5JG6A

Apc11-ubv shows role of noncovalent ring-ubiquitin interactions in processive multiubiquitination and ubiquitin chain elongation by apc/c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
61
Chain Sequence
DENCGICRMAFNGCCPDCDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anaphase-promoting complex subunit 11
publication title Dual RING E3 Architectures Regulate Multiubiquitination and Ubiquitin Chain Elongation by APC/C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 14
structure length 61
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5jg6A00
2MT5A 2AN6A 2Y43A 2K16A 3EB5A 2L80A 4N4FA 4YBSA 4UP5A 2L43A 3EB6A 2MA5A 1DVPA 5B79A 2RI7A 5DKAA 2VJFA 2KIZA 2G43A 2DX8A 2KWKA 3DQVR 4BBQA 3KQIA 2CT2A 3LQJA 4MSXA 2CSYA 3VK6A 2K4DA 5B76A 2YQMA 2LDRA 4I7DA 1T1HA 4QF3A 2VJEB 2MIQA 2KREA 2VPBA 2G6QA 2YREA 5D1MB 4FO9A 2C2VS 2XEUA 2UZGA 2H0DB 2YHNA 1VYXA 1CHCA 3ZPVE 3O70A 5C11A 2D8SA 4UP0A 1G25A 2YYRA 3IHPA 5TDWA 2ECWA 2KWNA 4LJNA 4GNFA 2CSZA 2YT5A 2HDPA 4V3LC 5D1LB 4WZ0A 4LK9A 3ZVZB 2VP7A 5H1TA 4S3OC 3N9QA 4PPEA 5KH7A 1X4IA 2L75A 3KNVA 1FBVA 2VNFA 1F62A 4P5OB 2VJEA 1Z2QA 2KGGA 1WEEA 5I3LA 5LKUA 5FERA 2PNXA 1ZBDB 2H0DA 1MM3A 1WIMA 2MD8C 4A49A 3HCSA 2ECVA 3U5PA 4L58A 4LLBA 1HYIA 2KU3A 2F6JA 4C9ZA 4A4BA 1X4UA 1LDKC 5TBNA 5FB1A 3RPGC 2QICA 3O34A 1WE9A 4IC3A 4MVTA 5B77A 2MNYA 3U5MA 5LCWB 2M85A 5DINA 2F6NA 5G05B 2Y1MA 5J3XA 4CA1A 2QIZA 3LQIA 2ECNA 2VPEA 5B8DA 2YW8A 5B75A 2G45A 2MNZA 4R8PK 2MA6A 3N9MA 4AYCB 2FUUA 5G04B 2EGPA 2LXHC 2L0BA 2YQLA 3HCUA 4PTBA 3HCTA 1VFYA 3O36A 2RSDA 4NN2A 1Z6UA 3QZVA 1HYJA 4XI1A 5LKTA 5D1KB 3DPLR 3O35A 3NG2A 1K2FA 3HTKC 3LQHA 2C2LA 2LN0A 4A0CD 1FP0A 1VD4A 2F42A 2I50A 2YU4A 3M63A 2IDAA 1N87A 4N3WA 2LXPC 2ZETC 2VPDA 3O33A 3PURA 2KR4A 2BAYA 3PUQA 4GNGA 5AITA 4R7EA 4QF2A 4O64A 3SOUA 4YBMA 5LKZA 5LKXA 2M6MA 4ZUXU 2KWOA 4WZ3B 1U6GB 4GNDA 1WESA 3M62A 2KFTA 3LRQA 3FL2A 5EYAF 1WEUA 2LGGA 1MM2A 2LGKA 4ZQLA 4W4UA 3ZVYA 1BORA 1WEWA 1WEMA 2JMDA 3T6RA 1JM7B 2L5UA 3N9NA 3I2DA 2K1JA 2HYED 3SOXA 4WA6A 3SHBA 3ZNIA 4B7YC 3C6WA 3N9PA 2JMJA 2LRIC 3GL6A 2ECTA 2ECGA 3M99A 5G0FA 2M3HA 4YADA 5TABA 1JOCA 5TRBA 3L11A 2KWJA 4Q6FA 1WEPA 2LGVA 4B86C 4UI9B 4CCGX 2JMIA 4ZDTA 4V3KC 3MHHA 2XB1A 3N9LA 2FUIA 2YUCA 4I7BA 5FEYA 2JRJA 1WENA 2E6SA 4R2YA 3SOWA 3KV5A 3RPGB 4YBTA 2CKLB 1WILA 4WZ2A 1JM7A 1WEOA 1WGMA 3V43A 2OXQC 5B78A 1E4UA 2K17A 4BHWA 1WEQA 1LDJB 3GV4A 2YHOA 3PHDA 4X3GA 4YATA 