5JG6A

Apc11-ubv shows role of noncovalent ring-ubiquitin interactions in processive multiubiquitination and ubiquitin chain elongation by apc/c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
61
Chain Sequence
DENCGICRMAFNGCCPDCDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual RING E3 Architectures Regulate Multiubiquitination and Ubiquitin Chain Elongation by APC/C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Anaphase-promoting complex subunit 11
total genus 14
structure length 61
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5jg6A00
1F62A 3SOWA 1RMDA 1WEQA 5FERA 4GNFA 1JOCA 3O34A 3L11A 1E4UA 4R8PK 4P5OB 2OXQC 2E6SA 3SHBA 5B77A 4PTBA 3MHHA 1N87A 3NG2A 4YC9A 1WEUA 2M3HA 4WZ3B 4IC2A 2C2LA 1WEEA 4AVXA 2G45A 5TRBA 1CHCA 5H1VA 3ASLA 4WZ2A 2KWJA 1WENA 3FL2A 2MT5A 4B7YC 3DQVR 3M62A 2YYRA 4WZ0A 2IDAA 2C2VS 2LGGA 2YW8A 2ECJA 3U5MA 2FUUA 1JM7B 2JMJA 1WIMA 4ZQLA 1DVPA 2KGGA 2ECNA 4YBTA 4UP5A 5H1TA 4O64A 1LDKC 1IYMA 4CCGX 3PUQA 3ZNIA 2EGPA 2L5UA 5JG6A 5TDRA 1WEVA 5B75A 4AP4A 4R7EA 3GV4A 4W4UA 2D8SA 3ZVZB 3O33A 4YADA 2VPDA 2PNXA 4LADB 2K1JA 4UP0A 2FSAA 2YSJA 2JMIA 2DX8A 3ZYQA 4WA6A 5D1KB 2YURA 3SOXA 4IC3A 1K2FA 1XWHA 2XEUA 5C13A 5LKXA 1WESA 3ZTGA 2ECGA 3T7LA 4ZUXU 3U5PA 5TBNA 4N4FA 2KIZA 1HYIA 3I2DA 4BHWA 3KV5A 4F52B 5J3XA 1FBVA 2CSZA 5G05B 3ZPVE 1WE9A 1LDJB 5LKTA 4V3KC 5G04B 2MUMA 2MD8C 2L0BA 2VJEB 2CKLB 3N9PA 4L58A 3N9LA 4QF2A 2YUCA 2LQ6A 4N3WA 4CA1A 3MHSA 1T1HA 5D1MB 2K4DA 3LQHA 3M63A 2Y1MA 4I7DA 1X4UA 2VPBA 5DINA 3IHPA 2VPEA 2YQLA 3QZVA 3N9NA 2MA5A 2MD7B 5H1UA 3C5KA 4MSXA 5B8DA 5LKUA 2VJFB 4LJNA 2VP7A 4L7XA 3O37A 1WEPA 2H0DA 4AYCA 4A49A 2FUIA 2Y1NA 1V87A 4FK5A 2YU4A 1ZBDB 4PPEA 2YT5A 4NN2A 2M85A 2KR4A 4AUQB 5FB0A 4FO9A 2KWOA 5B78A 2ECTA 2M1RA 4R2YA 4GNGA 2VJFA 3GL6A 2L43A 5EYAF 2I50A 1HYJA 1VYXA 4YBSA 2KYUA 2QICA 3SOUA 5C11A 5KH9A 1WGMA 5TDWA 1BORA 2ECVA 1WEWA 2KWKA 4S3OC 4YATA 1MM2A 3EB6A 3PURA 3KNVA 2LN0A 4QF3A 2YHOA 3HTKC 3V43A 4GB0A 2VJEA 3HCTA 2HYED 1Z2QA 3O35A 2MNZA 2KGIA 3EB5A 3KV6A 2Y43A 2LGKA 3ZVYA 2LV9A 5H9MA 2KU3A 4YAXA 3N9MA 2ECIA 2G43A 3LQJA 3HCUA 5I3LA 3C6WA 3KQIA 2RI7A 2QJ0A 5TABA 4FJCA 4A0CD 3U5NA 3N9QA 2HDPA 4BBQA 2BAYA 3PHDA 1FP0A 4XI1A 2ZETC 3O7AA 2ECWA 2F6NA 2QIZA 1U6GB 3RTRB 1X4JA 5AIUA 2F6JA 5DKAA 4GNEA 2LRIC 4V3LC 2K16A 4A4BA 5B79A 2M6MA 5LKZA 3L1XA 4LKAA 4C9ZA 1MM3A 3ZPV1 4GNDA 4I7CA 5LCWB 1JM7A 5G0FA 5FEYA 1VD4A 1Z6UA 2VNFA 2VPGA 4UI9B 