5JG6A

Apc11-ubv shows role of noncovalent ring-ubiquitin interactions in processive multiubiquitination and ubiquitin chain elongation by apc/c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
61
Chain Sequence
DENCGICRMAFNGCCPDCDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anaphase-promoting complex subunit 11
publication title Dual RING E3 Architectures Regulate Multiubiquitination and Ubiquitin Chain Elongation by APC/C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 14
structure length 61
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5jg6A00
4AYCB 2KWOA 1T1HA 2FUIA 5KH3A 2L5UA 5TDRA 3DQVR 2EA6A 3FL2A 2G45A 4ZDTA 3EB6A 5KH9A 4GB0A 4YBTA 3U5OA 2KYUA 2NAAA 2K16A 2EODA 3L1ZB 2M6MA 1WEEA 5FB0A 4AVXA 2VPBA 1WESA 3VK6A 1WEUA 2DX8A 4WZ0A 2YHOA 4AUQB 2FUUA 4LK9A 2YHNA 3LQHA 1E4UA 1WEWA 2XB1A 5H1VA 2JMDA 5AITA 4Q6FA 4MVTA 2MD7B 2CSYA 3O36A 3O35A 2KGIA 2K1JA 4WA6A 5B76A 4UP5A 1WEQA 2E6RA 2YQMA 4B7YC 5FB1A 3ZYQA 2RI7A 2LGKA 2EGPA 2C2VS 2VPEA 1X4JA 2KU3A 4A4CA 3RPGB 1WEMA 3ZPVE 3N9NA 4TKPB 2CT2A 5KH7A 4BHWA 1WGMA 3NG2A 1WE9A 3O7AA 2HYED 3N9OA 3M99A 2QICA 4R7EA 3KNVA 1WFKA 3KQIA 2ECVA 2RSDA 2VJEB 3LQIA 2L43A 1IYMA 5I3LA 3KV6A 1WEOA 2MNYA 2YT5A 3U5NA 5LKTA 3PUQA 3ZVZB 5B8DA 2K4DA 2L80A 4UI9B 1WILA 3N9QA 3GL6A 2G6QA 5H9MA 4S3OC 1VYXA 2LRIC 3HCSA 1HYJA 4LLBA 1LDKC 2L0BA 2E6SA 2OXQC 2YUCA 4YC9A 2F42A 3ZTGA 1FP0A 1VD4A 5AIUA 2CKLB 4IC2A 3PHDA 4QF3A 2MT5A 5H1TA 3T7LA 1X4IA 5DINA 5LKZA 1WENA 2KWJA 3SOUA 2ECNA 3N9MA 3ZPV1 3RPGC 1CHCA 5B78A 3KV5A 4V3LC 5G04B 5G05B 4PTBA 4X3GA 1G25A 5TABA 2YYRA 4A4BA 2Y1MA 2VJFA 3U5MA 3I2DA 4ZQLA 2C2LA 4YADA 3O70A 3V43A 4YABA 4XI1A 3HCUA 4FIPA 4I7DA 2LDRA 2UZGA 2HDPA 2LGLA 4WZ3B 3ZNIA 5EYAF 3LQJA 2F6JA 2PUYA 3MHSA 4L58A 1JM7A 4B86C 2ZETC 1F62A 2MUMA 2LGVA 1LDJB 2L75A 2H0DA 1MM3A 3QZVA 2YREA 5FERA 3T6RA 5G0FA 2LN0A 4GNEA 2QJ0A 1FBVA 4NN2A 2VP7A 4CCGX 3IHPA 3L1XA 2IDAA 4R8PK 2KWKA 1BORA 4QF2A 1U6GB 2XEUA 4YAXA 5TDWA 4FK5A 2I50A 3ZVYA 4W4UA 2M3HA 3GV4A 2M1RA 5TRBA 1Z60A 2D8SA 3SOWA 3PURA 5B79A 2CSZA 1WEPA 4AYCA 5D1KB 3MHHA 1VFYA 2FSAA 5C13A 2MA6A 2F6NA 2LXHC 2YU4A 2MA5A 4L7XA 1N87A 4I7CA 2MIQA 3N9PA 2JMJA 2KGGA 1X4UA 2LQ6A 3O33A 2KE1A 2BAYA 2VPGA 5B77A 4YBMA 3C6WA 2KWNA 5D1LB 5D1MB 3DPLR 4YATA 4IC3A 1WIMA 4GNDA 4C9ZA 1V87A 1JOCA 2ECWA 4AP4A 3HTKC 1Z6UA 4LKAA 4V3KC 1MM2A 1DVPA 3M63A 2PNXA 1K2FA 2KR4A 2LXPC 5FEYA 5H1UA 1XWHA 2AN6A 4N3WA 5JG6A 2YURA 