNA 2L80A 4Z6IA 5EWVA 2N9GA 3UV4A 5LCWB 3KNVA 1FBVA 1VD4A 3O34A 2RNYA 2IDAA 1T1HA 5A5SA 3N9LA 4LZ2A 4QYDA 2RI7A 2E61A 1ZKRA 3U5LA 5EM3A 5CUDA 4A9OA 5II2A 5LKXA 5CTLA 1WENA 2KFTA 5EA1A 4TS8A 2F42A 2KTBB 4DONA 3MDBC 5SVXA 5F1LA 2MNYA 4YYNA 3C6WA 4LZSA 5CQ4A 5DFDA 4QSSA 4ZW1A 3UV2A 2CONA 4F1PA 2MD8C 4TKPB 2BAYA 5BT5A 5H9MA 5E7DA 3MULA 4AI6A 4CFLA 3UVXA 2VPBA 2VPDA 5A5PA 5AD3A 2FD4A 5DW2A 5B75A 2JM3A 5F62A 4Z1SA 5G0FA 1WUMA 5L8UA 2H0DA 2FSAA 5CFWA 4AYCA 4HXKA 3ZVZB 5B79A 2YT5A 4A9FA 2D8SA 5EVAA 4MENA 4CUTA 4TZ2A 4ZUXU 3LQIA 5LKTA 2CSVA 2KWKA 4QNSA 5FFWA 5JWMA 1DCQA 4IR4A 1MM3A 4OGCA 5CUBA 5K29A 3UW9A 5H1UA 3SHBA 4Z0OA 5DX4A 5L96A 4GNDA 5EYAF 5EPBA 5SVIA 5I89A 4PCEA 4QR4A 4O7BA 5DLXA 4CUQA 4WHUA 2DWWA 5ENCA 5SVYA 1WEPA 4I7DA 2YSJA 2KIZA 3PURA 5EGUA 2YYRA 2D8UA 1WEOA 1Z60A 5CS8A 2WP2A 4XYAA 4Q0OA 3SVGA 2R0YA 4O78A 4TT2A 5E3DA 5CGPA 5ENIA 5CP5A 4GNEA 1N72A 3D1DA 4QYLA 2CRWA 4W4UA 1JM7B 2R0VA 5KO4A 5HFQA 2IQJA 5FEYA 4O64A 5I80A 2OXQC 4O71A 3ONIA 3P1FA 4YADA 5I7XA 4QSRA 2LGLA 4QR3A 4A9LA 5FE9A 4GNGA 4BBQA 4J0RA 4UYFB 4O7AA 5DFBA 4OUFA 5KHMA 4TQNA 4XY9A 4HXMA 5CPEA 5IGMA 2XB1A 5COIA 5ETBA 2MKEA 3DDTA 4IR6A 4YH3A 2JUNA 3JVLA 5EK9A 4BW4A 2ECJA 1HYIA 4LR6A 5B77A 4NUCA 4YATA 4QF3A 5TB6A 5FH6A 5FE0A 3O47A 5FE6A 4YBMA 4CUPA 4FIPA 3DPLR 4NRAA 5E9MA 1JOCA 3ZTGA 3HMHA 5D3JA 2YW8A 4J1PA 5I1QA 4N4IA 3O35A 2RNWA 4KCXA 1WFKA 3HCTA 2LAUA 2E7NA 5A5OA 4MR3A 4X2IA 5HQ5A 4QSQA 2DVQA 4NN2A 5C4QA 5I86A 2YSMA 5DBMA 4NYWA 5FB0A 4NYVA 5F1HA 2E7OA 2G6QA 3VK6A 5E74A 3ZYUA 2YVRA 1K2FA 5E9KA 5IIDA 2LRIC 3QZTA 4NS5A 2ECGA 2KE1A 5L97A 2WP1A 5B76A 2M1RA 5I40A 4NRCA 4QEVA 4XY8A 3LRQA 2YEKA 4QEUA 3EB6A 2RFJA 5DKAA 5TRBA 1LDJB 5F5ZA 5A85A
chains in the Genus database with same CATH topology
3AQAA 4R2YA 4Z6HA 4O70A 5LKUA 1WEWA 5FG6A 4HXOA 1WEUA 4MR5A 5EI4A 2CSYA 3MUKA 2RSDA 2MD7B 3MHSA 1JM4B 4CFKA 4UYGA 4QB3A 5ETDA 4AP4A 1JM7A 5JI8A 3UVWA 2ECTA 1WGMA 1G25A 4QSUA 5F60A 3IU6A 5D1KB 4UP5A 4QEWA 5D3TA 2LGGA 4NYXA 4RVRA 3GL6A 4AVXA 4BHWA 4F3IA 3V43A 4ZQLA 4YBSA 5LVRA 1WEEA 3IHPA 4LYSA 4UYFA 2KWJA 5AIUA 5FG4A 1E4UA 5EQ1A 5BT4A 4FLPA 4HXRA 2YDWA 5HJCA 2R0SA 5CQ5A 4A9NA 2L5EA 4O74A 2L75A 2EGPA 3TLPA 1XWHA 2LV9A 2MT5A 4HBWA 2YURA 2L43A 2DVSA 3N9NA 4UI9B 5KH9A 4QUUA 3SOWA 5FBXA 5FFYA 4KV1A 5DYXA 2DKWA 5AMEA 2OUOA 5LJ0A 4QSVA 3EB5A 4YBTA 3N9QA 4WHWA 5C89A 2F6NA 4HXPA 4O76A 5EPSA 2NAAA 5TABA 4HBXA 4WIVA 3P1DA 3KV5A 2YQDA 5FE3A 2LGKA 4Q6FA 1WEQA 5LJ2A 5FH8A 2K16A 4CL9A 2MUMA 4I7CA 4XUBA 2QJ0A 4S3OC 1CHCA 2I50A 4MEOA 2G45A 3HTKC 4MEQA 4YYHA 1RMDA 5I83A 4UP0A 5D26A 5D24A 5LUUA 2VNFA 4MR4A 1WESA 4IOQA 1Z2QA 3O7AA 4TU4A 3ASLA 5EP7A 5DY7A 3NG2A 2JMIA 3HMEA 2G43A 4GB0A 5CRZA 5H85A 4I7BA 5D1MB 3NXBA 4UYHA 5EPRA 2MNZA 2EA6A 1VFYA 3N9PA 2MJVB 4Q0NA 2KGGA 5CQ8A 2D9EA 2L0BA 5AITA 4BW3A 5EV9A 5FFVA 3U5JA 4A4BA 5D3LA 5ENFA 2M85A 4QR5A 3FL2A 2FUIA 4FK5A 5AD2A 4WZ3B 3HMFA 2GRCA 5ENEA 2DVRA 5HQ6A 1N87A 5ENHA 3RTRB 1F62A 4HBYA 5C7NA 5ENBA 2L5UA 5CUAA 5TDWA 4B7YC 5H1VA 5HEMA 3ZNIA 4R8PK 2ECWA 2E6SA 5BT3A 3UVYA 5LKZA 5FE2A 3Q2FA 5CQAA 5HELA 3IU5A 5DYAA 1Z6UA 3O33A 5EU1A 4A9EA 2FUUA 2VJEB 3S91A 5HCLA 4MSXA 3M63A 4YYDA 5I7YA 3P5OA 5E9LA 2JMJA 4ALGA 3ZYQA 3RPGC 1U6GB 5D1LB 2LXPC 3L1XA 1BORA 5A83A 4YYIA 1LDKC 2CSZA 5D3HA 5C87A 3O70A 5CQ6A 5HRWA 3PUQA 5KH3A 4FO9A 3LQHA 3G0LA 5DYUA 4YC9A 5F2PA 3L11A 1ZS5A 5C85A 5IGNA 2JMDA 5CQTA 4CUSA 4IR5A 2LSPB 4TT4A 3U5MA 4NR9A 4NRBA 5ENGA 4CUUA 2EODA 3AADA 2KWOA 5D7XA 4NR4A 2H60A 4QBMA 5LJ1A 4O7EA 4UIUA 3HCSA 2G4AA 4IR3A 1V87A 2I8NA 2OO1A 5F63A 4GPJA 4OGJA 2ZETC 4O72A 2MA6A 5E9IA 2VP7A 2YHOA 2RS9B 4O7CA 4PPEA 4WZ0A 5C11A 4TU6A 3N9OA 3O36A 4N3WA 5D3NA 5EWDA 5HM0A 4ZDTA 4Z93A 5DKDA 3DWYA 5I29A 4LYIA 4TYLA 3UVDA 2KU3A 2LN0A 4V3KC 4A0CD 3P1CA 4UIZA 4BW2A 4QSPA 4MEPA 3PHDA 1FP0A 4A9MA 5HLSA 5B78A 4Z1QA 1MM2A 1IYMA 3D7CA 2YELA 5KTXA 2ECIA 2YQMA 4P5OB 3T6RA 5FE8A 5CUCA 3ZVYA 5J3XA 4NQMA 2KWNA 4YYKA 2KYUA 5A7CA 5DW1A 4QSXA 5ENJA 5FE7A 2Y43A 3ZPVE 1WILA 4N4GA 4O75A 4QSWA 2DVVA 4TTEA 4ALHA 4A49A 1WE9A 3QZVA 5CQ3A 1DVPA 3I3JA 5DFCA 4V3LC 5L99A 4HXLA 4IORA 4L7XA 3U5OA 4MR6A 3QZSA 5F25A 5L98A 2VJEA 4NR8A 5DYCA 2L84A 5HQ7A 2OSSA 2NXBA 3P1EA 3RPGB 4GNFA 5IBNA 4NR7A 4A9HA 4BW1A 5FDZA 4Y03A 2C2VS 5D3PA 2QIZA 4OGIA 4N4FA 4QUTA 5IGLA 3M62A 4PY6A 2QICA 