1WEMA 3RPGC 2H0DB 4AYCB 2CSYA 2RSDA 3M99A 2MNYA 4I7BA 2KWNA 2YSMA 5KH7A 2G6QA 4Q6FA 3LRQA 5D1LB 2YHNA 2LGVA 2F42A 1Z60A 2KE1A 2EA6A 5FB1A 3VK6A 2CT2A 1X4IA 4S3OB 2KREA 4A4CA 5B76A 2EODA 3N9OA 3HCSA 4LK9A 4MVTA 2UZGA 2MIQA 1VFYA 5KH3A 3O36A 3U5OA 2LXPC 3L1ZB 2YQMA 2L75A 2L80A 2NAAA 3RPGB 3DPLR 2JRJA 4FIPA 4LLBA 2JMDA 4B86C 2CKLA 3T6RA 2LGLA 1G25A 3O70A 2MA6A 5AITA 2E6RA 2PUYA 4TKPB 2YREA 2XB1A 4X3GA 2KFTA 3LQIA 2LDRA 4YABA 2K17A 1WILA 1WEOA 1WFKA 4ZDTA 4YBMA 2AN6A 2LXHC
chains in the Genus database with same CATH superfamily
4H9DA 1F62A 3SOWA 1RMDA 1WEQA 5FERA 4GNFA 1JOCA 3O34A 3L11A 1E4UA 4R8PK 4P5OB 2OXQC 2E6SA 3SHBA 5B77A 4PTBA 3MHHA 1N87A 3NG2A 4YC9A 1WEUA 2M3HA 5SVIA 4WZ3B 4IC2A 2C2LA 1WEEA 4AVXA 2G45A 5TRBA 1MBMA 1CHCA 3SUBA 5H1VA 3ASLA 4WZ2A 2KWJA 1WENA 3FL2A 2MT5A 4B7YC 3DQVR 5SVIB 3M62A 2YYRA 4WZ0A 2IDAA 2C2VS 2LGGA 2YW8A 2ECJA 3U5MA 2FUUA 5SVYA 1JM7B 2JMJA 1WIMA 4ZQLA 1DVPA 4F1PA 2KGGA 2ECNA 4YBTA 4UP5A 5H1TA 4O64A 2XOCA 1LDKC 3KDEC 1IYMA 4CCGX 3PUQA 3ZNIA 2EGPA 2L5UA 5JG6A 5TDRA 1WEVA 5B75A 4AP4A 4R7EA 3GV4A 4W4UA 2D8SA 2XOZA 3ZVZB 3O33A 4YADA 2VPDA 2PNXA 4LADB 2K1JA 4UP0A 2FSAA 2D8UA 2YSJA 2JMIA 3PLWA 2DX8A 4O62A 3ZYQA 4WA6A 5D1KB 2YURA 3SOXA 4IC3A 1K2FA 3FM8C 1XWHA 2XEUA 5C13A 5LKXA 1WESA 3H7HA 3ZTGA 2ECGA 3T7LA 2RR4A 4ZUXU 3U5PA 5TBNA 4N4FA 2KIZA 1HYIA 3I2DA 4BHWA 3KV5A 4F52B 5J3XA 1FBVA 2CSZA 5G05B 3ZPVE 1WE9A 1LDJB 5LKTA 4V3KC 5G04B 2MUMA 3T9KA 2MD8C 4Z0RA 2L0BA 2VJEB 2CKLB 3N9PA 4L58A 3N9LA 4QF2A 2YUCA 2LQ6A 4N3WA 4CA1A 2E61A 3FANA 3MHSA 5D1MB 1T1HA 2K4DA 3LQHA 3M63A 2Y1MA 4I7DA 1X4UA 2VPBA 3E2DA 5DINA 3IHPA 2VPEA 2YQLA 3QZVA 3N9NA 2MA5A 2MD7B 5H1UA 3C5KA 3LDYA 4MSXA 5B8DA 5LKUA 2VJFB 4LJNA 2VP7A 4L7XA 2LAUA 3O37A 1WEPA 2H0DA 4AYCA 5K3QA 4A49A 2FUIA 2Y1NA 1V87A 4FK5A 3M7KA 2CRRA 3DWDA 2YU4A 1ZBDB 4PPEA 2YT5A 4NN2A 2MKEA 2M85A 2KR4A 4AUQB 5FB0A 4FO9A 2KWOA 3Q1DA 5B78A 2ECTA 2M1RA 2FD4A 4R2YA 2CSVA 4GNGA 2VJFA 3GL6A 2L43A 5EYAF 2I50A 2M13A 1HYJA 1VYXA 3JUEA 4YBSA 2KYUA 2QICA 3SOUA 2DSMA 5C11A 4OGCA 5KH9A 1WGMA 5TDWA 1BORA 2ECVA 3DDTA 1WEWA 2IQJA 2KWKA 4S3OC 4YATA 1MM2A 3EB6A 3PURA 3KNVA 2JM3A 2LN0A 4QF3A 2YHOA 2EXUA 3HTKC 4GB0A 3V43A 2VJEA 1DCQA 3HCTA 2HYED 1Z2QA 3LVRE 3O35A 2MNZA 2KGIA 3EB5A 3KV6A 2Y43A 2LGKA 4OGEA 3ZVYA 2LV9A 5H9MA 2KU3A 4YAXA 2FFWA 3N9MA 2EGMA 2ECIA 2G43A 3LQJA 3HCUA 5I3LA 3C6WA 3KQIA 2RI7A 2QJ0A 2XP0A 5TABA 3O47A 4FJCA 4A0CD 3U5NA 3N9QA 2HDPA 4BBQA 