3M62A 5B75A 2YSJA 2M85A 4FO9A 2ECGA 2VJFB 1HYIA 4LADB 2VPDA 3LRQA 4S3OB 5TBNA 2QIZA 2ECJA 2Y1NA 5LKUA 4WZ2A 1JM7B 4F52B 2G43A 3U5PA 3EB5A 1ZBDB 4FJCA 2H0DB 2KIZA 2YW8A 4BBQA 4GNGA 3HCTA 3N9LA 2KFTA 2YSMA 2VJEA 5DKAA 5C11A 4CA1A 4O64A 1Z2QA 2JMIA 4PPEA 5LCWB 3L11A 5J3XA 2KREA 4A49A 2JRJA 2ECIA 2YQLA 4LJNA 3ASLA 3O34A 2LV9A 2MD8C 1WEVA 4I7BA 2Y43A 3SHBA 2K17A 4P5OB 1RMDA 4ZUXU 4GNFA 4UP0A 2LGGA 4N4FA 4YBSA 3O37A 3RTRB 3SOXA 2ECTA 4R2YA 3C5KA 5LKXA 4A0CD 2MNZA 4MSXA 2CKLA 2VNFA
chains in the Genus database with same CATH superfamily
4AYCB 2KWOA 3T9KA 2LAUA 5SVIB 1T1HA 2FUIA 5KH3A 2L5UA 5TDRA 3DQVR 2EA6A 3FL2A 2G45A 4ZDTA 3EB6A 5KH9A 4GB0A 4YBTA 3U5OA 2KYUA 2NAAA 3FEHA 2JM3A 2K16A 2EODA 3L1ZB 2M6MA 1WEEA 5FB0A 4AVXA 3FANA 2VPBA 2EXUA 1WESA 3VK6A 3DWDA 1WEUA 2DX8A 2YVRA 4WZ0A 2YHOA 4AUQB 2FUUA 4LK9A 2YHNA 3LQHA 1E4UA 3H7HA 1WEWA 2XB1A 5H1VA 2KKXA 2L7PA 2JMDA 5AITA 4Q6FA 2B0OE 4MVTA 2MD7B 4F1PA 2CSYA 3O36A 3O35A 2E61A 2KGIA 2K1JA 4WA6A 5B76A 4UP5A 1WEQA 2E6RA 2YQMA 4B7YC 5FB1A 3ZYQA 2RI7A 2LGKA 2EGPA 2C2VS 2VPEA 1X4JA 2KU3A 4A4CA 3RPGB 1WEMA 3ZPVE 3N9NA 2DSMA 4TKPB 2CT2A 5KH7A 4BHWA 1WGMA 3NG2A 1WE9A 3O7AA 2JUNA 4Z0RA 2HYED 3N9OA 3M99A 2QICA 4R7EA 3KNVA 2XOZA 1WFKA 3KQIA 2D8UA 1DCQA 1MBMA 2ECVA 2RSDA 2VJEB 3LQIA 2FFWA 2L43A 1IYMA 5I3LA 3KV6A 1WEOA 2MNYA 2YT5A 3U5NA 5LKTA 3PUQA 2OWAA 3ZVZB 5B8DA 2K4DA 2L80A 4UI9B 1WILA 3N9QA 3GL6A 2G6QA 5H9MA 4S3OC 1VYXA 2LRIC 3HCSA 1HYJA 4LLBA 1LDKC 2L0BA 3MDBC 2E6SA 2OXQC 2XOCA 2YUCA 5SVYA 4YC9A 2F42A 3ZTGA 1FP0A 1VD4A 5AIUA 2CKLB 4IC2A 3PHDA 4QF3A 3SUBA 2MT5A 5H1TA 3T7LA 1X4IA 5DINA 5LKZA 1WENA 2KWJA 3SOUA 2ECNA 2M13A 3N9MA 3ZPV1 3RPGC 1CHCA 5B78A 4H9DA 3KV5A 3Q1DA 4V3LC 5G04B 5G05B 4PTBA 4X3GA 1G25A 5TABA 3DDTA 2YYRA 4A4BA 2Y1MA 2VJFA 3U5MA 3I2DA 4ZQLA 2C2LA 4YADA 3O70A 3V43A 4YABA 4XI1A 3HCUA 4FIPA 4I7DA 3KDEC 2LDRA 2UZGA 2HDPA 4OGEA 2LGLA 4WZ3B 3LVQE 3ZNIA 5EYAF 3LQJA 2F6JA 4O62A 2PUYA 3MHSA 4L58A 1JM7A 4B86C 2ZETC 1F62A 3FJUB 2MUMA 2LGVA 1LDJB 2L75A 2H0DA 2CRRA 1MM3A 3QZVA 2EGMA 4QQ4A 3O47A 2YREA 5FERA 3T6RA 5G0FA 2LN0A 4GNEA 2QJ0A 1FBVA 4NN2A 2VP7A 4CCGX 3IHPA 3L1XA 2IDAA 4R8PK 2KWKA 3LVRE 1BORA 4QF2A 1U6GB 2XEUA 4YAXA 5TDWA 4FK5A 2I50A 3ZVYA 4W4UA 2M3HA 3PLWA 3GV4A 2M1RA 2IQJA 5TRBA 1Z60A 2D8SA 3SOWA 3PURA 5B79A 2CSZA 1WEPA 2XOYA 4AYCA 2DJAA 2CRWA 5D1KB 5SVIA 5SVXA 3MHHA 1VFYA 2RR4A 2FSAA 5C13A 2MA6A 2F6NA 2LXHC 2KKYA 2YU4A 2MA5A 4L7XA 1N87A 4I7CA 