4YYJA 4NR6A 4TT6A 5E73A 4WA6A 5DLZA 5TCMA 4IC2A 4F52B 2D82A 2YREA 2M3HA 3FKMX 1WEVA 4PS5A 4YK0A 3JVMA 1ZBDB 4AKNA 2YUCA 2E6RA 2LQ6A 4LKAA 2ECNA 5F36A 3SVHA 3SOUA 5A5RA 4J0SA 5G05B 5FB1A 4PKLA 5FE4A 4UIVA 4BJXA 4A4CA 4XUAA 2MIQA 4CLBA 4XI1A 2RNXA 5IG6A 4YY6A 4LJNA 3SVFA 1E6IA 4YABA 3MXFA 3RCWA 3UV5A 2LXHC 5CZGA 4R7EA 5B8DA 2YEMA 3LQJA 2YQLA 2Y1MA 3GG3A 5CRMA 3N9MA 4YY4A 3KQIA 5JG6A 4FJCA 2F6JA 3U5KA 5ACYA 4C66A 4CCGX 4J3IA 5J0DA 1WIMA 5DKHA 5G4RA 5HRVA 4L58A 2KREA 5D3SA 5EICA 3KV6A 5A81A 2K4DA 2PUYA 4HXNA 1X0JA 3MB3A 5KTWA 2VJFB 5IGKA 5F61A 4NUEA 3SOXA 2VPEA 4UYEA 5HFRA 5TBNA 4PTBA 3S92A 2UZGA 4X3GA 5CUGA 5D3RA 2CKLB 5KH7A 3L1ZB 5E9VA 5DKCA 4UYDA 5A5QA 4NXJA 4HBVA 3O37A 1X4IA 3DQVR 3MB4A 2I7KA 2XEUA 4WZ2A 2VPGA 4YYMA 4QY4A 1X4UA 4QC1A 5D25A 2K1JA 2RO1A 5EWWA 4IC3A 5FH7A 4N4HA 4NR5A 5E0RA 4E96A 5LVQA 2E3KA 4KV4A 3JVJA 5A82A 2Y1NA 2YU4A 3MHHA 3MQMA 1EQFA 5CU8A 5CQ7A 3LXJA 5H1TA 5KU3A 4S3OB 4UITA 1JSPB 4LLBA 3M99A 2HDPA 3K2JA 2L85A 1VYXA 2DATA 4O7FA 1F68A 5G4SA 4LDFA 4LZRA 4QZSA 3JVKA 4A9JA 2AN6A 4LADB 4IOOA 5E9YA 4NQNA 4A9KA 4YH4A 4O77A 5EISA 5D0CA 2C2LA 2H0DB 4AYCB 4C9ZA 4PCIA 5EWHA 2ECVA 2HYED 2MA5A 2LDRA 2YW5A 5F3AA 3Q2EA 4NUDA 5I88A 4UIXA 5FE1A 1WEMA 4MVTA 5FERA 3HCUA 2LGVA 3C5KA 3GV4A 2K17A 5A5NA 5KTUA 5AMFA 5CUEA 5C8GA 5L8TA 2DX8A 5C13A 2PNXA 2M6MA 4UIWA 5CY9A 4CA1A 2KR4A 3U5NA 5EWCA 2KGIA 4QF2A 3G0JA 4QC3A 4LC2A 3T7LA 3I2DA 1WUGA 5HRXA 4B86C 4QSTA 2VJFA 1HYJA 4TZ8A 4YYGA 5FE5A 5II1A 4C67A 5I3LA 2R10A 3ZPV1 5FG5A 3LJWA 2JRJA 2YHNA 4A9IA 4LK9A 3DAIA 2CKLA 1X4JA 4HXSA 4CURA 4LYWA 5DINA 4YAXA 4LRGA 5TDRA 4AUQB 2CT2A 3U5PA 5G04B 4ZC9A 4UIYA 5HENA 5E3GA 2YYNA 2L80A 4Z6IA 5EWVA 2N9GA 3UV4A 5LCWB 3KNVA 1FBVA 1VD4A 3O34A 2RNYA 2IDAA 1T1HA 5A5SA 3N9LA 4LZ2A 4QYDA 2RI7A 3U5LA 5EM3A 5CUDA 4A9OA 5II2A 5LKXA 5CTLA 1WENA 2KFTA 5EA1A 4TS8A 2F42A 2KTBB 4DONA 5F1LA 2MNYA 4YYNA 3C6WA 4LZSA 5CQ4A 5DFDA 4QSSA 4ZW1A 3UV2A 2MD8C 4TKPB 2BAYA 5BT5A 5H9MA 5E7DA 3MULA 4CFLA 3UVXA 2VPBA 2VPDA 5A5PA 5AD3A 5DW2A 5B75A 5F62A 4Z1SA 5G0FA 1WUMA 5L8UA 2H0DA 2FSAA 5CFWA 4AYCA 4HXKA 3ZVZB 5B79A 2YT5A 4A9FA 2D8SA 5EVAA 4MENA 4CUTA 4TZ2A 4ZUXU 3LQIA 5LKTA 2KWKA 4QNSA 5FFWA 5JWMA 4IR4A 1MM3A 5CUBA 5K29A 3UW9A 5H1UA 3SHBA 5DX4A 5L96A 4GNDA 5EYAF 5EPBA 5I89A 4PCEA 4QR4A 4O7BA 5DLXA 4CUQA 4WHUA 2DWWA 5ENCA 1WEPA 4I7DA 2YSJA 2KIZA 3PURA 5EGUA 2YYRA 1WEOA 1Z60A 5CS8A 2WP2A 4XYAA 4Q0OA 3SVGA 2R0YA 4O78A 4TT2A 5E3DA 5CGPA 5ENIA 5CP5A 4GNEA 1N72A 4QYLA 1JM7B 4W4UA 2R0VA 5KO4A 5HFQA 5FEYA 4O64A 5I80A 2OXQC 4O71A 3ONIA 3P1FA 4YADA 5I7XA 4QSRA 2LGLA 4QR3A 4A9LA 5FE9A 4GNGA 4BBQA 4J0RA 4UYFB 4O7AA 5DFBA 4OUFA 5KHMA 4TQNA 4XY9A 4HXMA 5CPEA 5IGMA 2XB1A 5COIA 5ETBA 4IR6A 4YH3A 3JVLA 5EK9A 4BW4A 2ECJA 1HYIA 4LR6A 5B77A 4NUCA 4YATA 4QF3A 5TB6A 5FH6A 5FE0A 5FE6A 4YBMA 4CUPA 4FIPA 3DPLR 4NRAA 5E9MA 1JOCA 3ZTGA 3HMHA 5D3JA 2YW8A 4J1PA 5I1QA 4N4IA 3O35A 2RNWA 4KCXA 1WFKA 3HCTA 2E7NA 5A5OA 4MR3A 4X2IA 5HQ5A 4QSQA 2DVQA 4NN2A 5C4QA 5I86A 2YSMA 5DBMA 4NYWA 5FB0A 4NYVA 5F1HA 2E7OA 2G6QA 3VK6A 5E74A 3ZYUA 1K2FA 5E9KA 5IIDA 2LRIC 3QZTA 4NS5A 2ECGA 2KE1A 5L97A 2WP1A 5B76A 2M1RA 5I40A 4NRCA 4QEVA 4XY8A 3LRQA 2YEKA 4QEUA 3EB6A 2RFJA 5DKAA 5TRBA 1LDJB 5F5ZA 5A85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQA A;  4R2Y A;  4Z6H A;  4O70 A;  5LKU A;  1WEW A;  5FG6 A;  4HXO A;  1WEU A;  4MR5 A;  5EI4 A;  2CSY A;  3MUK A;  2RSD A;  2MD7 B;  3MHS A;  1JM4 B;  4CFK A;  4UYG A;  4QB3 A;  5ETD A;  4AP4 A;  1JM7 A;  5JI8 A;  3UVW A;  2ECT A;  1WGM A;  1G25 A;  4QSU A;  5F60 A;  3IU6 A;  5D1K B;  4UP5 A;  4QEW A;  5D3T A;  2LGG A;  4NYX A;  4RVR A;  3GL6 A;  4AVX A;  4BHW A;  4F3I A;  3V43 A;  4ZQL A;  4YBS A;  5LVR A;  1WEE A;  3IHP A;  4LYS A;  4UYF A;  2KWJ A;  5AIU A;  5FG4 A;  1E4U A;  5EQ1 A;  5BT4 A;  4FLP A;  4HXR A;  2YDW A;  5HJC A;  2R0S A;  5CQ5 A;  4A9N A;  2L5E A;  4O74 A;  2L75 A;  2EGP A;  3TLP A;  1XWH A;  2LV9 A;  2MT5 A;  4HBW A;  2YUR A;  2L43 A;  2DVS A;  3N9N A;  4UI9 B;  5KH9 A;  4QUU A;  3SOW A;  5FBX A;  5FFY A;  4KV1 A;  5DYX A;  2DKW A;  5AME A;  2OUO A;  5LJ0 A;  4QSV A;  3EB5 A;  4YBT A;  3N9Q A;  4WHW A;  5C89 A;  2F6N A;  4HXP A;  4O76 A;  5EPS A;  2NAA A;  5TAB A;  4HBX A;  4WIV A;  3P1D A;  3KV5 A;  2YQD A;  5FE3 A;  2LGK A;  