2BAYA 3PHDA 1FP0A 3LVQE 4XI1A 2ZETC 3O7AA 2ECWA 2F6NA 2QIZA 1U6GB 3RTRB 1X4JA 5AIUA 2F6JA 5DKAA 4GNEA 2LRIC 4V3LC 2K16A 3FAOA 4A4BA 5B79A 2M6MA 2JUNA 5LKZA 2KKXA 3L1XA 2L7PA 4LKAA 4C9ZA 1MM3A 3ZPV1 4GNDA 4I7CA 5LCWB 1JM7A 5G0FA 5FEYA 1VD4A 1Z6UA 2VNFA 2VPGA 4UI9B 1WEMA 3RPGC 2H0DB 4AYCB 2CSYA 2RSDA 3M99A 2MNYA 4I7BA 2KWNA 2YSMA 5KH7A 2G6QA 4Q6FA 3LRQA 5D1LB 2YHNA 2B0OE 2LGVA 2F42A 2CRWA 1Z60A 2KE1A 2EA6A 5FB1A 3VK6A 2CT2A 1X4IA 4S3OB 2KREA 4A4CA 4QQ4A 5B76A 2EODA 3N9OA 3HCSA 4LK9A 4MVTA 2P57A 2MIQA 2UZGA 1VFYA 4Z0OA 5KH3A 2CONA 3O36A 3U5OA 3MDBC 2LXPC 3L1ZB 2YQMA 2L75A 2L80A 2NAAA 3RPGB 2DJAA 3DPLR 2JRJA 4FIPA 4LLBA 2JMDA 4B86C 2CKLA 3T6RA 2KKYA 2LGLA 2OWAA 1G25A 3O70A 2MA6A 5AITA 2E6RA 2XOYA 2PUYA 4TKPB 2YREA 3FJUB 2XB1A 4X3GA 2KFTA 3LQIA 2LDRA 4YABA 2K17A 1WILA 1WEOA 3FEHA 1WFKA 4ZDTA 4YBMA 2AN6A 2YVRA 3LJUX 2LXHC 5SVXA
chains in the Genus database with same CATH topology
1F62A 3SOWA 1RMDA 1WEQA 5FERA 4GNFA 1JOCA 3O34A 3L11A 1E4UA 4R8PK 4P5OB 2OXQC 2E6SA 3SHBA 5B77A 4PTBA 3MHHA 1N87A 3NG2A 4YC9A 1WEUA 2M3HA 4WZ3B 4IC2A 2C2LA 1WEEA 4AVXA 2G45A 5TRBA 1CHCA 5H1VA 3ASLA 4WZ2A 2KWJA 1WENA 3FL2A 2MT5A 4B7YC 3DQVR 3M62A 2YYRA 4WZ0A 2IDAA 2C2VS 2LGGA 2YW8A 2ECJA 3U5MA 2FUUA 1JM7B 2JMJA 1WIMA 4ZQLA 1DVPA 2KGGA 2ECNA 4YBTA 4UP5A 5H1TA 4O64A 1LDKC 1IYMA 4CCGX 3PUQA 3ZNIA 2EGPA 2L5UA 5JG6A 5TDRA 1WEVA 5B75A 4AP4A 4R7EA 3GV4A 4W4UA 2D8SA 3ZVZB 3O33A 4YADA 2VPDA 2PNXA 4LADB 2K1JA 4UP0A 2FSAA 2YSJA 2JMIA 2DX8A 3ZYQA 4WA6A 5D1KB 2YURA 3SOXA 4IC3A 1K2FA 1XWHA 2XEUA 5C13A 5LKXA 1WESA 3ZTGA 2ECGA 3T7LA 4ZUXU 3U5PA 5TBNA 4N4FA 2KIZA 1HYIA 3I2DA 4BHWA 3KV5A 4F52B 5J3XA 1FBVA 2CSZA 5G05B 3ZPVE 1WE9A 1LDJB 5LKTA 4V3KC 5G04B 2MUMA 2MD8C 2L0BA 2VJEB 2CKLB 3N9PA 4L58A 3N9LA 4QF2A 2YUCA 2LQ6A 4N3WA 4CA1A 3MHSA 1T1HA 5D1MB 2K4DA 3LQHA 3M63A 2Y1MA 4I7DA 1X4UA 2VPBA 5DINA 3IHPA 2VPEA 2YQLA 3QZVA 3N9NA 2MA5A 2MD7B 5H1UA 3C5KA 4MSXA 5B8DA 5LKUA 2VJFB 4LJNA 2VP7A 4L7XA 3O37A 1WEPA 2H0DA 4AYCA 4A49A 2FUIA 2Y1NA 1V87A 4FK5A 2YU4A 1ZBDB 4PPEA 2YT5A 4NN2A 2M85A 2KR4A 4AUQB 5FB0A 4FO9A 2KWOA 5B78A 2ECTA 2M1RA 4R2YA 4GNGA 2VJFA 3GL6A 2L43A 5EYAF 2I50A 1HYJA 1VYXA 4YBSA 2KYUA 2QICA 3SOUA 5C11A 5KH9A 1WGMA 5TDWA 1BORA 2ECVA 1WEWA 2KWKA 4S3OC 4YATA 1MM2A 3EB6A 3PURA 3KNVA 2LN0A 4QF3A 2YHOA 3HTKC 3V43A 4GB0A 2VJEA 3HCTA 2HYED 1Z2QA 3O35A 2MNZA 2KGIA 3EB5A 3KV6A 2Y43A 2LGKA 3ZVYA 2LV9A 5H9MA 2KU3A 4YAXA 3N9MA 2ECIA 2G43A 3LQJA 