2MIQA 3N9PA 2JMJA 2KGGA 1X4UA 2LQ6A 3O33A 2KE1A 2BAYA 3M7KA 2VPGA 5B77A 4YBMA 3C6WA 3E2DA 2KWNA 5D1LB 5D1MB 3DPLR 4YATA 4IC3A 1WIMA 3LDYA 4GNDA 4C9ZA 1V87A 1JOCA 2ECWA 3FM8C 4AP4A 2FD4A 3HTKC 1Z6UA 4LKAA 4V3KC 1MM2A 1DVPA 3M63A 2PNXA 3LJUX 1K2FA 2KR4A 2LXPC 5FEYA 5H1UA 3JUEA 1XWHA 2AN6A 4N3WA 5JG6A 2YURA 3M62A 5B75A 2YSJA 2M85A 4FO9A 2ECGA 2VJFB 1HYIA 4LADB 2VPDA 3LRQA 4S3OB 5TBNA 2CONA 2QIZA 2ECJA 2Y1NA 4OGCA 5LKUA 4WZ2A 1JM7B 4F52B 2XP0A 2G43A 3U5PA 3EB5A 1ZBDB 4FJCA 4Z0OA 2H0DB 2KIZA 2YW8A 4BBQA 2CSVA 4GNGA 3HCTA 3N9LA 2KFTA 2YSMA 2VJEA 5DKAA 5C11A 4CA1A 4O64A 1Z2QA 2JMIA 4PPEA 5LCWB 3L11A 5J3XA 2KREA 4A49A 2JRJA 2ECIA 2YQLA 4LJNA 3ASLA 3O34A 2LV9A 2MD8C 1WEVA 4I7BA 2Y43A 3SHBA 2K17A 4P5OB 1RMDA 4ZUXU 2P57A 4GNFA 4UP0A 2LGGA 4N4FA 5K3QA 4YBSA 3O37A 3RTRB 2MKEA 2ECTA 4R2YA 3SOXA 3C5KA 5LKXA 4A0CD 2MNZA 4MSXA 2CKLA 3FAOA 2VNFA
chains in the Genus database with same CATH topology
4AYCB 2KWOA 1T1HA 2FUIA 5KH3A 2L5UA 5TDRA 3DQVR 2EA6A 3FL2A 2G45A 4ZDTA 3EB6A 5KH9A 4GB0A 4YBTA 3U5OA 2KYUA 2NAAA 2K16A 2EODA 3L1ZB 2M6MA 1WEEA 5FB0A 4AVXA 2VPBA 1WESA 3VK6A 1WEUA 2DX8A 4WZ0A 2YHOA 4AUQB 2FUUA 4LK9A 2YHNA 3LQHA 1E4UA 1WEWA 2XB1A 5H1VA 2JMDA 5AITA 4Q6FA 4MVTA 2MD7B 2CSYA 3O36A 3O35A 2KGIA 2K1JA 4WA6A 5B76A 4UP5A 1WEQA 2E6RA 2YQMA 4B7YC 5FB1A 3ZYQA 2RI7A 2LGKA 2EGPA 2C2VS 2VPEA 1X4JA 2KU3A 4A4CA 3RPGB 1WEMA 3ZPVE 3N9NA 4TKPB 2CT2A 5KH7A 4BHWA 1WGMA 3NG2A 1WE9A 3O7AA 2HYED 3N9OA 3M99A 2QICA 4R7EA 3KNVA 1WFKA 3KQIA 2ECVA 2RSDA 2VJEB 3LQIA 2L43A 1IYMA 5I3LA 3KV6A 1WEOA 2MNYA 2YT5A 3U5NA 5LKTA 3PUQA 3ZVZB 5B8DA 2K4DA 2L80A 4UI9B 1WILA 3N9QA 3GL6A 2G6QA 5H9MA 4S3OC 1VYXA 2LRIC 3HCSA 1HYJA 4LLBA 1LDKC 2L0BA 2E6SA 2OXQC 2YUCA 4YC9A 2F42A 3ZTGA 1FP0A 1VD4A 5AIUA 2CKLB 4IC2A 3PHDA 4QF3A 2MT5A 5H1TA 3T7LA 1X4IA 5DINA 5LKZA 1WENA 2KWJA 3SOUA 2ECNA 3N9MA 3ZPV1 3RPGC 1CHCA 5B78A 3KV5A 4V3LC 5G04B 5G05B 4PTBA 4X3GA 1G25A 5TABA 2YYRA 4A4BA 2Y1MA 2VJFA 3U5MA 3I2DA 4ZQLA 2C2LA 4YADA 3O70A 3V43A 4YABA 4XI1A 3HCUA 4FIPA 4I7DA 2LDRA 2UZGA 2HDPA 2LGLA 4WZ3B 3ZNIA 5EYAF 3LQJA 2F6JA 2PUYA 3MHSA 4L58A 1JM7A 4B86C 2ZETC 1F62A 2MUMA 2LGVA 1LDJB 2L75A 2H0DA 1MM3A 3QZVA 2YREA 5FERA 3T6RA 5G0FA 2LN0A 4GNEA 2QJ0A 1FBVA 4NN2A 2VP7A 4CCGX 3IHPA 3L1XA 2IDAA 4R8PK 2KWKA 1BORA 4QF2A 1U6GB 2XEUA 4YAXA 5TDWA 4FK5A 2I50A 3ZVYA 4W4UA 2M3HA 3GV4A 2M1RA 5TRBA 1Z60A 2D8SA 3SOWA 3PURA 5B79A 2CSZA 1WEPA 4AYCA 5D1KB 3MHHA 1VFYA 2FSAA 5C13A 