4Q6F A;  1WEQ A;  5LJ2 A;  5FH8 A;  2K16 A;  4CL9 A;  2MUM A;  4I7C A;  4XUB A;  2QJ0 A;  4S3O C;  1CHC A;  2I50 A;  4MEO A;  2G45 A;  3HTK C;  4MEQ A;  4YYH A;  1RMD A;  5I83 A;  4UP0 A;  5D26 A;  5D24 A;  5LUU A;  2VNF A;  4MR4 A;  1WES A;  4IOQ A;  1Z2Q A;  3O7A A;  4TU4 A;  3ASL A;  5EP7 A;  5DY7 A;  3NG2 A;  2JMI A;  3HME A;  2G43 A;  4GB0 A;  5CRZ A;  5H85 A;  4I7B A;  5D1M B;  3NXB A;  4UYH A;  5EPR A;  2MNZ A;  2EA6 A;  1VFY A;  3N9P A;  2MJV B;  4Q0N A;  2KGG A;  5CQ8 A;  2D9E A;  2L0B A;  5AIT A;  4BW3 A;  5EV9 A;  5FFV A;  3U5J A;  4A4B A;  5D3L A;  5ENF A;  2M85 A;  4QR5 A;  3FL2 A;  2FUI A;  4FK5 A;  5AD2 A;  4WZ3 B;  3HMF A;  2GRC A;  5ENE A;  2DVR A;  5HQ6 A;  1N87 A;  5ENH A;  3RTR B;  1F62 A;  4HBY A;  5C7N A;  5ENB A;  2L5U A;  5CUA A;  5TDW A;  4B7Y C;  5H1V A;  5HEM A;  3ZNI A;  4R8P K;  2ECW A;  2E6S A;  5BT3 A;  3UVY A;  5LKZ A;  5FE2 A;  3Q2F A;  5CQA A;  5HEL A;  3IU5 A;  5DYA A;  1Z6U A;  3O33 A;  5EU1 A;  4A9E A;  2FUU A;  2VJE B;  3S91 A;  5HCL A;  4MSX A;  3M63 A;  4YYD A;  5I7Y A;  3P5O A;  5E9L A;  2JMJ A;  4ALG A;  3ZYQ A;  3RPG C;  1U6G B;  5D1L B;  2LXP C;  3L1X A;  1BOR A;  5A83 A;  4YYI A;  1LDK C;  2CSZ A;  5D3H A;  5C87 A;  3O70 A;  5CQ6 A;  5HRW A;  3PUQ A;  5KH3 A;  4FO9 A;  3LQH A;  3G0L A;  5DYU A;  4YC9 A;  5F2P A;  3L11 A;  1ZS5 A;  5C85 A;  5IGN A;  2JMD A;  5CQT A;  4CUS A;  4IR5 A;  2LSP B;  4TT4 A;  3U5M A;  4NR9 A;  4NRB A;  5ENG A;  4CUU A;  2EOD A;  3AAD A;  2KWO A;  5D7X A;  4NR4 A;  2H60 A;  4QBM A;  5LJ1 A;  4O7E A;  4UIU A;  3HCS A;  2G4A A;  4IR3 A;  1V87 A;  2I8N A;  2OO1 A;  5F63 A;  4GPJ A;  4OGJ A;  2ZET C;  4O72 A;  2MA6 A;  5E9I A;  2VP7 A;  2YHO A;  2RS9 B;  4O7C A;  4PPE A;  4WZ0 A;  5C11 A;  4TU6 A;  3N9O A;  3O36 A;  4N3W A;  5D3N A;  5EWD A;  5HM0 A;  4ZDT A;  4Z93 A;  5DKD A;  3DWY A;  5I29 A;  4LYI A;  4TYL A;  3UVD A;  2KU3 A;  2LN0 A;  4V3K C;  4A0C D;  3P1C A;  4UIZ A;  4BW2 A;  4QSP A;  4MEP A;  3PHD A;  1FP0 A;  4A9M A;  5HLS A;  5B78 A;  4Z1Q A;  1MM2 A;  1IYM A;  3D7C A;  2YEL A;  5KTX A;  2ECI A;  2YQM A;  4P5O B;  3T6R A;  5FE8 A;  5CUC A;  3ZVY A;  5J3X A;  4NQM A;  2KWN A;  4YYK A;  2KYU A;  5A7C A;  5DW1 A;  4QSX A;  5ENJ A;  5FE7 A;  2Y43 A;  3ZPV E;  1WIL A;  4N4G A;  4O75 A;  4QSW A;  2DVV A;  4TTE A;  4ALH A;  4A49 A;  1WE9 A;  3QZV A;  5CQ3 A;  1DVP A;  3I3J A;  5DFC A;  4V3L C;  5L99 A;  4HXL A;  4IOR A;  4L7X A;  3U5O A;  4MR6 A;  3QZS A;  5F25 A;  5L98 A;  2VJE A;  4NR8 A;  5DYC A;  2L84 A;  5HQ7 A;  2OSS A;  2NXB A;  3P1E A;  3RPG B;  4GNF A;  5IBN A;  4NR7 A;  4A9H A;  4BW1 A;  5FDZ A;  4Y03 A;  2C2V S;  5D3P A;  2QIZ A;  4OGI A;  4N4F A;  4QUT A;  5IGL A;  3M62 A;  4PY6 A;  2QIC A;  4YYJ A;  4NR6 A;  4TT6 A;  5E73 A;  4WA6 A;  5DLZ A;  5TCM A;  4IC2 A;  4F52 B;  2D82 A;  2YRE A;  2M3H A;  3FKM X;  1WEV A;  4PS5 A;  4YK0 A;  3JVM A;  1ZBD B;  4AKN A;  2YUC A;  2E6R A;  2LQ6 A;  4LKA A;  2ECN A;  5F36 A;  3SVH A;  3SOU A;  5A5R A;  4J0S A;  5G05 B;  5FB1 A;  4PKL A;  5FE4 A;  4UIV A;  4BJX A;  4A4C A;  4XUA A;  2MIQ A;  4CLB A;  4XI1 A;  2RNX A;  5IG6 A;  4YY6 A;  4LJN A;  3SVF A;  1E6I A;  4YAB A;  3MXF A;  3RCW A;  3UV5 A;  2LXH C;  5CZG A;  4R7E A;  5B8D A;  2YEM A;  3LQJ A;  2YQL A;  2Y1M A;  3GG3 A;  5CRM A;  3N9M A;  4YY4 A;  3KQI A;  5JG6 A;  4FJC A;  2F6J A;  3U5K A;  5ACY A;  4C66 A;  4CCG X;  4J3I A;  5J0D A;  1WIM A;  5DKH A;  5G4R A;  5HRV A;  4L58 A;  2KRE A;  5D3S A;  5EIC A;  3KV6 A;  5A81 A;  2K4D A;  2PUY A;  4HXN A;  1X0J A;  3MB3 A;  5KTW A;  2VJF B;  5IGK A;  5F61 A;  4NUE A;  3SOX A;  2VPE A;  4UYE A;  5HFR A;  5TBN A;  4PTB A;  3S92 A;  2UZG A;  4X3G A;  5CUG A;  5D3R A;  2CKL B;  5KH7 A;  3L1Z B;  5E9V A;  5DKC A;  4UYD A;  5A5Q A;  4NXJ A;  4HBV A;  3O37 A;  1X4I A;  3DQV R;  3MB4 A;  2I7K A;  2XEU A;  4WZ2 A;  2VPG A;  4YYM A;  4QY4 A;  1X4U A;  4QC1 A;  5D25 A;  2K1J A;  2RO1 A;  5EWW A;  4IC3 A;  5FH7 A;  4N4H A;  4NR5 A;  5E0R A;  4E96 A;  5LVQ A;  2E3K A;  4KV4 A;  3JVJ A;  5A82 A;  2Y1N A;  2YU4 A;  3MHH A;  3MQM A;  1EQF A;  5CU8 A;  5CQ7 A;  3LXJ A;  5H1T A;  5KU3 A;  4S3O B;  4UIT A;  1JSP B;  4LLB A;  3M99 A;  2HDP A;  3K2J A;  2L85 A;  1VYX A;  2DAT A;  4O7F A;  1F68 A;  