5JG6A

Apc11-ubv shows role of noncovalent ring-ubiquitin interactions in processive multiubiquitination and ubiquitin chain elongation by apc/c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
61
Chain Sequence
DENCGICRMAFNGCCPDCDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual RING E3 Architectures Regulate Multiubiquitination and Ubiquitin Chain Elongation by APC/C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Anaphase-promoting complex subunit 11
total genus 14
structure length 61
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5jg6A00
4V3KC 2DX8A 2LGGA 2YU4A 3PUQA 3ZVYA 2MNZA 4PTBA 2ECVA 5FB1A 3C6WA 4YAXA 2JMJA 3O35A 1BORA 5FERA 2C2VS 2LXPC 4C9ZA 2CSYA 1WEPA 1DVPA 3O70A 5C11A 4FIPA 4UP0A 4PPEA 5TABA 5B76A 4NN2A 4LJNA 4YBSA 3EB6A 2K16A 4N3WA 2VPEA 4A4BA 3L1XA 4AYCA 5KH9A 3GL6A 2M3HA 2YREA 3O34A 1WEUA 2MD7B 4YADA 1FP0A 4I7CA 4MVTA 2L5UA 1VFYA 1CHCA 3DPLR 3C5KA 2EODA 2LN0A 3RTRB 1WFKA 4FJCA 3U5MA 4IC2A 5EYAF 4BBQA 5H1TA 2AN6A 2EA6A 3LQJA 1FBVA 4R7EA 5H9MA 2QICA 5D1LB 3SOUA 2KGIA 3N9PA 1WGMA 2FSAA 4FK5A 2ZETC 2YURA 5B75A 2MUMA 2LRIC 2MNYA 5JG6A 2UZGA 1T1HA 1WENA 2RI7A 1V87A 2FUUA 4LK9A 1WESA 4MSXA 2ECNA 2IDAA 2JMIA 1E4UA 3PHDA 2MD8C 4FO9A 3T7LA 2YHNA 4IC3A 1X4JA 1WEOA 4R2YA 3HCUA 2Y1MA 4WA6A 1JM7A 3HCTA 2JMDA 5G05B 2JRJA 2ECTA 3U5PA 5D1MB 4GNEA 4ZUXU 2HYED 3DQVR 3VK6A 5B79A 5AIUA 2K4DA 3GV4A 1G25A 2CSZA 3PURA 4TKPB 4R8PK 2YUCA 4F52B 4LADB 2I50A 3N9LA 2F6NA 4W4UA 3O7AA 1K2FA 3MHSA 4QF3A 2KFTA 5LCWB 2CKLA 5H1UA 5KH7A 5FEYA 2VPDA 5FB0A 2MA5A 4WZ3B 2ECJA 2BAYA 4AP4A 2PUYA 3LQHA 2FUIA 4A0CD 2KE1A 2LGLA 3L1ZB 3N9QA 2F42A 2QIZA 1VYXA 3U5NA 4A4CA 5H1VA 2D8SA 3HTKC 3KV6A 2VNFA 5TDWA 2RSDA 4B86C 2E6RA 2YQLA 5TRBA 5D1KB 2L75A 3LRQA 2KU3A 4I7DA 1X4UA 2L0BA 4S3OB 3HCSA 3LQIA 4LKAA 3I2DA 2PNXA 2HDPA 1WEVA 1VD4A 2Y1NA 2KYUA 3ZPVE 2H0DA 4Q6FA 4P5OB 5G0FA 1XWHA 1WEEA 2K17A 3SOWA 4YABA 5LKUA 1U6GB 1MM3A 3O37A 1Z60A 4YBTA 3RPGB 3KNVA 2ECWA 2ECGA 2F6JA 4GNDA 1IYMA 3M62A 2H0DB 2OXQC 2XB1A 4ZDTA 4AVXA 1Z6UA 5TDRA 5LKTA 5B78A 1N87A 3M99A 4A49A 2VJFB 5LKXA 2LDRA 4AYCB 4I7BA 2VJFA 3RPGC 1HYIA 2E6SA 3N9OA 2KIZA 1WEWA 2KREA 4WZ2A 1LDJB 3ZVZB 5B77A 1X4IA 5C13A 2M85A 2VJEA 1ZBDB 3ASLA 1WEQA 3N9MA 4UI9B 4ZQLA 3MHHA 2G43A 2KGGA 2LV9A 1JOCA 2MIQA 5DINA 4BHWA 1HYJA 2G6QA 2LGKA 5TBNA 2VPGA 3U5OA 1WE9A 4LLBA 3L11A 3T6RA 4S3OC 1WIMA 4GB0A 2KR4A 1RMDA 2VJEB 5B8DA 2M6MA 3IHPA 4AUQB 4YC9A 5KH3A 