3KV6A 2LQ6A 5C13A 5H1VA 2M1RA 3ZYQA 2YSJA 2KE1A 3L1ZB 2MD7B 1X4JA 4AYCA 2FSAA 3ZTGA 2KYUA 2MUMA 3T7LA 3ASLA 2CKLA 4FJCA 5AIUA 2YURA 4L7XA 1V87A 2LGLA 3U5NA 1Z60A 4IC2A 4GB0A 2ECIA 4F52B 2ECJA 2LV9A 4LKAA 2E6RA 2NAAA 4YC9A 5KH3A 1WEVA 5KH9A 1RMDA 2VPGA 3MHSA 4FIPA 2VJFB 4S3OB 1WFKA 4TKPB 4LADB 5H1UA 2EA6A 3L1XA 2QJ0A 5H9MA 2Y1NA 4FK5A 4AUQB 2KGIA 4A4CA 2EODA 3O37A 3RTRB 4I7CA 4AVXA 1IYMA 2PUYA 1XWHA 5JG6A 3O7AA 4GNEA 3C5KA 3ZPV1 4YAXA 4YABA 2YSMA 3N9OA 4AP4A 3U5OA 5TDRA 5FB0A
chains in the Genus database with same CATH superfamily
2MT5A 2AN6A 2Y43A 2K16A 2XP0A 3EB5A 2L80A 4N4FA 4YBSA 4UP5A 2L43A 3EB6A 3T9KA 2MA5A 1DVPA 5B79A 2RI7A 5DKAA 2VJFA 2KIZA 2G43A 2DX8A 2KWKA 3DQVR 3FM8C 4BBQA 3KQIA 2CT2A 2CRRA 3LQJA 4MSXA 2MKEA 2CSYA 3VK6A 2K4DA 5B76A 2YQMA 2LDRA 4I7DA 1T1HA 4QF3A 2VJEB 2MIQA 2KREA 2VPBA 2G6QA 2YREA 5D1MB 4FO9A 2C2VS 2XEUA 2UZGA 2H0DB 2YHNA 1VYXA 1CHCA 3ZPVE 3O70A 5C11A 2D8SA 4UP0A 1G25A 2YYRA 3IHPA 5TDWA 2ECWA 2KWNA 4LJNA 4GNFA 5SVIB 2CSZA 2YT5A 2HDPA 4V3LC 5D1LB 4WZ0A 4LK9A 3ZVZB 2VP7A 5H1TA 4S3OC 3N9QA 4PPEA 5KH7A 5SVXA 1X4IA 4F1PA 2RR4A 2L75A 3KNVA 1FBVA 4Z0OA 2VNFA 1F62A 4P5OB 2VJEA 1Z2QA 3LVQE 2KGGA 1WEEA 5I3LA 5LKUA 5FERA 2PNXA 3LVRE 1ZBDB 2H0DA 1MM3A 1WIMA 2MD8C 3E2DA 4A49A 3HCSA 2ECVA 3U5PA 4L58A 4LLBA 1HYIA 2KU3A 2F6JA 4C9ZA 4A4BA 1X4UA 1LDKC 5TBNA 5FB1A 3RPGC 5SVIA 2QICA 3O34A 1WE9A 2XOCA 4IC3A 4MVTA 5B77A 2MNYA 3U5MA 5LCWB 2M85A 5DINA 2F6NA 5G05B 2Y1MA 5J3XA 2EXUA 4CA1A 2QIZA 3LQIA 2ECNA 2VPEA 2E61A 5B8DA 2YW8A 4H9DA 5B75A 2G45A 2MNZA 4R8PK 2MA6A 3N9MA 2CRWA 3FEHA 4AYCB 2FUUA 5G04B 3Q1DA 2EGPA 2CSVA 2LXHC 2L0BA 2YQLA 3HCUA 4PTBA 2L7PA 3HCTA 1VFYA 3O36A 2RSDA 2JUNA 4NN2A 1Z6UA 3QZVA 1HYJA 4XI1A 5LKTA 5D1KB 3DPLR 3O35A 3NG2A 1K2FA 3HTKC 3LQHA 2C2LA 2LN0A 4A0CD 1FP0A 1VD4A 2F42A 2I50A 2YU4A 3M63A 2DSMA 2IDAA 1N87A 4N3WA 2LXPC 2ZETC 2VPDA 3O33A 3PURA 2KR4A 2BAYA 3O47A 3PUQA 3M7KA 2LAUA 4GNGA 5AITA 4R7EA 4QF2A 4O64A 2CONA 2FFWA 1MBMA 3SOUA 4YBMA 5LKZA 2D8UA 5LKXA 2FD4A 3KDEC 2M6MA 4ZUXU 2KWOA 4WZ3B 1U6GB 4GNDA 4Z0RA 1WESA 3M62A 2KFTA 3LRQA 3FL2A 5EYAF 1WEUA 2LGGA 1MM2A 2LGKA 4ZQLA 4W4UA 3ZVYA 1BORA 1WEWA 1WEMA 2JMDA 2KKYA 3T6RA 1JM7B 2L5UA 2YVRA 3N9NA 3I2DA 2K1JA 2HYED 3SOXA 4WA6A 3SHBA 3ZNIA 4B7YC 3C6WA 3N9PA 1DCQA 2JMJA 2LRIC 3GL6A 2ECTA 2ECGA 3M99A 5G0FA 2M3HA 4YADA 5TABA 1JOCA 5TRBA 3L11A 2KWJA 4Q6FA 1WEPA 2LGVA 3H7HA 4B86C 4UI9B 4CCGX 2JMIA 4ZDTA 4V3KC 3MHHA 2XB1A 