5G4S A;  4LDF A;  4LZR A;  4QZS A;  3JVK A;  4A9J A;  2AN6 A;  4LAD B;  4IOO A;  5E9Y A;  4NQN A;  4A9K A;  4YH4 A;  4O77 A;  5EIS A;  5D0C A;  2C2L A;  2H0D B;  4AYC B;  4C9Z A;  4PCI A;  5EWH A;  2ECV A;  2HYE D;  2MA5 A;  2LDR A;  2YW5 A;  5F3A A;  3Q2E A;  4NUD A;  5I88 A;  4UIX A;  5FE1 A;  1WEM A;  4MVT A;  5FER A;  3HCU A;  2LGV A;  3C5K A;  3GV4 A;  2K17 A;  5A5N A;  5KTU A;  5AMF A;  5CUE A;  5C8G A;  5L8T A;  2DX8 A;  5C13 A;  2PNX A;  2M6M A;  4UIW A;  5CY9 A;  4CA1 A;  2KR4 A;  3U5N A;  5EWC A;  2KGI A;  4QF2 A;  3G0J A;  4QC3 A;  4LC2 A;  3T7L A;  3I2D A;  1WUG A;  5HRX A;  4B86 C;  4QST A;  2VJF A;  1HYJ A;  4TZ8 A;  4YYG A;  5FE5 A;  5II1 A;  4C67 A;  5I3L A;  2R10 A;  3ZPV 1;  5FG5 A;  3LJW A;  2JRJ A;  2YHN A;  4A9I A;  4LK9 A;  3DAI A;  2CKL A;  1X4J A;  4HXS A;  4CUR A;  4LYW A;  5DIN A;  4YAX A;  4LRG A;  5TDR A;  4AUQ B;  2CT2 A;  3U5P A;  5G04 B;  4ZC9 A;  4UIY A;  5HEN A;  5E3G A;  2YYN A;  2L80 A;  4Z6I A;  5EWV A;  2N9G A;  3UV4 A;  5LCW B;  3KNV A;  1FBV A;  1VD4 A;  3O34 A;  2RNY A;  2IDA A;  1T1H A;  5A5S A;  3N9L A;  4LZ2 A;  4QYD A;  2RI7 A;  3U5L A;  5EM3 A;  5CUD A;  4A9O A;  5II2 A;  5LKX A;  5CTL A;  1WEN A;  2KFT A;  5EA1 A;  4TS8 A;  2F42 A;  2KTB B;  4DON A;  5F1L A;  2MNY A;  4YYN A;  3C6W A;  4LZS A;  5CQ4 A;  5DFD A;  4QSS A;  4ZW1 A;  3UV2 A;  2MD8 C;  4TKP B;  2BAY A;  5BT5 A;  5H9M A;  5E7D A;  3MUL A;  4CFL A;  3UVX A;  2VPB A;  2VPD A;  5A5P A;  5AD3 A;  5DW2 A;  5B75 A;  5F62 A;  4Z1S A;  5G0F A;  1WUM A;  5L8U A;  2H0D A;  2FSA A;  5CFW A;  4AYC A;  4HXK A;  3ZVZ B;  5B79 A;  2YT5 A;  4A9F A;  2D8S A;  5EVA A;  4MEN A;  4CUT A;  4TZ2 A;  4ZUX U;  3LQI A;  5LKT A;  2KWK A;  4QNS A;  5FFW A;  5JWM A;  4IR4 A;  1MM3 A;  5CUB A;  5K29 A;  3UW9 A;  5H1U A;  3SHB A;  5DX4 A;  5L96 A;  4GND A;  5EYA F;  5EPB A;  5I89 A;  4PCE A;  4QR4 A;  4O7B A;  5DLX A;  4CUQ A;  4WHU A;  2DWW A;  5ENC A;  1WEP A;  4I7D A;  2YSJ A;  2KIZ A;  3PUR A;  5EGU A;  2YYR A;  1WEO A;  1Z60 A;  5CS8 A;  2WP2 A;  4XYA A;  4Q0O A;  3SVG A;  2R0Y A;  4O78 A;  4TT2 A;  5E3D A;  5CGP A;  5ENI A;  5CP5 A;  4GNE A;  1N72 A;  4QYL A;  1JM7 B;  4W4U A;  2R0V A;  5KO4 A;  5HFQ A;  5FEY A;  4O64 A;  5I80 A;  2OXQ C;  4O71 A;  3ONI A;  3P1F A;  4YAD A;  5I7X A;  4QSR A;  2LGL A;  4QR3 A;  4A9L A;  5FE9 A;  4GNG A;  4BBQ A;  4J0R A;  4UYF B;  4O7A A;  5DFB A;  4OUF A;  5KHM A;  4TQN A;  4XY9 A;  4HXM A;  5CPE A;  5IGM A;  2XB1 A;  5COI A;  5ETB A;  4IR6 A;  4YH3 A;  3JVL A;  5EK9 A;  4BW4 A;  2ECJ A;  1HYI A;  4LR6 A;  5B77 A;  4NUC A;  4YAT A;  4QF3 A;  5TB6 A;  5FH6 A;  5FE0 A;  5FE6 A;  4YBM A;  4CUP A;  4FIP A;  3DPL R;  4NRA A;  5E9M A;  1JOC A;  3ZTG A;  3HMH A;  5D3J A;  2YW8 A;  4J1P A;  5I1Q A;  4N4I A;  3O35 A;  2RNW A;  4KCX A;  1WFK A;  3HCT A;  2E7N A;  5A5O A;  4MR3 A;  4X2I A;  5HQ5 A;  4QSQ A;  2DVQ A;  4NN2 A;  5C4Q A;  5I86 A;  2YSM A;  5DBM A;  4NYW A;  5FB0 A;  4NYV A;  5F1H A;  2E7O A;  2G6Q A;  3VK6 A;  5E74 A;  3ZYU A;  1K2F A;  5E9K A;  5IID A;  2LRI C;  3QZT A;  4NS5 A;  2ECG A;  2KE1 A;  5L97 A;  2WP1 A;  5B76 A;  2M1R A;  5I40 A;  4NRC A;  4QEV A;  4XY8 A;  3LRQ A;  2YEK A;  4QEU A;  3EB6 A;  2RFJ A;  5DKA A;  5TRB A;  1LDJ B;  5F5Z A;  5A85 A; 
#chains in the Genus database with same CATH topology
 3DWD A;  3AQA A;  4R2Y A;  4Z6H A;  4O70 A;  5LKU A;  1WEW A;  5FG6 A;  4HXO A;  1WEU A;  4MR5 A;  5EI4 A;  2CSY A;  3MUK A;  2RSD A;  2MD7 B;  3MHS A;  1JM4 B;  4CFK A;  4UYG A;  4QB3 A;  5ETD A;  4AP4 A;  1JM7 A;  5JI8 A;  3UVW A;  2ECT A;  1WGM A;  1G25 A;  4QSU A;  5F60 A;  3IU6 A;  5D1K B;  4UP5 A;  4QEW A;  2RR4 A;  4Z0R A;  5D3T A;  2LGG A;  4NYX A;  4RVR A;  3GL6 A;  4AVX A;  4BHW A;  4F3I A;  3V43 A;  4ZQL A;  4YBS A;  5LVR A;  1WEE A;  3IHP A;  4LYS A;  4UYF A;  2KWJ A;  5AIU A;  5FG4 A;  1E4U A;  5EQ1 A;  5BT4 A;  4FLP A;  4HXR A;  2YDW A;  5HJC A;  2R0S A;  5CQ5 A;  4A9N A;  2L5E A;  4O74 A;  2L75 A;  2EGP A;  3TLP A;  1XWH A;  2LV9 A;  2MT5 A;  4HBW A;  2YUR A;  2L43 A;  2DVS A;  3N9N A;  4UI9 B;  5KH9 A;  4QUU A;  3SOW A;  5FBX A;  5FFY A;  4KV1 A;  5DYX A;  2DKW A;  5AME A;  2OUO A;  5LJ0 A;  4QSV A;  2EGM A;  4YBT A;  3EB5 A;  3N9Q A;  5K3Q A;  4WHW