2MA6A 2F6NA 2LXHC 2YU4A 2MA5A 4L7XA 1N87A 4I7CA 2MIQA 3N9PA 2JMJA 2KGGA 1X4UA 2LQ6A 3O33A 2KE1A 2BAYA 2VPGA 5B77A 4YBMA 3C6WA 2KWNA 5D1LB 5D1MB 3DPLR 4YATA 4IC3A 1WIMA 4GNDA 4C9ZA 1V87A 1JOCA 2ECWA 4AP4A 3HTKC 1Z6UA 4LKAA 4V3KC 1MM2A 1DVPA 3M63A 2PNXA 1K2FA 2KR4A 2LXPC 5FEYA 5H1UA 1XWHA 2AN6A 4N3WA 5JG6A 2YURA 3M62A 5B75A 2YSJA 2M85A 4FO9A 2ECGA 2VJFB 1HYIA 4LADB 2VPDA 3LRQA 4S3OB 5TBNA 2QIZA 2ECJA 2Y1NA 5LKUA 4WZ2A 1JM7B 4F52B 2G43A 3U5PA 3EB5A 1ZBDB 4FJCA 2H0DB 2KIZA 2YW8A 4BBQA 4GNGA 3HCTA 3N9LA 2KFTA 2YSMA 2VJEA 5DKAA 5C11A 4CA1A 4O64A 1Z2QA 2JMIA 4PPEA 5LCWB 3L11A 5J3XA 2KREA 4A49A 2JRJA 2ECIA 2YQLA 4LJNA 3ASLA 3O34A 2LV9A 2MD8C 1WEVA 4I7BA 2Y43A 3SHBA 2K17A 4P5OB 1RMDA 4ZUXU 4GNFA 4UP0A 2LGGA 4N4FA 4YBSA 3O37A 3RTRB 3SOXA 2ECTA 4R2YA 3C5KA 5LKXA 4A0CD 2MNZA 4MSXA 2CKLA 2VNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYC B;  2KWO A;  1T1H A;  2FUI A;  5KH3 A;  2L5U A;  5TDR A;  3DQV R;  2EA6 A;  3FL2 A;  2G45 A;  4ZDT A;  3EB6 A;  5KH9 A;  4GB0 A;  4YBT A;  3U5O A;  2KYU A;  2NAA A;  2K16 A;  2EOD A;  3L1Z B;  2M6M A;  1WEE A;  5FB0 A;  4AVX A;  2VPB A;  1WES A;  3VK6 A;  1WEU A;  2DX8 A;  4WZ0 A;  2YHO A;  4AUQ B;  2FUU A;  4LK9 A;  2YHN A;  3LQH A;  1E4U A;  1WEW A;  2XB1 A;  5H1V A;  2JMD A;  5AIT A;  4Q6F A;  4MVT A;  2MD7 B;  2CSY A;  3O36 A;  3O35 A;  2KGI A;  2K1J A;  4WA6 A;  5B76 A;  4UP5 A;  1WEQ A;  2E6R A;  2YQM A;  4B7Y C;  5FB1 A;  3ZYQ A;  2RI7 A;  2LGK A;  2EGP A;  2C2V S;  2VPE A;  1X4J A;  2KU3 A;  4A4C A;  3RPG B;  1WEM A;  3ZPV E;  3N9N A;  4TKP B;  2CT2 A;  5KH7 A;  4BHW A;  1WGM A;  3NG2 A;  1WE9 A;  3O7A A;  2HYE D;  3N9O A;  3M99 A;  2QIC A;  4R7E A;  3KNV A;  1WFK A;  3KQI A;  2ECV A;  2RSD A;  2VJE B;  3LQI A;  2L43 A;  1IYM A;  5I3L A;  3KV6 A;  1WEO A;  2MNY A;  2YT5 A;  3U5N A;  5LKT A;  3PUQ A;  3ZVZ B;  5B8D A;  2K4D A;  2L80 A;  4UI9 B;  1WIL A;  3N9Q A;  3GL6 A;  2G6Q A;  5H9M A;  4S3O C;  1VYX A;  2LRI C;  3HCS A;  1HYJ A;  4LLB A;  1LDK C;  2L0B A;  2E6S A;  2OXQ C;  2YUC A;  4YC9 A;  2F42 A;  3ZTG A;  1FP0 A;  1VD4 A;  5AIU A;  2CKL B;  4IC2 A;  3PHD A;  4QF3 A;  2MT5 A;  5H1T A;  3T7L A;  1X4I A;  5DIN A;  5LKZ A;  1WEN A;  2KWJ A;  3SOU A;  2ECN A;  3N9M A;  3ZPV 1;  3RPG C;  1CHC A;  5B78 A;  3KV5 A;  4V3L C;  5G04 B;  5G05 B;  4PTB A;  4X3G A;  1G25 A;  5TAB A;  2YYR A;  4A4B A;  2Y1M A;  2VJF A;  3U5M A;  3I2D A;  4ZQL A;  2C2L