3N9LA 2FUIA 2EGMA 4OGEA 2YUCA 4I7BA 2B0OE 5FEYA 2JRJA 4R2YA 1WENA 2E6SA 3SOWA 3KV5A 3RPGB 3FJUB 4YBTA 2CKLB 1WILA 4WZ2A 1JM7A 1WEOA 4O62A 3SUBA 3FAOA 1WGMA 3V43A 2OXQC 3MDBC 5B78A 1E4UA 2K17A 3LDYA 4BHWA 2JM3A 1WEQA 1LDJB 3GV4A 2YHOA 3PHDA 4QQ4A 4X3GA 3DWDA 4YATA 3KV6A 2LQ6A 5K3QA 5C13A 3JUEA 5H1VA 3LJUX 2IQJA 2M1RA 3ZYQA 2YSJA 2KE1A 3FANA 3L1ZB 2MD7B 1X4JA 4AYCA 2FSAA 3ZTGA 2KYUA 4OGCA 5SVYA 2MUMA 3T7LA 3ASLA 2CKLA 4FJCA 5AIUA 2YURA 4L7XA 1V87A 2LGLA 3U5NA 1Z60A 4IC2A 4GB0A 2ECIA 4F52B 2ECJA 2LV9A 4LKAA 2E6RA 2P57A 2NAAA 4YC9A 5KH3A 1WEVA 5KH9A 1RMDA 2VPGA 3MHSA 4FIPA 2VJFB 4S3OB 1WFKA 4TKPB 4LADB 5H1UA 2EA6A 3L1XA 2QJ0A 5H9MA 2OWAA 2Y1NA 2XOYA 4FK5A 4AUQB 2KGIA 4A4CA 2EODA 3O37A 3RTRB 4I7CA 4AVXA 2XOZA 1IYMA 2PUYA 1XWHA 5JG6A 2KKXA 3O7AA 3PLWA 4GNEA 3C5KA 2DJAA 4YAXA 3ZPV1 4YABA 2YSMA 3N9OA 4AP4A 2M13A 3U5OA 5TDRA 3DDTA 5FB0A
chains in the Genus database with same CATH topology
2MT5A 2AN6A 2Y43A 2K16A 3EB5A 2L80A 4N4FA 4YBSA 4UP5A 2L43A 3EB6A 2MA5A 1DVPA 5B79A 2RI7A 5DKAA 2VJFA 2KIZA 2G43A 2DX8A 2KWKA 3DQVR 4BBQA 3KQIA 2CT2A 3LQJA 4MSXA 2CSYA 3VK6A 2K4DA 5B76A 2YQMA 2LDRA 4I7DA 1T1HA 4QF3A 2VJEB 2MIQA 2KREA 2VPBA 2G6QA 2YREA 5D1MB 4FO9A 2C2VS 2XEUA 2UZGA 2H0DB 2YHNA 1VYXA 1CHCA 3ZPVE 3O70A 5C11A 2D8SA 4UP0A 1G25A 2YYRA 3IHPA 5TDWA 2ECWA 2KWNA 4LJNA 4GNFA 2CSZA 2YT5A 2HDPA 4V3LC 5D1LB 4WZ0A 4LK9A 3ZVZB 2VP7A 5H1TA 4S3OC 3N9QA 4PPEA 5KH7A 1X4IA 2L75A 3KNVA 1FBVA 2VNFA 1F62A 4P5OB 2VJEA 1Z2QA 2KGGA 1WEEA 5I3LA 5LKUA 5FERA 2PNXA 1ZBDB 2H0DA 1MM3A 1WIMA 2MD8C 4A49A 3HCSA 2ECVA 3U5PA 4L58A 4LLBA 1HYIA 2KU3A 2F6JA 4C9ZA 4A4BA 1X4UA 1LDKC 5TBNA 5FB1A 3RPGC 2QICA 3O34A 1WE9A 4IC3A 4MVTA 5B77A 2MNYA 3U5MA 5LCWB 2M85A 5DINA 2F6NA 5G05B 2Y1MA 5J3XA 4CA1A 2QIZA 3LQIA 2ECNA 2VPEA 5B8DA 2YW8A 5B75A 2G45A 2MNZA 4R8PK 2MA6A 3N9MA 4AYCB 2FUUA 5G04B 2EGPA 2LXHC 2L0BA 2YQLA 3HCUA 4PTBA 3HCTA 1VFYA 3O36A 2RSDA 4NN2A 1Z6UA 3QZVA 1HYJA 4XI1A 5LKTA 5D1KB 3DPLR 3O35A 3NG2A 1K2FA 3HTKC 3LQHA 2C2LA 2LN0A 4A0CD 1FP0A 1VD4A 2F42A 2I50A 2YU4A 3M63A 2IDAA 1N87A 4N3WA 2LXPC 2ZETC 2VPDA 3O33A 3PURA 2KR4A 2BAYA 3PUQA 4GNGA 5AITA 4R7EA 4QF2A 4O64A 3SOUA 4YBMA 5LKZA 5LKXA 2M6MA 4ZUXU 2KWOA 4WZ3B 1U6GB 4GNDA 1WESA 3M62A 2KFTA 3LRQA 3FL2A 5EYAF 1WEUA 2LGGA 1MM2A 2LGKA 4ZQLA 4W4UA 3ZVYA 1BORA 1WEWA 1WEMA 2JMDA 3T6RA 1JM7B 2L5UA 3N9NA 3I2DA 2K1JA 2HYED 3SOXA 4WA6A 3SHBA 3ZNIA 4B7YC 3C6WA 3N9PA 2JMJA 2LRIC 3GL6A 2ECTA 2ECGA 