3QZVA 5I3LA 2YT5A 2VPBA 2C2LA 3SOXA 1WILA 2MT5A 4CCGX 4B7YC 2YW8A 5J3XA 2QJ0A 2L80A 2KWNA 2MA6A 4L58A 3KV5A 2LXHC 3FL2A 2M1RA 2LGVA 2K1JA 2EGPA 4GNGA 1F62A 4YATA 2YQMA 2XEUA 1Z2QA 3NG2A 3ZNIA 4N4FA 1JM7B 4X3GA 2CT2A 3M63A 4WZ0A 1MM2A 2LQ6A 2KWOA 2YYRA 3KQIA 2G45A 3O36A 4GNFA 3SHBA 3V43A 2YSMA 4UP5A 3ZTGA 5G04B 2Y43A 3ZPV1 4YBMA 2YHOA 4CA1A 4L7XA 1LDKC 4XI1A 2YSJA 2KWJA 4O64A 2NAAA 3O33A 5DKAA 4QF2A 2L43A 3EB5A 3N9NA 4V3LC 1WEMA 5AITA 2CKLB 2ECIA 5LKZA 3ZYQA 2VP7A 2KWKA
chains in the Genus database with same CATH superfamily
4V3KC 2DX8A 2LGGA 2YU4A 3PUQA 3ZVYA 2MNZA 3FJUB 4PTBA 2ECVA 4O62A 5FB1A 3C6WA 4YAXA 2JMJA 3FANA 3O35A 1BORA 5FERA 2C2VS 2LXPC 4C9ZA 4OGCA 2CSYA 1WEPA 1DVPA 3O70A 5C11A 4FIPA 4UP0A 4PPEA 2XOCA 5TABA 5B76A 4NN2A 4LJNA 4YBSA 3EB6A 3H7HA 2K16A 4N3WA 2VPEA 4A4BA 3L1XA 3FM8C 4AYCA 5KH9A 5SVXA 3GL6A 2M3HA 2KKXA 2YREA 3O34A 1WEUA 2MD7B 4YADA 3DDTA 1FP0A 4I7CA 4MVTA 2L5UA 1VFYA 1CHCA 3DPLR 3C5KA 2EODA 2LN0A 2E61A 3RTRB 2FFWA 1WFKA 4FJCA 3U5MA 4IC2A 5EYAF 4BBQA 5H1TA 2AN6A 3SUBA 2EA6A 3LQJA 4QQ4A 3Q1DA 1FBVA 3MDBC 4R7EA 5H9MA 2QICA 5D1LB 3SOUA 2KGIA 3N9PA 1WGMA 2FSAA 4FK5A 5K3QA 2ZETC 2YURA 5B75A 2MUMA 2LRIC 2MNYA 5JG6A 2UZGA 1T1HA 1WENA 2RI7A 1V87A 2FUUA 4LK9A 1WESA 4MSXA 2ECNA 2DJAA 2IDAA 2JMIA 1E4UA 3PHDA 2MD8C 4FO9A 3T7LA 2YHNA 4IC3A 1X4JA 1WEOA 4R2YA 3HCUA 2Y1MA 4WA6A 3O47A 1JM7A 3HCTA 4F1PA 2JMDA 2LAUA 5G05B 2JRJA 2ECTA 3U5PA 2XOZA 2FD4A 5SVIB 3FEHA 5D1MB 4GNEA 2EXUA 4ZUXU 2HYED 3DQVR 2MKEA 3VK6A 5B79A 5AIUA 2K4DA 3GV4A 1G25A 2CSZA 3JUEA 3PURA 4TKPB 4R8PK 2YUCA 4F52B 4LADB 2I50A 3N9LA 2F6NA 4W4UA 3O7AA 1K2FA 3MHSA 4QF3A 2KFTA 5LCWB 2CKLA 5H1UA 5KH7A 5FEYA 2VPDA 5FB0A 2MA5A 4WZ3B 2ECJA 2BAYA 4AP4A 2PUYA 3LQHA 2FUIA 4A0CD 2KE1A 2LGLA 3L1ZB 3N9QA 2F42A 2QIZA 1VYXA 3U5NA 4A4CA 5H1VA 2D8SA 3HTKC 3KV6A 2VNFA 5TDWA 2RSDA 4B86C 2E6RA 2YQLA 2EGMA 5TRBA 5D1KB 2L75A 3LRQA 2KU3A 4I7DA 2DSMA 1X4UA 2L0BA 4S3OB 2KWKA 3M7KA 2D8UA 3HCSA 3LQIA 4LKAA 3I2DA 2PNXA 2HDPA 5SVYA 1WEVA 1VD4A 2Y1NA 2KYUA 3ZPVE 2H0DA 4Q6FA 2YVRA 4P5OB 5G0FA 1XWHA 2B0OE 1WEEA 3T9KA 2K17A 3SOWA 4YABA 5LKUA 1U6GB 1MM3A 3O37A 1Z60A 1MBMA 4YBTA 3RPGB 3KNVA 2ECWA 4H9DA 2P57A 2ECGA 2F6JA 4GNDA 1IYMA 3M62A 3LVQE 2H0DB 2OXQC 2XB1A 4ZDTA 3PLWA 4AVXA 1Z6UA 5TDRA 5LKTA 5B78A 1N87A 3M99A 4A49A 2VJFB 5LKXA 2LDRA 2CSVA 2RR4A 4AYCB 4I7BA 2VJFA 3RPGC 1HYIA 2E6SA 3N9OA 2KIZA 1WEWA 2JUNA 2KREA 4WZ2A 1LDJB 3ZVZB 5B77A 1X4IA 5C13A 