3HCUA 5I3LA 3C6WA 3KQIA 2RI7A 2QJ0A 5TABA 4FJCA 4A0CD 3U5NA 3N9QA 2HDPA 4BBQA 2BAYA 3PHDA 1FP0A 4XI1A 2ZETC 3O7AA 2ECWA 2F6NA 2QIZA 1U6GB 3RTRB 1X4JA 5AIUA 2F6JA 5DKAA 4GNEA 2LRIC 4V3LC 2K16A 4A4BA 5B79A 2M6MA 5LKZA 3L1XA 4LKAA 4C9ZA 1MM3A 3ZPV1 4GNDA 4I7CA 5LCWB 1JM7A 5G0FA 5FEYA 1VD4A 1Z6UA 2VNFA 2VPGA 4UI9B 1WEMA 3RPGC 2H0DB 4AYCB 2CSYA 2RSDA 3M99A 2MNYA 4I7BA 2KWNA 2YSMA 5KH7A 2G6QA 4Q6FA 3LRQA 5D1LB 2YHNA 2LGVA 2F42A 1Z60A 2KE1A 2EA6A 5FB1A 3VK6A 2CT2A 1X4IA 4S3OB 2KREA 4A4CA 5B76A 2EODA 3N9OA 3HCSA 4LK9A 4MVTA 2UZGA 2MIQA 1VFYA 5KH3A 3O36A 3U5OA 2LXPC 3L1ZB 2YQMA 2L75A 2L80A 2NAAA 3RPGB 3DPLR 2JRJA 4FIPA 4LLBA 2JMDA 4B86C 2CKLA 3T6RA 2LGLA 1G25A 3O70A 2MA6A 5AITA 2E6RA 2PUYA 4TKPB 2YREA 2XB1A 4X3GA 2KFTA 3LQIA 2LDRA 4YABA 2K17A 1WILA 1WEOA 1WFKA 4ZDTA 4YBMA 2AN6A 2LXHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F62 A;  3SOW A;  1RMD A;  1WEQ A;  5FER A;  4GNF A;  1JOC A;  3O34 A;  3L11 A;  1E4U A;  4R8P K;  4P5O B;  2OXQ C;  2E6S A;  3SHB A;  5B77 A;  4PTB A;  3MHH A;  1N87 A;  3NG2 A;  4YC9 A;  1WEU A;  2M3H A;  4WZ3 B;  4IC2 A;  2C2L A;  1WEE A;  4AVX A;  2G45 A;  5TRB A;  1CHC A;  5H1V A;  3ASL A;  4WZ2 A;  2KWJ A;  1WEN A;  3FL2 A;  2MT5 A;  4B7Y C;  3DQV R;  3M62 A;  2YYR A;  4WZ0 A;  2IDA A;  2C2V S;  2LGG A;  2YW8 A;  2ECJ A;  3U5M A;  2FUU A;  1JM7 B;  2JMJ A;  1WIM A;  4ZQL A;  1DVP A;  2KGG A;  2ECN A;  4YBT A;  4UP5 A;  5H1T A;  4O64 A;  1LDK C;  1IYM A;  4CCG X;  3PUQ A;  3ZNI A;  2EGP A;  2L5U A;  5JG6 A;  5TDR A;  1WEV A;  5B75 A;  4AP4 A;  4R7E A;  3GV4 A;  4W4U A;  2D8S A;  3ZVZ B;  3O33 A;  4YAD A;  2VPD A;  2PNX A;  4LAD B;  2K1J A;  4UP0 A;  2FSA A;  2YSJ A;  2JMI A;  2DX8 A;  3ZYQ A;  4WA6 A;  5D1K B;  2YUR A;  3SOX A;  4IC3 A;  1K2F A;  1XWH A;  2XEU A;  5C13 A;  5LKX A;  1WES A;  3ZTG A;  2ECG A;  3T7L A;  4ZUX U;  3U5P A;  5TBN A;  4N4F A;  2KIZ A;  1HYI A;  3I2D A;  4BHW A;  3KV5 A;  4F52 B;  5J3X A;  1FBV A;  2CSZ A;  5G05 B;  3ZPV E;  1WE9 A;  1LDJ B;  5LKT A;  4V3K C;  5G04 B;  2MUM A;  2MD8 C;  2L0B A;  2VJE B;  2CKL B;  3N9P A;  4L58 A;  3N9L A;  4QF2 A;  2YUC A;  2LQ6 A;  4N3W A;  4CA1 A;  3MHS A;  1T1H A;  5D1M B;  2K4D A;  3LQH A;  3M63 A;  2Y1M A;  4I7D A;  1X4U A;  2VPB A;  5DIN A;  3IHP A;  2VPE A;  2YQL A;  3QZV A;  3N9N A;  2MA5 A;  2MD7 B;  5H1U A;  3C5K A;  4MSX A;  5B8D A;  5LKU A;  2VJF B;  4LJN A;  2VP7 A;  4L7X A;  3O37 A;  