3M99A 5G0FA 2M3HA 4YADA 5TABA 1JOCA 5TRBA 3L11A 2KWJA 4Q6FA 1WEPA 2LGVA 4B86C 4UI9B 4CCGX 2JMIA 4ZDTA 4V3KC 3MHHA 2XB1A 3N9LA 2FUIA 2YUCA 4I7BA 5FEYA 2JRJA 1WENA 2E6SA 4R2YA 3SOWA 3KV5A 3RPGB 4YBTA 2CKLB 1WILA 4WZ2A 1JM7A 1WEOA 1WGMA 3V43A 2OXQC 5B78A 1E4UA 2K17A 4BHWA 1WEQA 1LDJB 3GV4A 2YHOA 3PHDA 4X3GA 4YATA 3KV6A 2LQ6A 5C13A 5H1VA 2M1RA 3ZYQA 2YSJA 2KE1A 3L1ZB 2MD7B 1X4JA 4AYCA 2FSAA 3ZTGA 2KYUA 2MUMA 3T7LA 3ASLA 2CKLA 4FJCA 5AIUA 2YURA 4L7XA 1V87A 2LGLA 3U5NA 1Z60A 4IC2A 4GB0A 2ECIA 4F52B 2ECJA 2LV9A 4LKAA 2E6RA 2NAAA 4YC9A 5KH3A 1WEVA 5KH9A 1RMDA 2VPGA 3MHSA 4FIPA 2VJFB 4S3OB 1WFKA 4TKPB 4LADB 5H1UA 2EA6A 3L1XA 2QJ0A 5H9MA 2Y1NA 4FK5A 4AUQB 2KGIA 4A4CA 2EODA 3O37A 3RTRB 4I7CA 4AVXA 1IYMA 2PUYA 1XWHA 5JG6A 3O7AA 4GNEA 3C5KA 3ZPV1 4YAXA 4YABA 2YSMA 3N9OA 4AP4A 3U5OA 5TDRA 5FB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MT5 A;  2AN6 A;  2Y43 A;  2K16 A;  3EB5 A;  2L80 A;  4N4F A;  4YBS A;  4UP5 A;  2L43 A;  3EB6 A;  2MA5 A;  1DVP A;  5B79 A;  2RI7 A;  5DKA A;  2VJF A;  2KIZ A;  2G43 A;  2DX8 A;  2KWK A;  3DQV R;  4BBQ A;  3KQI A;  2CT2 A;  3LQJ A;  4MSX A;  2CSY A;  3VK6 A;  2K4D A;  5B76 A;  2YQM A;  2LDR A;  4I7D A;  1T1H A;  4QF3 A;  2VJE B;  2MIQ A;  2KRE A;  2VPB A;  2G6Q A;  2YRE A;  5D1M B;  4FO9 A;  2C2V S;  2XEU A;  2UZG A;  2H0D B;  2YHN A;  1VYX A;  1CHC A;  3ZPV E;  3O70 A;  5C11 A;  2D8S A;  4UP0 A;  1G25 A;  2YYR A;  3IHP A;  5TDW A;  2ECW A;  2KWN A;  4LJN A;  4GNF A;  2CSZ A;  2YT5 A;  2HDP A;  4V3L C;  5D1L B;  4WZ0 A;  4LK9 A;  3ZVZ B;  2VP7 A;  5H1T A;  4S3O C;  3N9Q A;  4PPE A;  5KH7 A;  1X4I A;  2L75 A;  3KNV A;  1FBV A;  2VNF A;  1F62 A;  4P5O B;  2VJE A;  1Z2Q A;  2KGG A;  1WEE A;  5I3L A;  5LKU A;  5FER A;  2PNX A;  1ZBD B;  2H0D A;  1MM3 A;  1WIM A;  2MD8 C;  4A49 A;  3HCS A;  2ECV A;  3U5P A;  4L58 A;  4LLB A;  1HYI A;  2KU3 A;  2F6J A;  4C9Z A;  4A4B A;  1X4U A;  1LDK C;  5TBN A;  5FB1 A;  3RPG C;  2QIC A;  3O34 A;  1WE9 A;  4IC3 A;  4MVT A;  5B77 A;  2MNY A;  3U5M A;  5LCW B;  2M85 A;  5DIN A;  2F6N A;  5G05 B;  2Y1M A;  5J3X A;  4CA1 A;  2QIZ A;  3LQI A;  2ECN A;  2VPE A;  5B8D A;  2YW8 A;  5B75 A;  2G45 A;  2MNZ A;  4R8P K;  2MA6 A;  3N9M A;  4AYC B;  2FUU A;  5G04 B;  2EGP A;  2LXH C;  2L0B A;  2YQL A;  3HCU A;  4PTB A;  3HCT A;  1VFY A;  3O36 A;  2RSD A;  4NN2 A;  1Z6U A;  3QZV A;  1HYJ A;  4XI1 A;  5LKT A;  5D1K B;  3DPL R;  3O35 A;  3NG2 