2M85A 2VJEA 1ZBDB 3ASLA 1WEQA 3N9MA 4UI9B 4ZQLA 3MHHA 2G43A 2KGGA 2LV9A 3KDEC 1JOCA 2MIQA 2CRWA 4Z0OA 5DINA 4BHWA 1HYJA 2G6QA 2LGKA 5TBNA 2VPGA 3U5OA 1WE9A 4LLBA 3L11A 3T6RA 4S3OC 1WIMA 4GB0A 2KR4A 1RMDA 2VJEB 5B8DA 2M6MA 3IHPA 4AUQB 2CONA 4YC9A 5KH3A 3QZVA 5I3LA 2YT5A 2VPBA 2C2LA 1DCQA 3SOXA 1WILA 2MT5A 4CCGX 4B7YC 2YW8A 2L7PA 5J3XA 2QJ0A 2L80A 2KWNA 3LJUX 2MA6A 2OWAA 4L58A 3KV5A 3DWDA 2LXHC 3FL2A 2M1RA 2LGVA 2K1JA 2EGPA 4GNGA 1F62A 4YATA 2YQMA 2XEUA 1Z2QA 3E2DA 3NG2A 3ZNIA 4N4FA 1JM7B 4X3GA 2CT2A 3M63A 5SVIA 4WZ0A 1MM2A 2LQ6A 2KWOA 2YYRA 3KQIA 2G45A 2KKYA 3O36A 4GNFA 3SHBA 3V43A 2YSMA 4UP5A 3ZTGA 5G04B 2XOYA 2Y43A 3ZPV1 3LDYA 2CRRA 4YBMA 4OGEA 2M13A 4Z0RA 2YHOA 4CA1A 4L7XA 1LDKC 4XI1A 2YSJA 3FAOA 2KWJA 4O64A 2NAAA 3O33A 2IQJA 5DKAA 2JM3A 4QF2A 2L43A 3EB5A 3N9NA 4V3LC 1WEMA 3LVRE 5AITA 2CKLB 2ECIA 5LKZA 3ZYQA 2VP7A 2XP0A
chains in the Genus database with same CATH topology
4V3KC 2DX8A 2LGGA 2YU4A 3PUQA 3ZVYA 2MNZA 4PTBA 2ECVA 5FB1A 3C6WA 4YAXA 2JMJA 3O35A 1BORA 5FERA 2C2VS 2LXPC 4C9ZA 2CSYA 1WEPA 1DVPA 3O70A 5C11A 4FIPA 4UP0A 4PPEA 5TABA 5B76A 4NN2A 4LJNA 4YBSA 3EB6A 2K16A 4N3WA 2VPEA 4A4BA 3L1XA 4AYCA 5KH9A 3GL6A 2M3HA 2YREA 3O34A 1WEUA 2MD7B 4YADA 1FP0A 4I7CA 4MVTA 2L5UA 1VFYA 1CHCA 3DPLR 3C5KA 2EODA 2LN0A 3RTRB 1WFKA 4FJCA 3U5MA 4IC2A 5EYAF 4BBQA 5H1TA 2AN6A 2EA6A 3LQJA 1FBVA 4R7EA 5H9MA 2QICA 5D1LB 3SOUA 2KGIA 3N9PA 1WGMA 2FSAA 4FK5A 2ZETC 2YURA 5B75A 2MUMA 2LRIC 2MNYA 5JG6A 2UZGA 1T1HA 1WENA 2RI7A 1V87A 2FUUA 4LK9A 1WESA 4MSXA 2ECNA 2IDAA 2JMIA 1E4UA 3PHDA 2MD8C 4FO9A 3T7LA 2YHNA 4IC3A 1X4JA 1WEOA 4R2YA 3HCUA 2Y1MA 4WA6A 1JM7A 3HCTA 2JMDA 5G05B 2JRJA 2ECTA 3U5PA 5D1MB 4GNEA 4ZUXU 2HYED 3DQVR 3VK6A 5B79A 5AIUA 2K4DA 3GV4A 1G25A 2CSZA 3PURA 4TKPB 4R8PK 2YUCA 4F52B 4LADB 2I50A 3N9LA 2F6NA 4W4UA 3O7AA 1K2FA 3MHSA 4QF3A 2KFTA 5LCWB 2CKLA 5H1UA 5KH7A 5FEYA 2VPDA 5FB0A 2MA5A 4WZ3B 2ECJA 2BAYA 4AP4A 2PUYA 3LQHA 2FUIA 4A0CD 2KE1A 2LGLA 3L1ZB 3N9QA 2F42A 2QIZA 1VYXA 3U5NA 4A4CA 5H1VA 2D8SA 3HTKC 3KV6A 2VNFA 5TDWA 2RSDA 4B86C 2E6RA 2YQLA 5TRBA 5D1KB 2L75A 3LRQA 2KU3A 4I7DA 1X4UA 2L0BA 4S3OB 3HCSA 3LQIA 4LKAA 3I2DA 2PNXA 2HDPA 1WEVA 1VD4A 2Y1NA 2KYUA 3ZPVE 2H0DA 4Q6FA 4P5OB 5G0FA 1XWHA 1WEEA 2K17A 3SOWA 4YABA 5LKUA 1U6GB 1MM3A 3O37A 1Z60A 4YBTA 3RPGB 3KNVA 2ECWA 2ECGA 2F6JA 4GNDA 1IYMA 3M62A 2H0DB 2OXQC 2XB1A 4ZDTA 4AVXA 1Z6UA 5TDRA 5LKTA 5B78A 1N87A 3M99A 4A49A 2VJFB 5LKXA 2LDRA 4AYCB 4I7BA 