1WEP A;  2H0D A;  4AYC A;  4A49 A;  2FUI A;  2Y1N A;  1V87 A;  4FK5 A;  2YU4 A;  1ZBD B;  4PPE A;  2YT5 A;  4NN2 A;  2M85 A;  2KR4 A;  4AUQ B;  5FB0 A;  4FO9 A;  2KWO A;  5B78 A;  2ECT A;  2M1R A;  4R2Y A;  4GNG A;  2VJF A;  3GL6 A;  2L43 A;  5EYA F;  2I50 A;  1HYJ A;  1VYX A;  4YBS A;  2KYU A;  2QIC A;  3SOU A;  5C11 A;  5KH9 A;  1WGM A;  5TDW A;  1BOR A;  2ECV A;  1WEW A;  2KWK A;  4S3O C;  4YAT A;  1MM2 A;  3EB6 A;  3PUR A;  3KNV A;  2LN0 A;  4QF3 A;  2YHO A;  3HTK C;  3V43 A;  4GB0 A;  2VJE A;  3HCT A;  2HYE D;  1Z2Q A;  3O35 A;  2MNZ A;  2KGI A;  3EB5 A;  3KV6 A;  2Y43 A;  2LGK A;  3ZVY A;  2LV9 A;  5H9M A;  2KU3 A;  4YAX A;  3N9M A;  2ECI A;  2G43 A;  3LQJ A;  3HCU A;  5I3L A;  3C6W A;  3KQI A;  2RI7 A;  2QJ0 A;  5TAB A;  4FJC A;  4A0C D;  3U5N A;  3N9Q A;  2HDP A;  4BBQ A;  2BAY A;  3PHD A;  1FP0 A;  4XI1 A;  2ZET C;  3O7A A;  2ECW A;  2F6N A;  2QIZ A;  1U6G B;  3RTR B;  1X4J A;  5AIU A;  2F6J A;  5DKA A;  4GNE A;  2LRI C;  4V3L C;  2K16 A;  4A4B A;  5B79 A;  2M6M A;  5LKZ A;  3L1X A;  4LKA A;  4C9Z A;  1MM3 A;  3ZPV 1;  4GND A;  4I7C A;  5LCW B;  1JM7 A;  5G0F A;  5FEY A;  1VD4 A;  1Z6U A;  2VNF A;  2VPG A;  4UI9 B;  1WEM A;  3RPG C;  2H0D B;  4AYC B;  2CSY A;  2RSD A;  3M99 A;  2MNY A;  4I7B A;  2KWN A;  2YSM A;  5KH7 A;  2G6Q A;  4Q6F A;  3LRQ A;  5D1L B;  2YHN A;  2LGV A;  2F42 A;  1Z60 A;  2KE1 A;  2EA6 A;  5FB1 A;  3VK6 A;  2CT2 A;  1X4I A;  4S3O B;  2KRE A;  4A4C A;  5B76 A;  2EOD A;  3N9O A;  3HCS A;  4LK9 A;  4MVT A;  2UZG A;  2MIQ A;  1VFY A;  5KH3 A;  3O36 A;  3U5O A;  2LXP C;  3L1Z B;  2YQM A;  2L75 A;  2L80 A;  2NAA A;  3RPG B;  3DPL R;  2JRJ A;  4FIP A;  4LLB A;  2JMD A;  4B86 C;  2CKL A;  3T6R A;  2LGL A;  1G25 A;  3O70 A;  2MA6 A;  5AIT A;  2E6R A;  2PUY A;  4TKP B;  2YRE A;  2XB1 A;  4X3G A;  2KFT A;  3LQI A;  2LDR A;  4YAB A;  2K17 A;  1WIL A;  1WEO A;  1WFK A;  4ZDT A;  4YBM A;  2AN6 A;  2LXH C; 
#chains in the Genus database with same CATH topology
 4H9D A;  1F62 A;  3SOW A;  1RMD A;  1WEQ A;  5FER A;  4GNF A;  1JOC A;  3O34 A;  3L11 A;  1E4U A;  4R8P K;  4P5O B;  2OXQ C;  2E6S A;  3SHB A;  5B77 A;  4PTB A;  3MHH A;  1N87 A;  3NG2 A;  4YC9 A;  1WEU A;  2M3H A;  5SVI A;  4WZ3 B;  4IC2 A;  2C2L A;  1WEE A;  4AVX A;  2G45 A;  5TRB A;  1MBM A;  1CHC A;  3SUB A;  5H1V A;  3ASL A;  4WZ2 A;  2KWJ A;  1WEN A;  3FL2 A;  2MT5 A;  4B7Y C;  3DQV R;  5SVI B;  3M62 A;  