A;  5C89 A;  2F6N A;  4HXP A;  4O76 A;  5EPS A;  2NAA A;  5TAB A;  4HBX A;  4WIV A;  3P1D A;  3KV5 A;  2YQD A;  5FE3 A;  2LGK A;  4Q6F A;  1WEQ A;  5LJ2 A;  5FH8 A;  2K16 A;  4CL9 A;  2MUM A;  4I7C A;  4XUB A;  2P57 A;  2QJ0 A;  4S3O C;  1CHC A;  2I50 A;  4MEO A;  2G45 A;  3HTK C;  4MEQ A;  2DJA A;  4YYH A;  1RMD A;  5I83 A;  4UP0 A;  5D26 A;  5D24 A;  5LUU A;  2VNF A;  4MR4 A;  1WES A;  4IOQ A;  1Z2Q A;  3O7A A;  4TU4 A;  3ASL A;  5EP7 A;  5DY7 A;  3NG2 A;  3LVR E;  2JMI A;  2XOY A;  3HME A;  4QQ4 A;  2G43 A;  3FAO A;  5CRZ A;  4GB0 A;  3KDE C;  5H85 A;  4I7B A;  5D1M B;  3NXB A;  4UYH A;  2L7P A;  5EPR A;  3JUE A;  2MNZ A;  2EA6 A;  1VFY A;  3N9P A;  2MJV B;  2KKY A;  4Q0N A;  2KGG A;  5CQ8 A;  2D9E A;  2L0B A;  3FM8 C;  5AIT A;  4BW3 A;  5EV9 A;  5FFV A;  3U5J A;  4A4B A;  5D3L A;  5ENF A;  2M85 A;  4QR5 A;  3FL2 A;  2FUI A;  4FK5 A;  5AD2 A;  4WZ3 B;  3HMF A;  2GRC A;  5ENE A;  2DVR A;  5HQ6 A;  1N87 A;  5ENH A;  3RTR B;  1F62 A;  4HBY A;  5C7N A;  5ENB A;  2L5U A;  4O62 A;  5CUA A;  5TDW A;  3FEH A;  4B7Y C;  5H1V A;  5HEM A;  3ZNI A;  4R8P K;  2ECW A;  2E6S A;  5BT3 A;  3UVY A;  2KKX A;  5LKZ A;  5FE2 A;  3Q2F A;  5CQA A;  5HEL A;  3IU5 A;  5DYA A;  1Z6U A;  3O33 A;  5EU1 A;  4A9E A;  2FUU A;  2VJE B;  4AKH A;  3S91 A;  3PLW A;  5HCL A;  4MSX A;  3M63 A;  4YYD A;  5I7Y A;  3P5O A;  5E9L A;  2JMJ A;  4ALG A;  3H7H A;  3RPG C;  3ZYQ A;  1U6G B;  5D1L B;  2LXP C;  3L1X A;  3SUB A;  1BOR A;  5A83 A;  4YYI A;  1LDK C;  2CSZ A;  3E2D A;  5D3H A;  5C87 A;  3O70 A;  4H9D A;  5CQ6 A;  5HRW A;  3PUQ A;  5KH3 A;  4FO9 A;  3LQH A;  3G0L A;  5DYU A;  4YC9 A;  5F2P A;  3L11 A;  1ZS5 A;  5C85 A;  5IGN A;  2JMD A;  5CQT A;  4CUS A;  4IR5 A;  2LSP B;  4TT4 A;  3U5M A;  4NR9 A;  4NRB A;  5ENG A;  4CUU A;  4AKI A;  2EOD A;  3AAD A;  2KWO A;  5D7X A;  4NR4 A;  2H60 A;  4QBM A;  5LJ1 A;  4O7E A;  4UIU A;  3HCS A;  2G4A A;  4IR3 A;  1V87 A;  2I8N A;  2OO1 A;  5F63 A;  4GPJ A;  4OGJ A;  3ERR A;  4O72 A;  2ZET C;  2MA6 A;  5E9I A;  2VP7 A;  2YHO A;  2RS9 B;  4O7C A;  2XOZ A;  4PPE A;  4WZ0 A;  5C11 A;  4TU6 A;  3N9O A;  3O36 A;  4N3W A;  5D3N A;  5EWD A;  5HM0 A;  4ZDT A;  4Z93 A;  5DKD A;  3DWY A;  5I29 A;  4LYI A;  4TYL A;  3UVD A;  2KU3 A;  2LN0 A;  2OWA A;  4V3K C;  4A0C D;  3P1C A;  4UIZ A;  4BW2 A;  4QSP A;  3T9K A;  4MEP A;  3PHD A;  1FP0 A;  4A9M A;  5HLS A;  5B78 A;  4Z1Q A;  1MM2 A;  1IYM A;  3D7C A;  2YEL A;  5KTX A;  2ECI A;  2YQM A;  4P5O B;  3T6R A;  5FE8 A;  5CUC A;  3ZVY A;  5J3X A;  4NQM A;  2KWN A;  4YYK A;  2KYU A;  5A7C A;  5DW1 A;  4QSX A;  5ENJ A;  5FE7 A;  2Y43 A;  2DSM A;  3LJU X;  1WIL A;  3ZPV E;  4N4G A;  4O75 A;  4QSW A;  2DVV A;  4TTE A;  4ALH A;  4A49 A;  1WE9 A;  3QZV A;  5CQ3 A;  1DVP A;  3I3J A;  5DFC A;  4V3L C;  5L99 A;  4HXL A;  4IOR A;  4L7X A;  3U5O A;  4MR6 A;  3QZS A;  5F25 A;  5L98 A;  2VJE A;  4NR8 A;  5DYC A;  2L84 A;  5HQ7 A;  2OSS A;  2NXB A;  3P1E A;  3RPG B;  4GNF A;  5IBN A;  4NR7 A;  4A9H A;  4BW1 A;  5FDZ A;  4Y03 A;  2C2V S;  5D3P A;  2QIZ A;  4OGI A;  4N4F A;  4QUT A;  5IGL A;  3M62 A;  4PY6 A;  2QIC A;  4YYJ A;  4NR6 A;  4TT6 A;  3VKH A;  3D1B A;  5E73 A;  4WA6 A;  5DLZ A;  5TCM A;  4IC2 A;  4F52 B;  2EJN A;  2D82 A;  2YRE A;  2M3H A;  3FKM X;  1WEV A;  4PS5 A;  4YK0 A;  3JVM A;  1ZBD B;  4AKN A;  2YUC A;  4AKG A;  2E6R A;  2LQ6 A;  4LKA A;  2ECN A;  5F36 A;  3SVH A;  3SOU A;  5A5R A;  4J0S A;  5G05 B;  5FB1 A;  4OGE A;  4PKL A;  5FE4 A;  4UIV A;  4BJX A;  4A4C A;  4XUA A;  2MIQ A;  4CLB A;  4XI1 A;  2RNX A;  5IG6 A;  4YY6 A;  3FJU B;  4LJN A;  3SVF A;  1E6I A;  4YAB A;  3MXF A;  3RCW A;  3UV5 A;  2LXH C;  5CZG A;  4R7E A;  5B8D A;  2YEM A;  3LQJ A;  2YQL A;  2Y1M A;  3GG3 A;  5CRM A;  3N9M A;  4YY4 A;  3KQI A;  5JG6 A;  4FJC A;  2F6J A;  3U5K A;  5ACY A;  4C66 A;  4CCG X;  4J3I A;  5J0D A;  1WIM A;  5DKH A;  5G4R A;  5HRV A;  4L58 A;  2KRE A;  5D3S A;  5EIC A;  3KV6 A;  5A81 A;  2K4D A;  1PUO A;  2PUY A;  4HXN A;  1X0J A;  3MB3 A;  5KTW A;  2VJF B;  5IGK A;  5F61 A;  4NUE A;  3SOX A;  2VPE A;  4UYE A;  5HFR A;  1MBM A;  5TBN A;  4PTB A;  3S92 A;  2UZG A;  4X3G A;  5CUG A;  5D3R A;  2CKL B;  5KH7 A;  3L1Z B;  5E9V A;  5DKC A;  4UYD A;  5A5Q A;  4NXJ A;  4HBV