2VJFA 3RPGC 1HYIA 2E6SA 3N9OA 2KIZA 1WEWA 2KREA 4WZ2A 1LDJB 3ZVZB 5B77A 1X4IA 5C13A 2M85A 2VJEA 1ZBDB 3ASLA 1WEQA 3N9MA 4UI9B 4ZQLA 3MHHA 2G43A 2KGGA 2LV9A 1JOCA 2MIQA 5DINA 4BHWA 1HYJA 2G6QA 2LGKA 5TBNA 2VPGA 3U5OA 1WE9A 4LLBA 3L11A 3T6RA 4S3OC 1WIMA 4GB0A 2KR4A 1RMDA 2VJEB 5B8DA 2M6MA 3IHPA 4AUQB 4YC9A 5KH3A 3QZVA 5I3LA 2YT5A 2VPBA 2C2LA 3SOXA 1WILA 2MT5A 4CCGX 4B7YC 2YW8A 5J3XA 2QJ0A 2L80A 2KWNA 2MA6A 4L58A 3KV5A 2LXHC 3FL2A 2M1RA 2LGVA 2K1JA 2EGPA 4GNGA 1F62A 4YATA 2YQMA 2XEUA 1Z2QA 3NG2A 3ZNIA 4N4FA 1JM7B 4X3GA 2CT2A 3M63A 4WZ0A 1MM2A 2LQ6A 2KWOA 2YYRA 3KQIA 2G45A 3O36A 4GNFA 3SHBA 3V43A 2YSMA 4UP5A 3ZTGA 5G04B 2Y43A 3ZPV1 4YBMA 2YHOA 4CA1A 4L7XA 1LDKC 4XI1A 2YSJA 2KWJA 4O64A 2NAAA 3O33A 5DKAA 4QF2A 2L43A 3EB5A 3N9NA 4V3LC 1WEMA 5AITA 2CKLB 2ECIA 5LKZA 3ZYQA 2VP7A 2KWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V3K C;  2DX8 A;  2LGG A;  2YU4 A;  3PUQ A;  3ZVY A;  2MNZ A;  4PTB A;  2ECV A;  5FB1 A;  3C6W A;  4YAX A;  2JMJ A;  3O35 A;  1BOR A;  5FER A;  2C2V S;  2LXP C;  4C9Z A;  2CSY A;  1WEP A;  1DVP A;  3O70 A;  5C11 A;  4FIP A;  4UP0 A;  4PPE A;  5TAB A;  5B76 A;  4NN2 A;  4LJN A;  4YBS A;  3EB6 A;  2K16 A;  4N3W A;  2VPE A;  4A4B A;  3L1X A;  4AYC A;  5KH9 A;  3GL6 A;  2M3H A;  2YRE A;  3O34 A;  1WEU A;  2MD7 B;  4YAD A;  1FP0 A;  4I7C A;  4MVT A;  2L5U A;  1VFY A;  1CHC A;  3DPL R;  3C5K A;  2EOD A;  2LN0 A;  3RTR B;  1WFK A;  4FJC A;  3U5M A;  4IC2 A;  5EYA F;  4BBQ A;  5H1T A;  2AN6 A;  2EA6 A;  3LQJ A;  1FBV A;  4R7E A;  5H9M A;  2QIC A;  5D1L B;  3SOU A;  2KGI A;  3N9P A;  1WGM A;  2FSA A;  4FK5 A;  2ZET C;  2YUR A;  5B75 A;  2MUM A;  2LRI C;  2MNY A;  5JG6 A;  2UZG A;  1T1H A;  1WEN A;  2RI7 A;  1V87 A;  2FUU A;  4LK9 A;  1WES A;  4MSX A;  2ECN A;  2IDA A;  2JMI A;  1E4U A;  3PHD A;  2MD8 C;  4FO9 A;  3T7L A;  2YHN A;  4IC3 A;  1X4J A;  1WEO A;  4R2Y A;  3HCU A;  2Y1M A;  4WA6 A;  1JM7 A;  3HCT A;  2JMD A;  5G05 B;  2JRJ A;  2ECT A;  3U5P A;  5D1M B;  4GNE A;  4ZUX U;  2HYE D;  3DQV R;  3VK6 A;  5B79 A;  5AIU A;  2K4D A;  3GV4 A;  1G25 A;  2CSZ A;  3PUR A;  4TKP B;  4R8P K;  2YUC A;  4F52 B;  4LAD B;  2I50 A;  3N9L A;  2F6N A;  4W4U A;  3O7A A;  1K2F A;  3MHS A;  4QF3 A;  2KFT A;  5LCW B;  2CKL A;  5H1U A;  5KH7 A;  5FEY A;  2VPD A;  5FB0 A;  2MA5 A;  4WZ3 B;  2ECJ A;  2BAY A;  4AP4 A;  2PUY A;  3LQH A;  2FUI A;  4A0C D;  2KE1 A;  2LGL A;  3L1Z B;  3N9Q A;  