A;  1K2F A;  3HTK C;  3LQH A;  2C2L A;  2LN0 A;  4A0C D;  1FP0 A;  1VD4 A;  2F42 A;  2I50 A;  2YU4 A;  3M63 A;  2IDA A;  1N87 A;  4N3W A;  2LXP C;  2ZET C;  2VPD A;  3O33 A;  3PUR A;  2KR4 A;  2BAY A;  3PUQ A;  4GNG A;  5AIT A;  4R7E A;  4QF2 A;  4O64 A;  3SOU A;  4YBM A;  5LKZ A;  5LKX A;  2M6M A;  4ZUX U;  2KWO A;  4WZ3 B;  1U6G B;  4GND A;  1WES A;  3M62 A;  2KFT A;  3LRQ A;  3FL2 A;  5EYA F;  1WEU A;  2LGG A;  1MM2 A;  2LGK A;  4ZQL A;  4W4U A;  3ZVY A;  1BOR A;  1WEW A;  1WEM A;  2JMD A;  3T6R A;  1JM7 B;  2L5U A;  3N9N A;  3I2D A;  2K1J A;  2HYE D;  3SOX A;  4WA6 A;  3SHB A;  3ZNI A;  4B7Y C;  3C6W A;  3N9P A;  2JMJ A;  2LRI C;  3GL6 A;  2ECT A;  2ECG A;  3M99 A;  5G0F A;  2M3H A;  4YAD A;  5TAB A;  1JOC A;  5TRB A;  3L11 A;  2KWJ A;  4Q6F A;  1WEP A;  2LGV A;  4B86 C;  4UI9 B;  4CCG X;  2JMI A;  4ZDT A;  4V3K C;  3MHH A;  2XB1 A;  3N9L A;  2FUI A;  2YUC A;  4I7B A;  5FEY A;  2JRJ A;  1WEN A;  2E6S A;  4R2Y A;  3SOW A;  3KV5 A;  3RPG B;  4YBT A;  2CKL B;  1WIL A;  4WZ2 A;  1JM7 A;  1WEO A;  1WGM A;  3V43 A;  2OXQ C;  5B78 A;  1E4U A;  2K17 A;  4BHW A;  1WEQ A;  1LDJ B;  3GV4 A;  2YHO A;  3PHD A;  4X3G A;  4YAT A;  3KV6 A;  2LQ6 A;  5C13 A;  5H1V A;  2M1R A;  3ZYQ A;  2YSJ A;  2KE1 A;  3L1Z B;  2MD7 B;  1X4J A;  4AYC A;  2FSA A;  3ZTG A;  2KYU A;  2MUM A;  3T7L A;  3ASL A;  2CKL A;  4FJC A;  5AIU A;  2YUR A;  4L7X A;  1V87 A;  2LGL A;  3U5N A;  1Z60 A;  4IC2 A;  4GB0 A;  2ECI A;  4F52 B;  2ECJ A;  2LV9 A;  4LKA A;  2E6R A;  2NAA A;  4YC9 A;  5KH3 A;  1WEV A;  5KH9 A;  1RMD A;  2VPG A;  3MHS A;  4FIP A;  2VJF B;  4S3O B;  1WFK A;  4TKP B;  4LAD B;  5H1U A;  2EA6 A;  3L1X A;  2QJ0 A;  5H9M A;  2Y1N A;  4FK5 A;  4AUQ B;  2KGI A;  4A4C A;  2EOD A;  3O37 A;  3RTR B;  4I7C A;  4AVX A;  1IYM A;  2PUY A;  1XWH A;  5JG6 A;  3O7A A;  4GNE A;  3C5K A;  3ZPV 1;  4YAX A;  4YAB A;  2YSM A;  3N9O A;  4AP4 A;  3U5O A;  5TDR A;  5FB0 A; 
#chains in the Genus database with same CATH topology
 2MT5 A;  2AN6 A;  2Y43 A;  2K16 A;  2XP0 A;  3EB5 A;  2L80 A;  4N4F A;  4YBS A;  4UP5 A;  2L43 A;  3EB6 A;  3T9K A;  2MA5 A;  1DVP A;  5B79 A;  2RI7 A;  5DKA A;  2VJF A;  2KIZ A;  2G43 A;  2DX8 A;  2KWK A;  3DQV R;  3FM8 C;  4BBQ A;  3KQI A;  2CT2 A;  2CRR A;  3LQJ A;  4MSX A;  2MKE A;  2CSY A;  3VK6 A;  2K4D A;  5B76 A;  2YQM A;  2LDR A;  4I7D A;  1T1H A;  4QF3 A;  2VJE B;  2MIQ A;  2KRE A;  2VPB A;  2G6Q A;  