A;  4YAD A;  3O70 A;  3V43 A;  4YAB A;  4XI1 A;  3HCU A;  4FIP A;  4I7D A;  2LDR A;  2UZG A;  2HDP A;  2LGL A;  4WZ3 B;  3ZNI A;  5EYA F;  3LQJ A;  2F6J A;  2PUY A;  3MHS A;  4L58 A;  1JM7 A;  4B86 C;  2ZET C;  1F62 A;  2MUM A;  2LGV A;  1LDJ B;  2L75 A;  2H0D A;  1MM3 A;  3QZV A;  2YRE A;  5FER A;  3T6R A;  5G0F A;  2LN0 A;  4GNE A;  2QJ0 A;  1FBV A;  4NN2 A;  2VP7 A;  4CCG X;  3IHP A;  3L1X A;  2IDA A;  4R8P K;  2KWK A;  1BOR A;  4QF2 A;  1U6G B;  2XEU A;  4YAX A;  5TDW A;  4FK5 A;  2I50 A;  3ZVY A;  4W4U A;  2M3H A;  3GV4 A;  2M1R A;  5TRB A;  1Z60 A;  2D8S A;  3SOW A;  3PUR A;  5B79 A;  2CSZ A;  1WEP A;  4AYC A;  5D1K B;  3MHH A;  1VFY A;  2FSA A;  5C13 A;  2MA6 A;  2F6N A;  2LXH C;  2YU4 A;  2MA5 A;  4L7X A;  1N87 A;  4I7C A;  2MIQ A;  3N9P A;  2JMJ A;  2KGG A;  1X4U A;  2LQ6 A;  3O33 A;  2KE1 A;  2BAY A;  2VPG A;  5B77 A;  4YBM A;  3C6W A;  2KWN A;  5D1L B;  5D1M B;  3DPL R;  4YAT A;  4IC3 A;  1WIM A;  4GND A;  4C9Z A;  1V87 A;  1JOC A;  2ECW A;  4AP4 A;  3HTK C;  1Z6U A;  4LKA A;  4V3K C;  1MM2 A;  1DVP A;  3M63 A;  2PNX A;  1K2F A;  2KR4 A;  2LXP C;  5FEY A;  5H1U A;  1XWH A;  2AN6 A;  4N3W A;  5JG6 A;  2YUR A;  3M62 A;  5B75 A;  2YSJ A;  2M85 A;  4FO9 A;  2ECG A;  2VJF B;  1HYI A;  4LAD B;  2VPD A;  3LRQ A;  4S3O B;  5TBN A;  2QIZ A;  2ECJ A;  2Y1N A;  5LKU A;  4WZ2 A;  1JM7 B;  4F52 B;  2G43 A;  3U5P A;  3EB5 A;  1ZBD B;  4FJC A;  2H0D B;  2KIZ A;  2YW8 A;  4BBQ A;  4GNG A;  3HCT A;  3N9L A;  2KFT A;  2YSM A;  2VJE A;  5DKA A;  5C11 A;  4CA1 A;  4O64 A;  1Z2Q A;  2JMI A;  4PPE A;  5LCW B;  3L11 A;  5J3X A;  2KRE A;  4A49 A;  2JRJ A;  2ECI A;  2YQL A;  4LJN A;  3ASL A;  3O34 A;  2LV9 A;  2MD8 C;  1WEV A;  4I7B A;  2Y43 A;  3SHB A;  2K17 A;  4P5O B;  1RMD A;  4ZUX U;  4GNF A;  4UP0 A;  2LGG A;  4N4F A;  4YBS A;  3O37 A;  3RTR B;  3SOX A;  2ECT A;  4R2Y A;  3C5K A;  5LKX A;  4A0C D;  2MNZ A;  4MSX A;  2CKL A;  2VNF A; 
#chains in the Genus database with same CATH topology
 4AYC B;  2KWO A;  3T9K A;  2LAU A;  5SVI B;  1T1H A;  2FUI A;  5KH3 A;  2L5U A;  5TDR A;  3DQV R;  2EA6 A;  3FL2 A;  2G45 A;  4ZDT A;  3EB6 A;  5KH9 A;  4GB0 A;  4YBT A;  3U5O A;  2KYU A;  2NAA A;  3FEH A;  2JM3 A;  2K16 A;  2EOD A;  3L1Z B;  2M6M A;  1WEE A;  5FB0 A;  4AVX A;  3FAN A;  2VPB A;  2EXU A;  1WES A;  3VK6 A;  3DWD A;  1WEU A;  2DX8 A;  2YVR A;  4WZ0 A;  2YHO A;  4AUQ B;  2FUU A;  4LK9 A;  2YHN A;  