2F42 A;  2QIZ A;  1VYX A;  3U5N A;  4A4C A;  5H1V A;  2D8S A;  3HTK C;  3KV6 A;  2VNF A;  5TDW A;  2RSD A;  4B86 C;  2E6R A;  2YQL A;  5TRB A;  5D1K B;  2L75 A;  3LRQ A;  2KU3 A;  4I7D A;  1X4U A;  2L0B A;  4S3O B;  3HCS A;  3LQI A;  4LKA A;  3I2D A;  2PNX A;  2HDP A;  1WEV A;  1VD4 A;  2Y1N A;  2KYU A;  3ZPV E;  2H0D A;  4Q6F A;  4P5O B;  5G0F A;  1XWH A;  1WEE A;  2K17 A;  3SOW A;  4YAB A;  5LKU A;  1U6G B;  1MM3 A;  3O37 A;  1Z60 A;  4YBT A;  3RPG B;  3KNV A;  2ECW A;  2ECG A;  2F6J A;  4GND A;  1IYM A;  3M62 A;  2H0D B;  2OXQ C;  2XB1 A;  4ZDT A;  4AVX A;  1Z6U A;  5TDR A;  5LKT A;  5B78 A;  1N87 A;  3M99 A;  4A49 A;  2VJF B;  5LKX A;  2LDR A;  4AYC B;  4I7B A;  2VJF A;  3RPG C;  1HYI A;  2E6S A;  3N9O A;  2KIZ A;  1WEW A;  2KRE A;  4WZ2 A;  1LDJ B;  3ZVZ B;  5B77 A;  1X4I A;  5C13 A;  2M85 A;  2VJE A;  1ZBD B;  3ASL A;  1WEQ A;  3N9M A;  4UI9 B;  4ZQL A;  3MHH A;  2G43 A;  2KGG A;  2LV9 A;  1JOC A;  2MIQ A;  5DIN A;  4BHW A;  1HYJ A;  2G6Q A;  2LGK A;  5TBN A;  2VPG A;  3U5O A;  1WE9 A;  4LLB A;  3L11 A;  3T6R A;  4S3O C;  1WIM A;  4GB0 A;  2KR4 A;  1RMD A;  2VJE B;  5B8D A;  2M6M A;  3IHP A;  4AUQ B;  4YC9 A;  5KH3 A;  3QZV A;  5I3L A;  2YT5 A;  2VPB A;  2C2L A;  3SOX A;  1WIL A;  2MT5 A;  4CCG X;  4B7Y C;  2YW8 A;  5J3X A;  2QJ0 A;  2L80 A;  2KWN A;  2MA6 A;  4L58 A;  3KV5 A;  2LXH C;  3FL2 A;  2M1R A;  2LGV A;  2K1J A;  2EGP A;  4GNG A;  1F62 A;  4YAT A;  2YQM A;  2XEU A;  1Z2Q A;  3NG2 A;  3ZNI A;  4N4F A;  1JM7 B;  4X3G A;  2CT2 A;  3M63 A;  4WZ0 A;  1MM2 A;  2LQ6 A;  2KWO A;  2YYR A;  3KQI A;  2G45 A;  3O36 A;  4GNF A;  3SHB A;  3V43 A;  2YSM A;  4UP5 A;  3ZTG A;  5G04 B;  2Y43 A;  3ZPV 1;  4YBM A;  2YHO A;  4CA1 A;  4L7X A;  1LDK C;  4XI1 A;  2YSJ A;  2KWJ A;  4O64 A;  2NAA A;  3O33 A;  5DKA A;  4QF2 A;  2L43 A;  3EB5 A;  3N9N A;  4V3L C;  1WEM A;  5AIT A;  2CKL B;  2ECI A;  5LKZ A;  3ZYQ A;  2VP7 A;  2KWK A; 
#chains in the Genus database with same CATH topology
 4V3K C;  2DX8 A;  2LGG A;  2YU4 A;  3PUQ A;  3ZVY A;  2MNZ A;  3FJU B;  4PTB A;  2ECV A;  4O62 A;  5FB1 A;  3C6W A;  4YAX A;  2JMJ A;  3FAN A;  3O35 A;  1BOR A;  5FER A;  2C2V S;  2LXP C;  4C9Z A;  4OGC A;  2CSY A;  1WEP A;  1DVP A;  3O70 A;  5C11 A;  4FIP A;  4UP0 A;  4PPE A;  2XOC A;  5TAB A;  5B76 A;  4NN2 A;  4LJN A;  4YBS A;  3EB6 A;  3H7H A;  2K16 A;  4N3W A;  2VPE A;  4A4B A;  3L1X A;  3FM8 C;  4AYC A;  