2YRE A;  5D1M B;  4FO9 A;  2C2V S;  2XEU A;  2UZG A;  2H0D B;  2YHN A;  1VYX A;  1CHC A;  3ZPV E;  3O70 A;  5C11 A;  2D8S A;  4UP0 A;  1G25 A;  2YYR A;  3IHP A;  5TDW A;  2ECW A;  2KWN A;  4LJN A;  4GNF A;  5SVI B;  2CSZ A;  2YT5 A;  2HDP A;  4V3L C;  5D1L B;  4WZ0 A;  4LK9 A;  3ZVZ B;  2VP7 A;  5H1T A;  4S3O C;  3N9Q A;  4PPE A;  5KH7 A;  5SVX A;  1X4I A;  4F1P A;  2RR4 A;  2L75 A;  3KNV A;  1FBV A;  4Z0O A;  2VNF A;  1F62 A;  4P5O B;  2VJE A;  1Z2Q A;  3LVQ E;  2KGG A;  1WEE A;  5I3L A;  5LKU A;  5FER A;  2PNX A;  3LVR E;  1ZBD B;  2H0D A;  1MM3 A;  1WIM A;  2MD8 C;  3E2D A;  4A49 A;  3HCS A;  2ECV A;  3U5P A;  4L58 A;  4LLB A;  1HYI A;  2KU3 A;  2F6J A;  4C9Z A;  4A4B A;  1X4U A;  1LDK C;  5TBN A;  5FB1 A;  3RPG C;  5SVI A;  2QIC A;  3O34 A;  1WE9 A;  2XOC A;  4IC3 A;  4MVT A;  5B77 A;  2MNY A;  3U5M A;  5LCW B;  2M85 A;  5DIN A;  2F6N A;  5G05 B;  2Y1M A;  5J3X A;  2EXU A;  4CA1 A;  2QIZ A;  3LQI A;  2ECN A;  2VPE A;  2E61 A;  5B8D A;  2YW8 A;  4H9D A;  5B75 A;  2G45 A;  2MNZ A;  4R8P K;  2MA6 A;  3N9M A;  2CRW A;  3FEH A;  4AYC B;  2FUU A;  5G04 B;  3Q1D A;  2EGP A;  2CSV A;  2LXH C;  2L0B A;  2YQL A;  3HCU A;  4PTB A;  2L7P A;  3HCT A;  1VFY A;  3O36 A;  2RSD A;  2JUN A;  4NN2 A;  1Z6U A;  3QZV A;  1HYJ A;  4XI1 A;  5LKT A;  5D1K B;  3DPL R;  3O35 A;  3NG2 A;  1K2F A;  3HTK C;  3LQH A;  2C2L A;  2LN0 A;  4A0C D;  1FP0 A;  1VD4 A;  2F42 A;  2I50 A;  2YU4 A;  3M63 A;  2DSM A;  2IDA A;  1N87 A;  4N3W A;  2LXP C;  2ZET C;  2VPD A;  3O33 A;  3PUR A;  2KR4 A;  2BAY A;  3O47 A;  3PUQ A;  3M7K A;  2LAU A;  4GNG A;  5AIT A;  4R7E A;  4QF2 A;  4O64 A;  2CON A;  2FFW A;  1MBM A;  3SOU A;  4YBM A;  5LKZ A;  2D8U A;  5LKX A;  2FD4 A;  3KDE C;  2M6M A;  4ZUX U;  2KWO A;  4WZ3 B;  1U6G B;  4GND A;  4Z0R A;  1WES A;  3M62 A;  2KFT A;  3LRQ A;  3FL2 A;  5EYA F;  1WEU A;  2LGG A;  1MM2 A;  2LGK A;  4ZQL A;  4W4U A;  3ZVY A;  1BOR A;  1WEW A;  1WEM A;  2JMD A;  2KKY A;  3T6R A;  1JM7 B;  2L5U A;  2YVR A;  3N9N A;  3I2D A;  2K1J A;  2HYE D;  3SOX A;  4WA6 A;  3SHB A;  3ZNI A;  4B7Y C;  3C6W A;  3N9P A;  1DCQ A;  2JMJ A;  2LRI C;  3GL6 A;  2ECT A;  2ECG A;  3M99 A;  5G0F A;  2M3H A;  4YAD A;  5TAB A;  1JOC A;  5TRB A;  3L11 A;  2KWJ A;  4Q6F A;  1WEP A;  2LGV A;  3H7H A;  4B86 C;  4UI9 B;  4CCG X;  2JMI A;  4ZDT A;  4V3K C;  3MHH A;  2XB1 A;  3N9L A;  2FUI A;  2EGM A;  4OGE A;  2YUC A;  4I7B A;  