2YYR A;  4WZ0 A;  2IDA A;  2C2V S;  2LGG A;  2YW8 A;  2ECJ A;  3U5M A;  2FUU A;  5SVY A;  1JM7 B;  2JMJ A;  1WIM A;  4ZQL A;  1DVP A;  4F1P A;  2KGG A;  2ECN A;  4YBT A;  4UP5 A;  5H1T A;  4O64 A;  2XOC A;  1LDK C;  3KDE C;  1IYM A;  4CCG X;  3PUQ A;  3ZNI A;  2EGP A;  2L5U A;  5JG6 A;  5TDR A;  1WEV A;  5B75 A;  4AP4 A;  4R7E A;  3GV4 A;  4W4U A;  2D8S A;  2XOZ A;  3ZVZ B;  3O33 A;  4YAD A;  2VPD A;  2PNX A;  4LAD B;  2K1J A;  4UP0 A;  2FSA A;  2D8U A;  2YSJ A;  2JMI A;  3PLW A;  2DX8 A;  4O62 A;  3ZYQ A;  4WA6 A;  5D1K B;  2YUR A;  3SOX A;  4IC3 A;  1K2F A;  3FM8 C;  1XWH A;  2XEU A;  5C13 A;  5LKX A;  1WES A;  3H7H A;  3ZTG A;  2ECG A;  3T7L A;  2RR4 A;  4ZUX U;  3U5P A;  5TBN A;  4N4F A;  2KIZ A;  1HYI A;  3I2D A;  4BHW A;  3KV5 A;  4F52 B;  5J3X A;  1FBV A;  2CSZ A;  5G05 B;  3ZPV E;  1WE9 A;  1LDJ B;  5LKT A;  4V3K C;  5G04 B;  2MUM A;  3T9K A;  2MD8 C;  4Z0R A;  2L0B A;  2VJE B;  2CKL B;  3N9P A;  4L58 A;  3N9L A;  4QF2 A;  2YUC A;  2LQ6 A;  4N3W A;  4CA1 A;  2E61 A;  3FAN A;  3MHS A;  5D1M B;  1T1H A;  2K4D A;  3LQH A;  3M63 A;  2Y1M A;  4I7D A;  1X4U A;  2VPB A;  3E2D A;  5DIN A;  3IHP A;  2VPE A;  2YQL A;  3QZV A;  3N9N A;  2MA5 A;  2MD7 B;  5H1U A;  3C5K A;  3LDY A;  4MSX A;  5B8D A;  5LKU A;  2VJF B;  4LJN A;  2VP7 A;  4L7X A;  2LAU A;  3O37 A;  1WEP A;  2H0D A;  4AYC A;  5K3Q A;  4A49 A;  2FUI A;  2Y1N A;  1V87 A;  4FK5 A;  3M7K A;  2CRR A;  3DWD A;  2YU4 A;  1ZBD B;  4PPE A;  2YT5 A;  4NN2 A;  2MKE A;  2M85 A;  2KR4 A;  4AUQ B;  5FB0 A;  4FO9 A;  2KWO A;  3Q1D A;  5B78 A;  2ECT A;  2M1R A;  2FD4 A;  4R2Y A;  2CSV A;  4GNG A;  2VJF A;  3GL6 A;  2L43 A;  5EYA F;  2I50 A;  2M13 A;  1HYJ A;  1VYX A;  3JUE A;  4YBS A;  2KYU A;  2QIC A;  3SOU A;  2DSM A;  5C11 A;  4OGC A;  5KH9 A;  1WGM A;  5TDW A;  1BOR A;  2ECV A;  3DDT A;  1WEW A;  2IQJ A;  2KWK A;  4S3O C;  4YAT A;  1MM2 A;  3EB6 A;  3PUR A;  3KNV A;  2JM3 A;  2LN0 A;  4QF3 A;  2YHO A;  2EXU A;  3HTK C;  4GB0 A;  3V43 A;  2VJE A;  1DCQ A;  3HCT A;  2HYE D;  1Z2Q A;  3LVR E;  3O35 A;  2MNZ A;  2KGI A;  3EB5 A;  3KV6 A;  2Y43 A;  2LGK A;  4OGE A;  3ZVY A;  2LV9 A;  5H9M A;  2KU3 A;  4YAX A;  2FFW A;  3N9M A;  2EGM A;  2ECI A;  2G43 A;  3LQJ A;  3HCU A;  5I3L A;  3C6W A;  3KQI A;  2RI7 A;  2QJ0 A;  2XP0 A;  5TAB A;  3O47 A;  4FJC A;  4A0C D;  3U5N A;  3N9Q A;  2HDP A;  4BBQ A;  2BAY A;  3PHD A;  1FP0 A;  3LVQ E;  4XI1 A;  2ZET