5KH9 A;  5SVX A;  3GL6 A;  2M3H A;  2KKX A;  2YRE A;  3O34 A;  1WEU A;  2MD7 B;  4YAD A;  3DDT A;  1FP0 A;  4I7C A;  4MVT A;  2L5U A;  1VFY A;  1CHC A;  3DPL R;  3C5K A;  2EOD A;  2LN0 A;  2E61 A;  3RTR B;  2FFW A;  1WFK A;  4FJC A;  3U5M A;  4IC2 A;  5EYA F;  4BBQ A;  5H1T A;  2AN6 A;  3SUB A;  2EA6 A;  3LQJ A;  4QQ4 A;  3Q1D A;  1FBV A;  3MDB C;  4R7E A;  5H9M A;  2QIC A;  5D1L B;  3SOU A;  2KGI A;  3N9P A;  1WGM A;  2FSA A;  4FK5 A;  5K3Q A;  2ZET C;  2YUR A;  5B75 A;  2MUM A;  2LRI C;  2MNY A;  5JG6 A;  2UZG A;  1T1H A;  1WEN A;  2RI7 A;  1V87 A;  2FUU A;  4LK9 A;  1WES A;  4MSX A;  2ECN A;  2DJA A;  2IDA A;  2JMI A;  1E4U A;  3PHD A;  2MD8 C;  4FO9 A;  3T7L A;  2YHN A;  4IC3 A;  1X4J A;  1WEO A;  4R2Y A;  3HCU A;  2Y1M A;  4WA6 A;  3O47 A;  1JM7 A;  3HCT A;  4F1P A;  2JMD A;  2LAU A;  5G05 B;  2JRJ A;  2ECT A;  3U5P A;  2XOZ A;  2FD4 A;  5SVI B;  3FEH A;  5D1M B;  4GNE A;  2EXU A;  4ZUX U;  2HYE D;  3DQV R;  2MKE A;  3VK6 A;  5B79 A;  5AIU A;  2K4D A;  3GV4 A;  1G25 A;  2CSZ A;  3JUE A;  3PUR A;  4TKP B;  4R8P K;  2YUC A;  4F52 B;  4LAD B;  2I50 A;  3N9L A;  2F6N A;  4W4U A;  3O7A A;  1K2F A;  3MHS A;  4QF3 A;  2KFT A;  5LCW B;  2CKL A;  5H1U A;  5KH7 A;  5FEY A;  2VPD A;  5FB0 A;  2MA5 A;  4WZ3 B;  2ECJ A;  2BAY A;  4AP4 A;  2PUY A;  3LQH A;  2FUI A;  4A0C D;  2KE1 A;  2LGL A;  3L1Z B;  3N9Q A;  2F42 A;  2QIZ A;  1VYX A;  3U5N A;  4A4C A;  5H1V A;  2D8S A;  3HTK C;  3KV6 A;  2VNF A;  5TDW A;  2RSD A;  4B86 C;  2E6R A;  2YQL A;  2EGM A;  5TRB A;  5D1K B;  2L75 A;  3LRQ A;  2KU3 A;  4I7D A;  2DSM A;  1X4U A;  2L0B A;  4S3O B;  2KWK A;  3M7K A;  2D8U A;  3HCS A;  3LQI A;  4LKA A;  3I2D A;  2PNX A;  2HDP A;  5SVY A;  1WEV A;  1VD4 A;  2Y1N A;  2KYU A;  3ZPV E;  2H0D A;  4Q6F A;  2YVR A;  4P5O B;  5G0F A;  1XWH A;  2B0O E;  1WEE A;  3T9K A;  2K17 A;  3SOW A;  4YAB A;  5LKU A;  1U6G B;  1MM3 A;  3O37 A;  1Z60 A;  1MBM A;  4YBT A;  3RPG B;  3KNV A;  2ECW A;  4H9D A;  2P57 A;  2ECG A;  2F6J A;  4GND A;  1IYM A;  3M62 A;  3LVQ E;  2H0D B;  2OXQ C;  2XB1 A;  4ZDT A;  3PLW A;  4AVX A;  1Z6U A;  5TDR A;  5LKT A;  5B78 A;  1N87 A;  3M99 A;  4A49 A;  2VJF B;  5LKX A;  2LDR A;  2CSV A;  2RR4 A;  4AYC B;  4I7B A;  2VJF A;  3RPG C;  1HYI A;  2E6S A;  3N9O A;  2KIZ A;  1WEW A;  2JUN A;  2KRE A;  4WZ2 A;  1LDJ B;  3ZVZ B;  5B77 A;  1X4I A;  5C13 A;  2M85 A;  2VJE A;  1ZBD B;  3ASL A;  1WEQ A;  3N9M