A;  3O37 A;  1X4I A;  3DQV R;  2FFW A;  3MB4 A;  2I7K A;  2XEU A;  4WZ2 A;  2VPG A;  3LDY A;  4YYM A;  4QY4 A;  1X4U A;  4QC1 A;  5D25 A;  2K1J A;  2RO1 A;  5EWW A;  4IC3 A;  5FH7 A;  4N4H A;  4NR5 A;  5E0R A;  3M7K A;  4E96 A;  5LVQ A;  3LVQ E;  2E3K A;  4KV4 A;  3FAN A;  2B0O E;  3JVJ A;  5A82 A;  2Y1N A;  2YU4 A;  3MHH A;  3MQM A;  1EQF A;  5CU8 A;  5CQ7 A;  3LXJ A;  5H1T A;  5KU3 A;  4S3O B;  2XOC A;  4UIT A;  1JSP B;  4LLB A;  3M99 A;  2HDP A;  3K2J A;  2L85 A;  1VYX A;  2DAT A;  4O7F A;  1F68 A;  5G4S A;  4LDF A;  4LZR A;  4QZS A;  3JVK A;  4A9J A;  2AN6 A;  4LAD B;  4IOO A;  5E9Y A;  4NQN A;  4A9K A;  4YH4 A;  4O77 A;  5EIS A;  5D0C A;  2C2L A;  2H0D B;  4AYC B;  4C9Z A;  4PCI A;  5EWH A;  2ECV A;  2HYE D;  2MA5 A;  2LDR A;  2YW5 A;  5F3A A;  3Q2E A;  4NUD A;  5I88 A;  4UIX A;  5FE1 A;  1WEM A;  4MVT A;  5FER A;  3HCU A;  2LGV A;  3Q1D A;  3C5K A;  3GV4 A;  2K17 A;  5A5N A;  5KTU A;  5AMF A;  5CUE A;  5C8G A;  5L8T A;  2DX8 A;  5C13 A;  2PNX A;  2XP0 A;  2M6M A;  4UIW A;  5CY9 A;  5SVI B;  4CA1 A;  2KR4 A;  3U5N A;  5EWC A;  2KGI A;  4QF2 A;  3G0J A;  2M13 A;  4QC3 A;  4LC2 A;  3T7L A;  2EXU A;  3I2D A;  1WUG A;  5HRX A;  4B86 C;  4QST A;  2VJF A;  1HYJ A;  4TZ8 A;  4YYG A;  5FE5 A;  5II1 A;  4C67 A;  5I3L A;  2R10 A;  3ZPV 1;  5FG5 A;  3LJW A;  3VKG A;  2JRJ A;  2YHN A;  4A9I A;  4LK9 A;  3DAI A;  2CKL A;  1X4J A;  4HXS A;  4CUR A;  4LYW A;  5DIN A;  4YAX A;  4LRG A;  2CRR A;  5TDR A;  2CT2 A;  4AUQ B;  3U5P A;  5G04 B;  4ZC9 A;  4UIY A;  5HEN A;  5E3G A;  2YYN A;  2L80 A;  4Z6I A;  5EWV A;  2N9G A;  3UV4 A;  5LCW B;  3KNV A;  1FBV A;  1VD4 A;  3O34 A;  2RNY A;  2IDA A;  1T1H A;  5A5S A;  3N9L A;  4LZ2 A;  4QYD A;  2RI7 A;  2E61 A;  1ZKR A;  3U5L A;  5EM3 A;  5CUD A;  4A9O A;  5II2 A;  5LKX A;  5CTL A;  1WEN A;  2KFT A;  5EA1 A;  4TS8 A;  2F42 A;  2KTB B;  4DON A;  3MDB C;  5SVX A;  5F1L A;  2MNY A;  4YYN A;  3C6W A;  4LZS A;  5CQ4 A;  5DFD A;  4QSS A;  4ZW1 A;  3UV2 A;  2CON A;  4F1P A;  2MD8 C;  4TKP B;  2BAY A;  5BT5 A;  5H9M A;  5E7D A;  3MUL A;  4AI6 A;  4CFL A;  3UVX A;  2VPB A;  2VPD A;  5A5P A;  5AD3 A;  2FD4 A;  5DW2 A;  5B75 A;  2JM3 A;  5F62 A;  4Z1S A;  5G0F A;  1WUM A;  5L8U A;  2H0D A;  2FSA A;  5CFW A;  4AYC A;  4HXK A;  3ZVZ B;  5B79 A;  2YT5 A;  4A9F A;  2D8S A;  5EVA A;  4MEN A;  4CUT A;  4TZ2 A;  4ZUX U;  3LQI A;  5LKT A;  2CSV A;  2KWK A;  4QNS A;  5FFW A;  5JWM A;  1DCQ A;  4IR4 A;  1MM3 A;  4OGC A;  5CUB A;  5K29 A;  3UW9 A;  5H1U A;  3SHB A;  4Z0O A;  5DX4 A;  5L96 A;  4GND A;  5EYA F;  5EPB A;  5SVI A;  5I89 A;  4PCE A;  4QR4 A;  4O7B A;  5DLX A;  4CUQ A;  4WHU A;  2DWW A;  5ENC A;  5SVY A;  1WEP A;  4I7D A;  2YSJ A;  2KIZ A;  3PUR A;  5EGU A;  2YYR A;  2D8U A;  1WEO A;  1Z60 A;  5CS8 A;  2WP2 A;  4XYA A;  4Q0O A;  3SVG A;  2R0Y A;  4O78 A;  4TT2 A;  5E3D A;  5CGP A;  5ENI A;  5CP5 A;  4GNE A;  1N72 A;  3D1D A;  4QYL A;  2CRW A;  4W4U A;  1JM7 B;  2R0V A;  5KO4 A;  5HFQ A;  2IQJ A;  5FEY A;  4O64 A;  5I80 A;  2OXQ C;  4O71 A;  3ONI A;  3P1F A;  4YAD A;  5I7X A;  4QSR A;  2LGL A;  4QR3 A;  4A9L A;  5FE9 A;  4GNG A;  4BBQ A;  4J0R A;  4UYF B;  4O7A A;  5DFB A;  4OUF A;  5KHM A;  4TQN A;  4XY9 A;  4HXM A;  5CPE A;  5IGM A;  2XB1 A;  5COI A;  5ETB A;  2MKE A;  3DDT A;  4IR6 A;  4YH3 A;  2JUN A;  3JVL A;  5EK9 A;  4BW4 A;  2ECJ A;  1HYI A;  4LR6 A;  5B77 A;  4NUC A;  4YAT A;  4QF3 A;  5TB6 A;  5FH6 A;  5FE0 A;  3O47 A;  5FE6 A;  4YBM A;  4CUP A;  4FIP A;  3DPL R;  4NRA A;  5E9M A;  1JOC A;  3ZTG A;  3HMH A;  5D3J A;  2YW8 A;  4J1P A;  5I1Q A;  4N4I A;  3O35 A;  2RNW A;  4KCX A;  1WFK A;  3HCT A;  2LAU A;  2E7N A;  5A5O A;  4MR3 A;  4X2I A;  5HQ5 A;  4QSQ A;  2DVQ A;  4NN2 A;  5C4Q A;  5I86 A;  2YSM A;  5DBM A;  4NYW A;  5FB0 A;  4NYV A;  5F1H A;  2E7O A;  2G6Q A;  3VK6 A;  5E74 A;  3ZYU A;  2YVR A;  1K2F A;  5E9K A;  5IID A;  2LRI C;  3QZT A;  4NS5 A;  2ECG A;  2KE1 A;  5L97 A;  2WP1 A;  5B76 A;  2M1R A;  5I40 A;  4NRC A;  4QEV A;  4XY8 A;  3LRQ A;  2YEK A;  4QEU A;  3EB6 A;  2RFJ A;  5DKA A;  5TRB A;  1LDJ B;  5F5Z A;  5A85 A; 
#chains in the Genus database with same CATH homology