C;  3O7A A;  2ECW A;  2F6N A;  2QIZ A;  1U6G B;  3RTR B;  1X4J A;  5AIU A;  2F6J A;  5DKA A;  4GNE A;  2LRI C;  4V3L C;  2K16 A;  3FAO A;  4A4B A;  5B79 A;  2M6M A;  2JUN A;  5LKZ A;  2KKX A;  3L1X A;  2L7P A;  4LKA A;  4C9Z A;  1MM3 A;  3ZPV 1;  4GND A;  4I7C A;  5LCW B;  1JM7 A;  5G0F A;  5FEY A;  1VD4 A;  1Z6U A;  2VNF A;  2VPG A;  4UI9 B;  1WEM A;  3RPG C;  2H0D B;  4AYC B;  2CSY A;  2RSD A;  3M99 A;  2MNY A;  4I7B A;  2KWN A;  2YSM A;  5KH7 A;  2G6Q A;  4Q6F A;  3LRQ A;  5D1L B;  2YHN A;  2B0O E;  2LGV A;  2F42 A;  2CRW A;  1Z60 A;  2KE1 A;  2EA6 A;  5FB1 A;  3VK6 A;  2CT2 A;  1X4I A;  4S3O B;  2KRE A;  4A4C A;  4QQ4 A;  5B76 A;  2EOD A;  3N9O A;  3HCS A;  4LK9 A;  4MVT A;  2P57 A;  2MIQ A;  2UZG A;  1VFY A;  4Z0O A;  5KH3 A;  2CON A;  3O36 A;  3U5O A;  3MDB C;  2LXP C;  3L1Z B;  2YQM A;  2L75 A;  2L80 A;  2NAA A;  3RPG B;  2DJA A;  3DPL R;  2JRJ A;  4FIP A;  4LLB A;  2JMD A;  4B86 C;  2CKL A;  3T6R A;  2KKY A;  2LGL A;  2OWA A;  1G25 A;  3O70 A;  2MA6 A;  5AIT A;  2E6R A;  2XOY A;  2PUY A;  4TKP B;  2YRE A;  3FJU B;  2XB1 A;  4X3G A;  2KFT A;  3LQI A;  2LDR A;  4YAB A;  2K17 A;  1WIL A;  1WEO A;  3FEH A;  1WFK A;  4ZDT A;  4YBM A;  2AN6 A;  2YVR A;  3LJU X;  2LXH C;  5SVX A; 
#chains in the Genus database with same CATH homology
 1F62 A;  3SOW A;  1RMD A;  1WEQ A;  5FER A;  4GNF A;  1JOC A;  3O34 A;  3L11 A;  1E4U A;  4R8P K;  4P5O B;  2OXQ C;  2E6S A;  3SHB A;  5B77 A;  4PTB A;  3MHH A;  1N87 A;  3NG2 A;  4YC9 A;  1WEU A;  2M3H A;  4WZ3 B;  4IC2 A;  2C2L A;  1WEE A;  4AVX A;  2G45 A;  5TRB A;  1CHC A;  5H1V A;  3ASL A;  4WZ2 A;  2KWJ A;  1WEN A;  3FL2 A;  2MT5 A;  4B7Y C;  3DQV R;  3M62 A;  2YYR A;  4WZ0 A;  2IDA A;  2C2V S;  2LGG A;  2YW8 A;  2ECJ A;  3U5M A;  2FUU A;  1JM7 B;  2JMJ A;  1WIM A;  4ZQL A;  1DVP A;  2KGG A;  2ECN A;  4YBT A;  4UP5 A;  5H1T A;  4O64 A;  1LDK C;  1IYM A;  4CCG X;  3PUQ A;  3ZNI A;  2EGP A;  2L5U A;  5JG6 A;  5TDR A;  1WEV A;  5B75 A;  4AP4 A;  4R7E A;  3GV4 A;  4W4U A;  2D8S A;  3ZVZ B;  3O33 A;  4YAD A;  2VPD A;  2PNX A;  4LAD B;  2K1J A;  4UP0 A;  2FSA A;  2YSJ A;  2JMI A;  2DX8 A;  3ZYQ A;  4WA6 A;  5D1K B;  2YUR A;  3SOX A;  4IC3 A;  1K2F A;  1XWH A;  2XEU A;  5C13 A;  5LKX A;  1WES A;  3ZTG A;  2ECG A;  3T7L A;  4ZUX U;  3U5P A;  5TBN A;  4N4F A;  2KIZ A;  1HYI A;  3I2D A;  4BHW A;  3KV5 A;  4F52 B;  5J3X A;  1FBV A;  2CSZ A;  5G05 B;  3ZPV