A;  4UI9 B;  4ZQL A;  3MHH A;  2G43 A;  2KGG A;  2LV9 A;  3KDE C;  1JOC A;  2MIQ A;  2CRW A;  4Z0O A;  5DIN A;  4BHW A;  1HYJ A;  2G6Q A;  2LGK A;  5TBN A;  2VPG A;  3U5O A;  1WE9 A;  4LLB A;  3L11 A;  3T6R A;  4S3O C;  1WIM A;  4GB0 A;  2KR4 A;  1RMD A;  2VJE B;  5B8D A;  2M6M A;  3IHP A;  4AUQ B;  2CON A;  4YC9 A;  5KH3 A;  3QZV A;  5I3L A;  2YT5 A;  2VPB A;  2C2L A;  1DCQ A;  3SOX A;  1WIL A;  2MT5 A;  4CCG X;  4B7Y C;  2YW8 A;  2L7P A;  5J3X A;  2QJ0 A;  2L80 A;  2KWN A;  3LJU X;  2MA6 A;  2OWA A;  4L58 A;  3KV5 A;  3DWD A;  2LXH C;  3FL2 A;  2M1R A;  2LGV A;  2K1J A;  2EGP A;  4GNG A;  1F62 A;  4YAT A;  2YQM A;  2XEU A;  1Z2Q A;  3E2D A;  3NG2 A;  3ZNI A;  4N4F A;  1JM7 B;  4X3G A;  2CT2 A;  3M63 A;  5SVI A;  4WZ0 A;  1MM2 A;  2LQ6 A;  2KWO A;  2YYR A;  3KQI A;  2G45 A;  2KKY A;  3O36 A;  4GNF A;  3SHB A;  3V43 A;  2YSM A;  4UP5 A;  3ZTG A;  5G04 B;  2XOY A;  2Y43 A;  3ZPV 1;  3LDY A;  2CRR A;  4YBM A;  4OGE A;  2M13 A;  4Z0R A;  2YHO A;  4CA1 A;  4L7X A;  1LDK C;  4XI1 A;  2YSJ A;  3FAO A;  2KWJ A;  4O64 A;  2NAA A;  3O33 A;  2IQJ A;  5DKA A;  2JM3 A;  4QF2 A;  2L43 A;  3EB5 A;  3N9N A;  4V3L C;  1WEM A;  3LVR E;  5AIT A;  2CKL B;  2ECI A;  5LKZ A;  3ZYQ A;  2VP7 A;  2XP0 A; 
#chains in the Genus database with same CATH homology
 4V3K C;  2DX8 A;  2LGG A;  2YU4 A;  3PUQ A;  3ZVY A;  2MNZ A;  4PTB A;  2ECV A;  5FB1 A;  3C6W A;  4YAX A;  2JMJ A;  3O35 A;  1BOR A;  5FER A;  2C2V S;  2LXP C;  4C9Z A;  2CSY A;  1WEP A;  1DVP A;  3O70 A;  5C11 A;  4FIP A;  4UP0 A;  4PPE A;  5TAB A;  5B76 A;  4NN2 A;  4LJN A;  4YBS A;  3EB6 A;  2K16 A;  4N3W A;  2VPE A;  4A4B A;  3L1X A;  4AYC A;  5KH9 A;  3GL6 A;  2M3H A;  2YRE A;  3O34 A;  1WEU A;  2MD7 B;  4YAD A;  1FP0 A;  4I7C A;  4MVT A;  2L5U A;  1VFY A;  1CHC A;  3DPL R;  3C5K A;  2EOD A;  2LN0 A;  3RTR B;  1WFK A;  4FJC A;  3U5M A;  4IC2 A;  5EYA F;  4BBQ A;  5H1T A;  2AN6 A;  2EA6 A;  3LQJ A;  1FBV A;  4R7E A;  5H9M A;  2QIC A;  5D1L B;  3SOU A;  2KGI A;  3N9P A;  1WGM A;  2FSA A;  4FK5 A;  2ZET C;  2YUR A;  5B75 A;  2MUM A;  2LRI C;  2MNY A;  5JG6 A;  2UZG A;  1T1H A;  1WEN A;  2RI7 A;  1V87 A;  2FUU A;  4LK9 A;  1WES A;  4MSX A;  2ECN A;  2IDA A;  2JMI A;  1E4U A;  3PHD A;  2MD8 C;  4FO9 A;  3T7L A;  2YHN A;  4IC3 A;  1X4J A;  1WEO A;  4R2Y A;  3HCU A;  2Y1M A;  4WA6 A;  1JM7 A;  3HCT A;  2JMD A;  5G05 B;  2JRJ A;  2ECT A;  3U5P A;  5D1M