 3AQA A;  4R2Y A;  4Z6H A;  4O70 A;  5LKU A;  1WEW A;  5FG6 A;  4HXO A;  1WEU A;  4MR5 A;  5EI4 A;  2CSY A;  3MUK A;  2RSD A;  2MD7 B;  3MHS A;  1JM4 B;  4CFK A;  4UYG A;  4QB3 A;  5ETD A;  4AP4 A;  1JM7 A;  5JI8 A;  3UVW A;  2ECT A;  1WGM A;  1G25 A;  4QSU A;  5F60 A;  3IU6 A;  5D1K B;  4UP5 A;  4QEW A;  5D3T A;  2LGG A;  4NYX A;  4RVR A;  3GL6 A;  4AVX A;  4BHW A;  4F3I A;  3V43 A;  4ZQL A;  4YBS A;  5LVR A;  1WEE A;  3IHP A;  4LYS A;  4UYF A;  2KWJ A;  5AIU A;  5FG4 A;  1E4U A;  5EQ1 A;  5BT4 A;  4FLP A;  4HXR A;  2YDW A;  5HJC A;  2R0S A;  5CQ5 A;  4A9N A;  2L5E A;  4O74 A;  2L75 A;  2EGP A;  3TLP A;  1XWH A;  2LV9 A;  2MT5 A;  4HBW A;  2YUR A;  2L43 A;  2DVS A;  3N9N A;  4UI9 B;  5KH9 A;  4QUU A;  3SOW A;  5FBX A;  5FFY A;  4KV1 A;  5DYX A;  2DKW A;  5AME A;  2OUO A;  5LJ0 A;  4QSV A;  3EB5 A;  4YBT A;  3N9Q A;  4WHW A;  5C89 A;  2F6N A;  4HXP A;  4O76 A;  5EPS A;  2NAA A;  5TAB A;  4HBX A;  4WIV A;  3P1D A;  3KV5 A;  2YQD A;  5FE3 A;  2LGK A;  4Q6F A;  1WEQ A;  5LJ2 A;  5FH8 A;  2K16 A;  4CL9 A;  2MUM A;  4I7C A;  4XUB A;  2QJ0 A;  4S3O C;  1CHC A;  2I50 A;  4MEO A;  2G45 A;  3HTK C;  4MEQ A;  4YYH A;  1RMD A;  5I83 A;  4UP0 A;  5D26 A;  5D24 A;  5LUU A;  2VNF A;  4MR4 A;  1WES A;  4IOQ A;  1Z2Q A;  3O7A A;  4TU4 A;  3ASL A;  5EP7 A;  5DY7 A;  3NG2 A;  2JMI A;  3HME A;  2G43 A;  4GB0 A;  5CRZ A;  5H85 A;  4I7B A;  5D1M B;  3NXB A;  4UYH A;  5EPR A;  2MNZ A;  2EA6 A;  1VFY A;  3N9P A;  2MJV B;  4Q0N A;  2KGG A;  5CQ8 A;  2D9E A;  2L0B A;  5AIT A;  4BW3 A;  5EV9 A;  5FFV A;  3U5J A;  4A4B A;  5D3L A;  5ENF A;  2M85 A;  4QR5 A;  3FL2 A;  2FUI A;  4FK5 A;  5AD2 A;  4WZ3 B;  3HMF A;  2GRC A;  5ENE A;  2DVR A;  5HQ6 A;  1N87 A;  5ENH A;  3RTR B;  1F62 A;  4HBY A;  5C7N A;  5ENB A;  2L5U A;  5CUA A;  5TDW A;  4B7Y C;  5H1V A;  5HEM A;  3ZNI A;  4R8P K;  2ECW A;  2E6S A;  5BT3 A;  3UVY A;  5LKZ A;  5FE2 A;  3Q2F A;  5CQA A;  5HEL A;  3IU5 A;  5DYA A;  1Z6U A;  3O33 A;  5EU1 A;  4A9E A;  2FUU A;  2VJE B;  3S91 A;  5HCL A;  4MSX A;  3M63 A;  4YYD A;  5I7Y A;  3P5O A;  5E9L A;  2JMJ A;  4ALG A;  3ZYQ A;  3RPG C;  1U6G B;  5D1L B;  2LXP C;  3L1X A;  1BOR A;  5A83 A;  4YYI A;  1LDK C;  2CSZ A;  5D3H A;  5C87 A;  3O70 A;  5CQ6 A;  5HRW A;  3PUQ A;  5KH3 A;  4FO9 A;  3LQH A;  3G0L A;  5DYU A;  4YC9 A;  5F2P A;  3L11 A;  1ZS5 A;  5C85 A;  5IGN A;  2JMD A;  5CQT A;  4CUS A;  4IR5 A;  2LSP B;  4TT4 A;  3U5M A;  4NR9 A;  4NRB A;  5ENG A;  4CUU A;  2EOD A;  3AAD A;  2KWO A;  5D7X A;  4NR4 A;  2H60 A;  4QBM A;  5LJ1 A;  4O7E A;  4UIU A;  3HCS A;  2G4A A;  4IR3 A;  1V87 A;  2I8N A;  2OO1 A;  5F63 A;  4GPJ A;  4OGJ A;  2ZET C;  4O72 A;  2MA6 A;  5E9I A;  2VP7 A;  2YHO A;  2RS9 B;  4O7C A;  4PPE A;  4WZ0 A;  5C11 A;  4TU6 A;  3N9O A;  3O36 A;  4N3W A;  5D3N A;  5EWD A;  5HM0 A;  4ZDT A;  4Z93 A;  5DKD A;  3DWY A;  5I29 A;  4LYI A;  4TYL A;  3UVD A;  2KU3 A;  2LN0 A;  4V3K C;  4A0C D;  3P1C A;  4UIZ A;  4BW2 A;  4QSP A;  4MEP A;  3PHD A;  1FP0 A;  4A9M A;  5HLS A;  5B78 A;  4Z1Q A;  1MM2 A;  1IYM A;  3D7C A;  2YEL A;  5KTX A;  2ECI A;  2YQM A;  4P5O B;  3T6R A;  5FE8 A;  5CUC A;  3ZVY A;  5J3X A;  4NQM A;  2KWN A;  4YYK A;  2KYU A;  5A7C A;  5DW1 A;  4QSX A;  5ENJ A;  5FE7 A;  2Y43 A;  3ZPV E;  1WIL A;  4N4G A;  4O75 A;  4QSW A;  2DVV A;  4TTE A;  4ALH A;  4A49 A;  1WE9 A;  3QZV A;  5CQ3 A;  1DVP A;  3I3J A;  5DFC A;  4V3L C;  5L99 A;  4HXL A;  4IOR A;  4L7X A;  3U5O A;  4MR6 A;  3QZS A;  5F25 A;  5L98 A;  2VJE A;  4NR8 A;  5DYC A;  2L84 A;  5HQ7 A;  2OSS A;  2NXB A;  3P1E A;  3RPG B;  4GNF A;  5IBN A;  4NR7 A;  4A9H A;  4BW1 A;  5FDZ A;  4Y03 A;  2C2V S;  5D3P A;  2QIZ A;  4OGI A;  4N4F A;  4QUT A;  5IGL A;  3M62 A;  4PY6 A;  2QIC A;  4YYJ A;  4NR6 A;  4TT6 A;  5E73 A;  4WA6 A;  5DLZ A;  5TCM A;  4IC2 A;  4F52 B;  2D82 A;  2YRE A;  2M3H A;  3FKM X;  1WEV A;  4PS5 A;  4YK0 A;  3JVM A;  1ZBD B;  4AKN A;  2YUC A;  2E6R A;  2LQ6 A;  4LKA A;  2ECN A;  5F36 A;  3SVH A;  3SOU A;  5A5R A;  4J0S A;  5G05 B;  5FB1 A;  4PKL A;  5FE4 A;  4UIV A;  4BJX A;  4A4C A;  4XUA A;  2MIQ A;  4CLB A;  4XI1 A;  2RNX A;  5IG6 A;  4YY6 A;  4LJN A;  3SVF A;  1E6I A;  4YAB A;  3MXF A;  3RCW A;  3UV5 A;  2LXH C;  5CZG A;  4R7E A;  5B8D A;  2YEM A;  3LQJ A;  2YQL A;  2Y1M A;  3GG3 A;  5CRM A;  3N9M A;  4YY4 A;  3KQI A;  