3LQH A;  1E4U A;  3H7H A;  1WEW A;  2XB1 A;  5H1V A;  2KKX A;  2L7P A;  2JMD A;  5AIT A;  4Q6F A;  2B0O E;  4MVT A;  2MD7 B;  4F1P A;  2CSY A;  3O36 A;  3O35 A;  2E61 A;  2KGI A;  2K1J A;  4WA6 A;  5B76 A;  4UP5 A;  1WEQ A;  2E6R A;  2YQM A;  4B7Y C;  5FB1 A;  3ZYQ A;  2RI7 A;  2LGK A;  2EGP A;  2C2V S;  2VPE A;  1X4J A;  2KU3 A;  4A4C A;  3RPG B;  1WEM A;  3ZPV E;  3N9N A;  2DSM A;  4TKP B;  2CT2 A;  5KH7 A;  4BHW A;  1WGM A;  3NG2 A;  1WE9 A;  3O7A A;  2JUN A;  4Z0R A;  2HYE D;  3N9O A;  3M99 A;  2QIC A;  4R7E A;  3KNV A;  2XOZ A;  1WFK A;  3KQI A;  2D8U A;  1DCQ A;  1MBM A;  2ECV A;  2RSD A;  2VJE B;  3LQI A;  2FFW A;  2L43 A;  1IYM A;  5I3L A;  3KV6 A;  1WEO A;  2MNY A;  2YT5 A;  3U5N A;  5LKT A;  3PUQ A;  2OWA A;  3ZVZ B;  5B8D A;  2K4D A;  2L80 A;  4UI9 B;  1WIL A;  3N9Q A;  3GL6 A;  2G6Q A;  5H9M A;  4S3O C;  1VYX A;  2LRI C;  3HCS A;  1HYJ A;  4LLB A;  1LDK C;  2L0B A;  3MDB C;  2E6S A;  2OXQ C;  2XOC A;  2YUC A;  5SVY A;  4YC9 A;  2F42 A;  3ZTG A;  1FP0 A;  1VD4 A;  5AIU A;  2CKL B;  4IC2 A;  3PHD A;  4QF3 A;  3SUB A;  2MT5 A;  5H1T A;  3T7L A;  1X4I A;  5DIN A;  5LKZ A;  1WEN A;  2KWJ A;  3SOU A;  2ECN A;  2M13 A;  3N9M A;  3ZPV 1;  3RPG C;  1CHC A;  5B78 A;  4H9D A;  3KV5 A;  3Q1D A;  4V3L C;  5G04 B;  5G05 B;  4PTB A;  4X3G A;  1G25 A;  5TAB A;  3DDT A;  2YYR A;  4A4B A;  2Y1M A;  2VJF A;  3U5M A;  3I2D A;  4ZQL A;  2C2L A;  4YAD A;  3O70 A;  3V43 A;  4YAB A;  4XI1 A;  3HCU A;  4FIP A;  4I7D A;  3KDE C;  2LDR A;  2UZG A;  2HDP A;  4OGE A;  2LGL A;  4WZ3 B;  3LVQ E;  3ZNI A;  5EYA F;  3LQJ A;  2F6J A;  4O62 A;  2PUY A;  3MHS A;  4L58 A;  1JM7 A;  4B86 C;  2ZET C;  1F62 A;  3FJU B;  2MUM A;  2LGV A;  1LDJ B;  2L75 A;  2H0D A;  2CRR A;  1MM3 A;  3QZV A;  2EGM A;  4QQ4 A;  3O47 A;  2YRE A;  5FER A;  3T6R A;  5G0F A;  2LN0 A;  4GNE A;  2QJ0 A;  1FBV A;  4NN2 A;  2VP7 A;  4CCG X;  3IHP A;  3L1X A;  2IDA A;  4R8P K;  2KWK A;  3LVR E;  1BOR A;  4QF2 A;  1U6G B;  2XEU A;  4YAX A;  5TDW A;  4FK5 A;  2I50 A;  3ZVY A;  4W4U A;  2M3H A;  3PLW A;  3GV4 A;  2M1R A;  2IQJ A;  5TRB A;  1Z60 A;  2D8S A;  3SOW A;  3PUR A;  5B79 A;  2CSZ A;  1WEP A;  2XOY A;  4AYC A;  2DJA A;  2CRW A;  5D1K B;  5SVI A;  5SVX A;  3MHH A;  1VFY A;  2RR4 A;  2FSA A;  5C13 A;  2MA6 A;  2F6N A;  2LXH C;  2KKY A;  2YU4 A;  2MA5 A;  4L7X A;  1N87 A;  4I7C A;  2MIQ A;  3N9P A;  2JMJ A;  2KGG A;  1X4U A;  2LQ6 A;  