B;  4GNE A;  4ZUX U;  2HYE D;  3DQV R;  3VK6 A;  5B79 A;  5AIU A;  2K4D A;  3GV4 A;  1G25 A;  2CSZ A;  3PUR A;  4TKP B;  4R8P K;  2YUC A;  4F52 B;  4LAD B;  2I50 A;  3N9L A;  2F6N A;  4W4U A;  3O7A A;  1K2F A;  3MHS A;  4QF3 A;  2KFT A;  5LCW B;  2CKL A;  5H1U A;  5KH7 A;  5FEY A;  2VPD A;  5FB0 A;  2MA5 A;  4WZ3 B;  2ECJ A;  2BAY A;  4AP4 A;  2PUY A;  3LQH A;  2FUI A;  4A0C D;  2KE1 A;  2LGL A;  3L1Z B;  3N9Q A;  2F42 A;  2QIZ A;  1VYX A;  3U5N A;  4A4C A;  5H1V A;  2D8S A;  3HTK C;  3KV6 A;  2VNF A;  5TDW A;  2RSD A;  4B86 C;  2E6R A;  2YQL A;  5TRB A;  5D1K B;  2L75 A;  3LRQ A;  2KU3 A;  4I7D A;  1X4U A;  2L0B A;  4S3O B;  3HCS A;  3LQI A;  4LKA A;  3I2D A;  2PNX A;  2HDP A;  1WEV A;  1VD4 A;  2Y1N A;  2KYU A;  3ZPV E;  2H0D A;  4Q6F A;  4P5O B;  5G0F A;  1XWH A;  1WEE A;  2K17 A;  3SOW A;  4YAB A;  5LKU A;  1U6G B;  1MM3 A;  3O37 A;  1Z60 A;  4YBT A;  3RPG B;  3KNV A;  2ECW A;  2ECG A;  2F6J A;  4GND A;  1IYM A;  3M62 A;  2H0D B;  2OXQ C;  2XB1 A;  4ZDT A;  4AVX A;  1Z6U A;  5TDR A;  5LKT A;  5B78 A;  1N87 A;  3M99 A;  4A49 A;  2VJF B;  5LKX A;  2LDR A;  4AYC B;  4I7B A;  2VJF A;  3RPG C;  1HYI A;  2E6S A;  3N9O A;  2KIZ A;  1WEW A;  2KRE A;  4WZ2 A;  1LDJ B;  3ZVZ B;  5B77 A;  1X4I A;  5C13 A;  2M85 A;  2VJE A;  1ZBD B;  3ASL A;  1WEQ A;  3N9M A;  4UI9 B;  4ZQL A;  3MHH A;  2G43 A;  2KGG A;  2LV9 A;  1JOC A;  2MIQ A;  5DIN A;  4BHW A;  1HYJ A;  2G6Q A;  2LGK A;  5TBN A;  2VPG A;  3U5O A;  1WE9 A;  4LLB A;  3L11 A;  3T6R A;  4S3O C;  1WIM A;  4GB0 A;  2KR4 A;  1RMD A;  2VJE B;  5B8D A;  2M6M A;  3IHP A;  4AUQ B;  4YC9 A;  5KH3 A;  3QZV A;  5I3L A;  2YT5 A;  2VPB A;  2C2L A;  3SOX A;  1WIL A;  2MT5 A;  4CCG X;  4B7Y C;  2YW8 A;  5J3X A;  2QJ0 A;  2L80 A;  2KWN A;  2MA6 A;  4L58 A;  3KV5 A;  2LXH C;  3FL2 A;  2M1R A;  2LGV A;  2K1J A;  2EGP A;  4GNG A;  1F62 A;  4YAT A;  2YQM A;  2XEU A;  1Z2Q A;  3NG2 A;  3ZNI A;  4N4F A;  1JM7 B;  4X3G A;  2CT2 A;  3M63 A;  4WZ0 A;  1MM2 A;  2LQ6 A;  2KWO A;  2YYR A;  3KQI A;  2G45 A;  3O36 A;  4GNF A;  3SHB A;  3V43 A;  2YSM A;  4UP5 A;  3ZTG A;  5G04 B;  2Y43 A;  3ZPV 1;  4YBM A;  2YHO A;  4CA1 A;  4L7X A;  1LDK C;  4XI1 A;  2YSJ A;  2KWJ A;  4O64 A;  2NAA A;  3O33 A;  5DKA A;  4QF2 A;  2L43 A;  3EB5 A;  3N9N A;  4V3L C;  1WEM A;  5AIT A;  2CKL B;  2ECI A;  5LKZ A;  3ZYQ A;  2VP7 A;  2KWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...