2B0O E;  5FEY A;  2JRJ A;  4R2Y A;  1WEN A;  2E6S A;  3SOW A;  3KV5 A;  3RPG B;  3FJU B;  4YBT A;  2CKL B;  1WIL A;  4WZ2 A;  1JM7 A;  1WEO A;  4O62 A;  3SUB A;  3FAO A;  1WGM A;  3V43 A;  2OXQ C;  3MDB C;  5B78 A;  1E4U A;  2K17 A;  3LDY A;  4BHW A;  2JM3 A;  1WEQ A;  1LDJ B;  3GV4 A;  2YHO A;  3PHD A;  4QQ4 A;  4X3G A;  3DWD A;  4YAT A;  3KV6 A;  2LQ6 A;  5K3Q A;  5C13 A;  3JUE A;  5H1V A;  3LJU X;  2IQJ A;  2M1R A;  3ZYQ A;  2YSJ A;  2KE1 A;  3FAN A;  3L1Z B;  2MD7 B;  1X4J A;  4AYC A;  2FSA A;  3ZTG A;  2KYU A;  4OGC A;  5SVY A;  2MUM A;  3T7L A;  3ASL A;  2CKL A;  4FJC A;  5AIU A;  2YUR A;  4L7X A;  1V87 A;  2LGL A;  3U5N A;  1Z60 A;  4IC2 A;  4GB0 A;  2ECI A;  4F52 B;  2ECJ A;  2LV9 A;  4LKA A;  2E6R A;  2P57 A;  2NAA A;  4YC9 A;  5KH3 A;  1WEV A;  5KH9 A;  1RMD A;  2VPG A;  3MHS A;  4FIP A;  2VJF B;  4S3O B;  1WFK A;  4TKP B;  4LAD B;  5H1U A;  2EA6 A;  3L1X A;  2QJ0 A;  5H9M A;  2OWA A;  2Y1N A;  2XOY A;  4FK5 A;  4AUQ B;  2KGI A;  4A4C A;  2EOD A;  3O37 A;  3RTR B;  4I7C A;  4AVX A;  2XOZ A;  1IYM A;  2PUY A;  1XWH A;  5JG6 A;  2KKX A;  3O7A A;  3PLW A;  4GNE A;  3C5K A;  2DJA A;  4YAX A;  3ZPV 1;  4YAB A;  2YSM A;  3N9O A;  4AP4 A;  2M13 A;  3U5O A;  5TDR A;  3DDT A;  5FB0 A; 
#chains in the Genus database with same CATH homology
 2MT5 A;  2AN6 A;  2Y43 A;  2K16 A;  3EB5 A;  2L80 A;  4N4F A;  4YBS A;  4UP5 A;  2L43 A;  3EB6 A;  2MA5 A;  1DVP A;  5B79 A;  2RI7 A;  5DKA A;  2VJF A;  2KIZ A;  2G43 A;  2DX8 A;  2KWK A;  3DQV R;  4BBQ A;  3KQI A;  2CT2 A;  3LQJ A;  4MSX A;  2CSY A;  3VK6 A;  2K4D A;  5B76 A;  2YQM A;  2LDR A;  4I7D A;  1T1H A;  4QF3 A;  2VJE B;  2MIQ A;  2KRE A;  2VPB A;  2G6Q A;  2YRE A;  5D1M B;  4FO9 A;  2C2V S;  2XEU A;  2UZG A;  2H0D B;  2YHN A;  1VYX A;  1CHC A;  3ZPV E;  3O70 A;  5C11 A;  2D8S A;  4UP0 A;  1G25 A;  2YYR A;  3IHP A;  5TDW A;  2ECW A;  2KWN A;  4LJN A;  4GNF A;  2CSZ A;  2YT5 A;  2HDP A;  4V3L C;  5D1L B;  4WZ0 A;  4LK9 A;  3ZVZ B;  2VP7 A;  5H1T A;  4S3O C;  3N9Q A;  4PPE A;  5KH7 A;  1X4I A;  2L75 A;  3KNV A;  1FBV A;  2VNF A;  1F62 A;  4P5O B;  2VJE A;  1Z2Q A;  2KGG A;  1WEE A;  5I3L A;  5LKU A;  5FER A;  2PNX A;  1ZBD B;  2H0D A;  1MM3 A;  1WIM A;  2MD8 C;  4A49 A;  3HCS A;  2ECV A;  3U5P A;  4L58 A;  4LLB A;  1HYI A;  2KU3 A;  2F6J A;  4C9Z A;  4A4B A;  1X4U A;  1LDK C;  5TBN A;  5FB1 A;  3RPG C;  2QIC A;  3O34 A;  1WE9 A;  4IC3 A;  4MVT