5JG6 A;  4FJC A;  2F6J A;  3U5K A;  5ACY A;  4C66 A;  4CCG X;  4J3I A;  5J0D A;  1WIM A;  5DKH A;  5G4R A;  5HRV A;  4L58 A;  2KRE A;  5D3S A;  5EIC A;  3KV6 A;  5A81 A;  2K4D A;  2PUY A;  4HXN A;  1X0J A;  3MB3 A;  5KTW A;  2VJF B;  5IGK A;  5F61 A;  4NUE A;  3SOX A;  2VPE A;  4UYE A;  5HFR A;  5TBN A;  4PTB A;  3S92 A;  2UZG A;  4X3G A;  5CUG A;  5D3R A;  2CKL B;  5KH7 A;  3L1Z B;  5E9V A;  5DKC A;  4UYD A;  5A5Q A;  4NXJ A;  4HBV A;  3O37 A;  1X4I A;  3DQV R;  3MB4 A;  2I7K A;  2XEU A;  4WZ2 A;  2VPG A;  4YYM A;  4QY4 A;  1X4U A;  4QC1 A;  5D25 A;  2K1J A;  2RO1 A;  5EWW A;  4IC3 A;  5FH7 A;  4N4H A;  4NR5 A;  5E0R A;  4E96 A;  5LVQ A;  2E3K A;  4KV4 A;  3JVJ A;  5A82 A;  2Y1N A;  2YU4 A;  3MHH A;  3MQM A;  1EQF A;  5CU8 A;  5CQ7 A;  3LXJ A;  5H1T A;  5KU3 A;  4S3O B;  4UIT A;  1JSP B;  4LLB A;  3M99 A;  2HDP A;  3K2J A;  2L85 A;  1VYX A;  2DAT A;  4O7F A;  1F68 A;  5G4S A;  4LDF A;  4LZR A;  4QZS A;  3JVK A;  4A9J A;  2AN6 A;  4LAD B;  4IOO A;  5E9Y A;  4NQN A;  4A9K A;  4YH4 A;  4O77 A;  5EIS A;  5D0C A;  2C2L A;  2H0D B;  4AYC B;  4C9Z A;  4PCI A;  5EWH A;  2ECV A;  2HYE D;  2MA5 A;  2LDR A;  2YW5 A;  5F3A A;  3Q2E A;  4NUD A;  5I88 A;  4UIX A;  5FE1 A;  1WEM A;  4MVT A;  5FER A;  3HCU A;  2LGV A;  3C5K A;  3GV4 A;  2K17 A;  5A5N A;  5KTU A;  5AMF A;  5CUE A;  5C8G A;  5L8T A;  2DX8 A;  5C13 A;  2PNX A;  2M6M A;  4UIW A;  5CY9 A;  4CA1 A;  2KR4 A;  3U5N A;  5EWC A;  2KGI A;  4QF2 A;  3G0J A;  4QC3 A;  4LC2 A;  3T7L A;  3I2D A;  1WUG A;  5HRX A;  4B86 C;  4QST A;  2VJF A;  1HYJ A;  4TZ8 A;  4YYG A;  5FE5 A;  5II1 A;  4C67 A;  5I3L A;  2R10 A;  3ZPV 1;  5FG5 A;  3LJW A;  2JRJ A;  2YHN A;  4A9I A;  4LK9 A;  3DAI A;  2CKL A;  1X4J A;  4HXS A;  4CUR A;  4LYW A;  5DIN A;  4YAX A;  4LRG A;  5TDR A;  4AUQ B;  2CT2 A;  3U5P A;  5G04 B;  4ZC9 A;  4UIY A;  5HEN A;  5E3G A;  2YYN A;  2L80 A;  4Z6I A;  5EWV A;  2N9G A;  3UV4 A;  5LCW B;  3KNV A;  1FBV A;  1VD4 A;  3O34 A;  2RNY A;  2IDA A;  1T1H A;  5A5S A;  3N9L A;  4LZ2 A;  4QYD A;  2RI7 A;  3U5L A;  5EM3 A;  5CUD A;  4A9O A;  5II2 A;  5LKX A;  5CTL A;  1WEN A;  2KFT A;  5EA1 A;  4TS8 A;  2F42 A;  2KTB B;  4DON A;  5F1L A;  2MNY A;  4YYN A;  3C6W A;  4LZS A;  5CQ4 A;  5DFD A;  4QSS A;  4ZW1 A;  3UV2 A;  2MD8 C;  4TKP B;  2BAY A;  5BT5 A;  5H9M A;  5E7D A;  3MUL A;  4CFL A;  3UVX A;  2VPB A;  2VPD A;  5A5P A;  5AD3 A;  5DW2 A;  5B75 A;  5F62 A;  4Z1S A;  5G0F A;  1WUM A;  5L8U A;  2H0D A;  2FSA A;  5CFW A;  4AYC A;  4HXK A;  3ZVZ B;  5B79 A;  2YT5 A;  4A9F A;  2D8S A;  5EVA A;  4MEN A;  4CUT A;  4TZ2 A;  4ZUX U;  3LQI A;  5LKT A;  2KWK A;  4QNS A;  5FFW A;  5JWM A;  4IR4 A;  1MM3 A;  5CUB A;  5K29 A;  3UW9 A;  5H1U A;  3SHB A;  5DX4 A;  5L96 A;  4GND A;  5EYA F;  5EPB A;  5I89 A;  4PCE A;  4QR4 A;  4O7B A;  5DLX A;  4CUQ A;  4WHU A;  2DWW A;  5ENC A;  1WEP A;  4I7D A;  2YSJ A;  2KIZ A;  3PUR A;  5EGU A;  2YYR A;  1WEO A;  1Z60 A;  5CS8 A;  2WP2 A;  4XYA A;  4Q0O A;  3SVG A;  2R0Y A;  4O78 A;  4TT2 A;  5E3D A;  5CGP A;  5ENI A;  5CP5 A;  4GNE A;  1N72 A;  4QYL A;  1JM7 B;  4W4U A;  2R0V A;  5KO4 A;  5HFQ A;  5FEY A;  4O64 A;  5I80 A;  2OXQ C;  4O71 A;  3ONI A;  3P1F A;  4YAD A;  5I7X A;  4QSR A;  2LGL A;  4QR3 A;  4A9L A;  5FE9 A;  4GNG A;  4BBQ A;  4J0R A;  4UYF B;  4O7A A;  5DFB A;  4OUF A;  5KHM A;  4TQN A;  4XY9 A;  4HXM A;  5CPE A;  5IGM A;  2XB1 A;  5COI A;  5ETB A;  4IR6 A;  4YH3 A;  3JVL A;  5EK9 A;  4BW4 A;  2ECJ A;  1HYI A;  4LR6 A;  5B77 A;  4NUC A;  4YAT A;  4QF3 A;  5TB6 A;  5FH6 A;  5FE0 A;  5FE6 A;  4YBM A;  4CUP A;  4FIP A;  3DPL R;  4NRA A;  5E9M A;  1JOC A;  3ZTG A;  3HMH A;  5D3J A;  2YW8 A;  4J1P A;  5I1Q A;  4N4I A;  3O35 A;  2RNW A;  4KCX A;  1WFK A;  3HCT A;  2E7N A;  5A5O A;  4MR3 A;  4X2I A;  5HQ5 A;  4QSQ A;  2DVQ A;  4NN2 A;  5C4Q A;  5I86 A;  2YSM A;  5DBM A;  4NYW A;  5FB0 A;  4NYV A;  5F1H A;  2E7O A;  2G6Q A;  3VK6 A;  5E74 A;  3ZYU A;  1K2F A;  5E9K A;  5IID A;  2LRI C;  3QZT A;  4NS5 A;  2ECG A;  2KE1 A;  5L97 A;  2WP1 A;  5B76 A;  2M1R A;  5I40 A;  4NRC A;  4QEV A;  4XY8 A;  3LRQ A;  2YEK A;  4QEU A;  3EB6 A;  2RFJ A;  5DKA A;  5TRB A;  1LDJ B;  5F5Z A;  5A85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...