3O33 A;  2KE1 A;  2BAY A;  3M7K A;  2VPG A;  5B77 A;  4YBM A;  3C6W A;  3E2D A;  2KWN A;  5D1L B;  5D1M B;  3DPL R;  4YAT A;  4IC3 A;  1WIM A;  3LDY A;  4GND A;  4C9Z A;  1V87 A;  1JOC A;  2ECW A;  3FM8 C;  4AP4 A;  2FD4 A;  3HTK C;  1Z6U A;  4LKA A;  4V3K C;  1MM2 A;  1DVP A;  3M63 A;  2PNX A;  3LJU X;  1K2F A;  2KR4 A;  2LXP C;  5FEY A;  5H1U A;  3JUE A;  1XWH A;  2AN6 A;  4N3W A;  5JG6 A;  2YUR A;  3M62 A;  5B75 A;  2YSJ A;  2M85 A;  4FO9 A;  2ECG A;  2VJF B;  1HYI A;  4LAD B;  2VPD A;  3LRQ A;  4S3O B;  5TBN A;  2CON A;  2QIZ A;  2ECJ A;  2Y1N A;  4OGC A;  5LKU A;  4WZ2 A;  1JM7 B;  4F52 B;  2XP0 A;  2G43 A;  3U5P A;  3EB5 A;  1ZBD B;  4FJC A;  4Z0O A;  2H0D B;  2KIZ A;  2YW8 A;  4BBQ A;  2CSV A;  4GNG A;  3HCT A;  3N9L A;  2KFT A;  2YSM A;  2VJE A;  5DKA A;  5C11 A;  4CA1 A;  4O64 A;  1Z2Q A;  2JMI A;  4PPE A;  5LCW B;  3L11 A;  5J3X A;  2KRE A;  4A49 A;  2JRJ A;  2ECI A;  2YQL A;  4LJN A;  3ASL A;  3O34 A;  2LV9 A;  2MD8 C;  1WEV A;  4I7B A;  2Y43 A;  3SHB A;  2K17 A;  4P5O B;  1RMD A;  4ZUX U;  2P57 A;  4GNF A;  4UP0 A;  2LGG A;  4N4F A;  5K3Q A;  4YBS A;  3O37 A;  3RTR B;  2MKE A;  2ECT A;  4R2Y A;  3SOX A;  3C5K A;  5LKX A;  4A0C D;  2MNZ A;  4MSX A;  2CKL A;  3FAO A;  2VNF A; 
#chains in the Genus database with same CATH homology
 4AYC B;  2KWO A;  1T1H A;  2FUI A;  5KH3 A;  2L5U A;  5TDR A;  3DQV R;  2EA6 A;  3FL2 A;  2G45 A;  4ZDT A;  3EB6 A;  5KH9 A;  4GB0 A;  4YBT A;  3U5O A;  2KYU A;  2NAA A;  2K16 A;  2EOD A;  3L1Z B;  2M6M A;  1WEE A;  5FB0 A;  4AVX A;  2VPB A;  1WES A;  3VK6 A;  1WEU A;  2DX8 A;  4WZ0 A;  2YHO A;  4AUQ B;  2FUU A;  4LK9 A;  2YHN A;  3LQH A;  1E4U A;  1WEW A;  2XB1 A;  5H1V A;  2JMD A;  5AIT A;  4Q6F A;  4MVT A;  2MD7 B;  2CSY A;  3O36 A;  3O35 A;  2KGI A;  2K1J A;  4WA6 A;  5B76 A;  4UP5 A;  1WEQ A;  2E6R A;  2YQM A;  4B7Y C;  5FB1 A;  3ZYQ A;  2RI7 A;  2LGK A;  2EGP A;  2C2V S;  2VPE A;  1X4J A;  2KU3 A;  4A4C A;  3RPG B;  1WEM A;  3ZPV E;  3N9N A;  4TKP B;  2CT2 A;  5KH7 A;  4BHW A;  1WGM A;  3NG2 A;  1WE9 A;  3O7A A;  2HYE D;  3N9O A;  3M99 A;  2QIC A;  4R7E A;  3KNV A;  1WFK A;  3KQI A;  2ECV A;  2RSD A;  2VJE B;  3LQI A;  2L43 A;  1IYM A;  5I3L A;  3KV6 A;  1WEO A;  2MNY A;  2YT5 A;  3U5N A;  5LKT A;  3PUQ A;  3ZVZ B;  5B8D A;  2K4D A;  2L80 A;  4UI9 B;  1WIL A;  3N9Q A;  3GL6 A;  2G6Q A;  5H9M A;  4S3O C;  1VYX A;  2LRI C;  3HCS A;  1HYJ A;  4LLB