A;  5B77 A;  2MNY A;  3U5M A;  5LCW B;  2M85 A;  5DIN A;  2F6N A;  5G05 B;  2Y1M A;  5J3X A;  4CA1 A;  2QIZ A;  3LQI A;  2ECN A;  2VPE A;  5B8D A;  2YW8 A;  5B75 A;  2G45 A;  2MNZ A;  4R8P K;  2MA6 A;  3N9M A;  4AYC B;  2FUU A;  5G04 B;  2EGP A;  2LXH C;  2L0B A;  2YQL A;  3HCU A;  4PTB A;  3HCT A;  1VFY A;  3O36 A;  2RSD A;  4NN2 A;  1Z6U A;  3QZV A;  1HYJ A;  4XI1 A;  5LKT A;  5D1K B;  3DPL R;  3O35 A;  3NG2 A;  1K2F A;  3HTK C;  3LQH A;  2C2L A;  2LN0 A;  4A0C D;  1FP0 A;  1VD4 A;  2F42 A;  2I50 A;  2YU4 A;  3M63 A;  2IDA A;  1N87 A;  4N3W A;  2LXP C;  2ZET C;  2VPD A;  3O33 A;  3PUR A;  2KR4 A;  2BAY A;  3PUQ A;  4GNG A;  5AIT A;  4R7E A;  4QF2 A;  4O64 A;  3SOU A;  4YBM A;  5LKZ A;  5LKX A;  2M6M A;  4ZUX U;  2KWO A;  4WZ3 B;  1U6G B;  4GND A;  1WES A;  3M62 A;  2KFT A;  3LRQ A;  3FL2 A;  5EYA F;  1WEU A;  2LGG A;  1MM2 A;  2LGK A;  4ZQL A;  4W4U A;  3ZVY A;  1BOR A;  1WEW A;  1WEM A;  2JMD A;  3T6R A;  1JM7 B;  2L5U A;  3N9N A;  3I2D A;  2K1J A;  2HYE D;  3SOX A;  4WA6 A;  3SHB A;  3ZNI A;  4B7Y C;  3C6W A;  3N9P A;  2JMJ A;  2LRI C;  3GL6 A;  2ECT A;  2ECG A;  3M99 A;  5G0F A;  2M3H A;  4YAD A;  5TAB A;  1JOC A;  5TRB A;  3L11 A;  2KWJ A;  4Q6F A;  1WEP A;  2LGV A;  4B86 C;  4UI9 B;  4CCG X;  2JMI A;  4ZDT A;  4V3K C;  3MHH A;  2XB1 A;  3N9L A;  2FUI A;  2YUC A;  4I7B A;  5FEY A;  2JRJ A;  1WEN A;  2E6S A;  4R2Y A;  3SOW A;  3KV5 A;  3RPG B;  4YBT A;  2CKL B;  1WIL A;  4WZ2 A;  1JM7 A;  1WEO A;  1WGM A;  3V43 A;  2OXQ C;  5B78 A;  1E4U A;  2K17 A;  4BHW A;  1WEQ A;  1LDJ B;  3GV4 A;  2YHO A;  3PHD A;  4X3G A;  4YAT A;  3KV6 A;  2LQ6 A;  5C13 A;  5H1V A;  2M1R A;  3ZYQ A;  2YSJ A;  2KE1 A;  3L1Z B;  2MD7 B;  1X4J A;  4AYC A;  2FSA A;  3ZTG A;  2KYU A;  2MUM A;  3T7L A;  3ASL A;  2CKL A;  4FJC A;  5AIU A;  2YUR A;  4L7X A;  1V87 A;  2LGL A;  3U5N A;  1Z60 A;  4IC2 A;  4GB0 A;  2ECI A;  4F52 B;  2ECJ A;  2LV9 A;  4LKA A;  2E6R A;  2NAA A;  4YC9 A;  5KH3 A;  1WEV A;  5KH9 A;  1RMD A;  2VPG A;  3MHS A;  4FIP A;  2VJF B;  4S3O B;  1WFK A;  4TKP B;  4LAD B;  5H1U A;  2EA6 A;  3L1X A;  2QJ0 A;  5H9M A;  2Y1N A;  4FK5 A;  4AUQ B;  2KGI A;  4A4C A;  2EOD A;  3O37 A;  3RTR B;  4I7C A;  4AVX A;  1IYM A;  2PUY A;  1XWH A;  5JG6 A;  3O7A A;  4GNE A;  3C5K A;  3ZPV 1;  4YAX A;  4YAB A;  2YSM A;  3N9O A;  4AP4 A;  3U5O A;  5TDR A;  5FB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...