E;  1WE9 A;  1LDJ B;  5LKT A;  4V3K C;  5G04 B;  2MUM A;  2MD8 C;  2L0B A;  2VJE B;  2CKL B;  3N9P A;  4L58 A;  3N9L A;  4QF2 A;  2YUC A;  2LQ6 A;  4N3W A;  4CA1 A;  3MHS A;  1T1H A;  5D1M B;  2K4D A;  3LQH A;  3M63 A;  2Y1M A;  4I7D A;  1X4U A;  2VPB A;  5DIN A;  3IHP A;  2VPE A;  2YQL A;  3QZV A;  3N9N A;  2MA5 A;  2MD7 B;  5H1U A;  3C5K A;  4MSX A;  5B8D A;  5LKU A;  2VJF B;  4LJN A;  2VP7 A;  4L7X A;  3O37 A;  1WEP A;  2H0D A;  4AYC A;  4A49 A;  2FUI A;  2Y1N A;  1V87 A;  4FK5 A;  2YU4 A;  1ZBD B;  4PPE A;  2YT5 A;  4NN2 A;  2M85 A;  2KR4 A;  4AUQ B;  5FB0 A;  4FO9 A;  2KWO A;  5B78 A;  2ECT A;  2M1R A;  4R2Y A;  4GNG A;  2VJF A;  3GL6 A;  2L43 A;  5EYA F;  2I50 A;  1HYJ A;  1VYX A;  4YBS A;  2KYU A;  2QIC A;  3SOU A;  5C11 A;  5KH9 A;  1WGM A;  5TDW A;  1BOR A;  2ECV A;  1WEW A;  2KWK A;  4S3O C;  4YAT A;  1MM2 A;  3EB6 A;  3PUR A;  3KNV A;  2LN0 A;  4QF3 A;  2YHO A;  3HTK C;  3V43 A;  4GB0 A;  2VJE A;  3HCT A;  2HYE D;  1Z2Q A;  3O35 A;  2MNZ A;  2KGI A;  3EB5 A;  3KV6 A;  2Y43 A;  2LGK A;  3ZVY A;  2LV9 A;  5H9M A;  2KU3 A;  4YAX A;  3N9M A;  2ECI A;  2G43 A;  3LQJ A;  3HCU A;  5I3L A;  3C6W A;  3KQI A;  2RI7 A;  2QJ0 A;  5TAB A;  4FJC A;  4A0C D;  3U5N A;  3N9Q A;  2HDP A;  4BBQ A;  2BAY A;  3PHD A;  1FP0 A;  4XI1 A;  2ZET C;  3O7A A;  2ECW A;  2F6N A;  2QIZ A;  1U6G B;  3RTR B;  1X4J A;  5AIU A;  2F6J A;  5DKA A;  4GNE A;  2LRI C;  4V3L C;  2K16 A;  4A4B A;  5B79 A;  2M6M A;  5LKZ A;  3L1X A;  4LKA A;  4C9Z A;  1MM3 A;  3ZPV 1;  4GND A;  4I7C A;  5LCW B;  1JM7 A;  5G0F A;  5FEY A;  1VD4 A;  1Z6U A;  2VNF A;  2VPG A;  4UI9 B;  1WEM A;  3RPG C;  2H0D B;  4AYC B;  2CSY A;  2RSD A;  3M99 A;  2MNY A;  4I7B A;  2KWN A;  2YSM A;  5KH7 A;  2G6Q A;  4Q6F A;  3LRQ A;  5D1L B;  2YHN A;  2LGV A;  2F42 A;  1Z60 A;  2KE1 A;  2EA6 A;  5FB1 A;  3VK6 A;  2CT2 A;  1X4I A;  4S3O B;  2KRE A;  4A4C A;  5B76 A;  2EOD A;  3N9O A;  3HCS A;  4LK9 A;  4MVT A;  2UZG A;  2MIQ A;  1VFY A;  5KH3 A;  3O36 A;  3U5O A;  2LXP C;  3L1Z B;  2YQM A;  2L75 A;  2L80 A;  2NAA A;  3RPG B;  3DPL R;  2JRJ A;  4FIP A;  4LLB A;  2JMD A;  4B86 C;  2CKL A;  3T6R A;  2LGL A;  1G25 A;  3O70 A;  2MA6 A;  5AIT A;  2E6R A;  2PUY A;  4TKP B;  2YRE A;  2XB1 A;  4X3G A;  2KFT A;  3LQI A;  2LDR A;  4YAB A;  2K17 A;  1WIL A;  1WEO A;  1WFK A;  4ZDT A;  4YBM A;  2AN6 A;  2LXH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...