A;  1LDK C;  2L0B A;  2E6S A;  2OXQ C;  2YUC A;  4YC9 A;  2F42 A;  3ZTG A;  1FP0 A;  1VD4 A;  5AIU A;  2CKL B;  4IC2 A;  3PHD A;  4QF3 A;  2MT5 A;  5H1T A;  3T7L A;  1X4I A;  5DIN A;  5LKZ A;  1WEN A;  2KWJ A;  3SOU A;  2ECN A;  3N9M A;  3ZPV 1;  3RPG C;  1CHC A;  5B78 A;  3KV5 A;  4V3L C;  5G04 B;  5G05 B;  4PTB A;  4X3G A;  1G25 A;  5TAB A;  2YYR A;  4A4B A;  2Y1M A;  2VJF A;  3U5M A;  3I2D A;  4ZQL A;  2C2L A;  4YAD A;  3O70 A;  3V43 A;  4YAB A;  4XI1 A;  3HCU A;  4FIP A;  4I7D A;  2LDR A;  2UZG A;  2HDP A;  2LGL A;  4WZ3 B;  3ZNI A;  5EYA F;  3LQJ A;  2F6J A;  2PUY A;  3MHS A;  4L58 A;  1JM7 A;  4B86 C;  2ZET C;  1F62 A;  2MUM A;  2LGV A;  1LDJ B;  2L75 A;  2H0D A;  1MM3 A;  3QZV A;  2YRE A;  5FER A;  3T6R A;  5G0F A;  2LN0 A;  4GNE A;  2QJ0 A;  1FBV A;  4NN2 A;  2VP7 A;  4CCG X;  3IHP A;  3L1X A;  2IDA A;  4R8P K;  2KWK A;  1BOR A;  4QF2 A;  1U6G B;  2XEU A;  4YAX A;  5TDW A;  4FK5 A;  2I50 A;  3ZVY A;  4W4U A;  2M3H A;  3GV4 A;  2M1R A;  5TRB A;  1Z60 A;  2D8S A;  3SOW A;  3PUR A;  5B79 A;  2CSZ A;  1WEP A;  4AYC A;  5D1K B;  3MHH A;  1VFY A;  2FSA A;  5C13 A;  2MA6 A;  2F6N A;  2LXH C;  2YU4 A;  2MA5 A;  4L7X A;  1N87 A;  4I7C A;  2MIQ A;  3N9P A;  2JMJ A;  2KGG A;  1X4U A;  2LQ6 A;  3O33 A;  2KE1 A;  2BAY A;  2VPG A;  5B77 A;  4YBM A;  3C6W A;  2KWN A;  5D1L B;  5D1M B;  3DPL R;  4YAT A;  4IC3 A;  1WIM A;  4GND A;  4C9Z A;  1V87 A;  1JOC A;  2ECW A;  4AP4 A;  3HTK C;  1Z6U A;  4LKA A;  4V3K C;  1MM2 A;  1DVP A;  3M63 A;  2PNX A;  1K2F A;  2KR4 A;  2LXP C;  5FEY A;  5H1U A;  1XWH A;  2AN6 A;  4N3W A;  5JG6 A;  2YUR A;  3M62 A;  5B75 A;  2YSJ A;  2M85 A;  4FO9 A;  2ECG A;  2VJF B;  1HYI A;  4LAD B;  2VPD A;  3LRQ A;  4S3O B;  5TBN A;  2QIZ A;  2ECJ A;  2Y1N A;  5LKU A;  4WZ2 A;  1JM7 B;  4F52 B;  2G43 A;  3U5P A;  3EB5 A;  1ZBD B;  4FJC A;  2H0D B;  2KIZ A;  2YW8 A;  4BBQ A;  4GNG A;  3HCT A;  3N9L A;  2KFT A;  2YSM A;  2VJE A;  5DKA A;  5C11 A;  4CA1 A;  4O64 A;  1Z2Q A;  2JMI A;  4PPE A;  5LCW B;  3L11 A;  5J3X A;  2KRE A;  4A49 A;  2JRJ A;  2ECI A;  2YQL A;  4LJN A;  3ASL A;  3O34 A;  2LV9 A;  2MD8 C;  1WEV A;  4I7B A;  2Y43 A;  3SHB A;  2K17 A;  4P5O B;  1RMD A;  4ZUX U;  4GNF A;  4UP0 A;  2LGG A;  4N4F A;  4YBS A;  3O37 A;  3RTR B;  3SOX A;  2ECT A;  4R2Y A;  3C5K A;  5LKX A;  4A0C D;  2MNZ A;  4MSX A;  2CKL A;  2VNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...