4AVXA

Hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) bound to an ip2 compound at 1.68 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
GTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE SUBSTRATE
publication title Crystal Structure of the Tandem Vhs and Fyve Domains of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) Bound to an Ip2 Compound at 1.68 A Resolution
rcsb
source organism Homo sapiens
total genus 72
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4avxA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4avxA02
3SHBA 1LF8A 1WEEA 4V3KC 5LKXA 2Y1MA 2L0BA 3IHPA 2KR4A 4LADB 4R2YA 1Z2QA 3D9LA 3ZYLA 3ZPVE 5B78A 4LK9A 4R7EA 5LKTA 5CMYA 2PNXA 3N9PA 3LDZA 2MD7B 3DQVR 2KGGA 4BBQA 3KV6A 4Q96A 3KQIA 4C9ZA 4YC9A 4FLBA 3D9JA 4YATA 5C13A 5KH3A 1EDUA 2IDAA 2KWOA 1IYMA 2FSAA 4AVXA 2LRIC 5TDWA 3PHDA 2G6QA 2KIZA 4A4BA 2MOWA 1WEQA 3V43A 2LGKA 1HG2A 3N9QA 2KREA 2DX8A 2JRJA 3D9OA 4WA6A 4WZ3B 3U5NA 2G45A 1JM7B 5DINA 5TABA 2ECIA 4N3WA 1U6GB 2VPGA 2YUCA 5LOZA 3U5OA 2ECVA 4MVTA 4GZDA 3D9NA 3O36A 3KNVA 2MA6A 3L11A 3MHSA 3O33A 1MHQA 4L7XA 2VJFB 5G0FA 2LO6A 2BF0X 3LQIA 4GNFA 2LGLA 3M99A 5J08A 2H0DA 3T7LA 1HFAA 2VPBA 2BAYA 3N9LA 4A4CA 5B75A 4GNGA 1V87A 4CA1A 1FP0A 2E6RA 2LGVA 2MD8C 5TRBA 5JG6A 2YQLA 5B77A 4FK5A 2KWNA 3D9MA 2CSYA 2EODA 4FJCA 3I2DA 1MM3A 5FEYA 2CKLA 5FERA 5D1KB 1WEWA 1UJJA 3FL2A 1N87A 4IC2A 2YHOA 4AYCA 2LXPC 5B79A 1XWHA 3G2TA 3ZNIA 2L0TB 5LP0A 3O37A 2YSMA 2MA5A 4GB0A 2MT5A 3KV5A 5LCWB 3SOUA 4YBTA 5H1UA 1CHCA 1WEUA 3G2UA 2L80A 2KM4A 4S3OC 4LLBA 2CSZA 4F52B 2DIWA 2MNZA 2G43A 3N9OA 1ELKA 1JWGA 4B7YC 2KGIA 3O70A 3ZVYA 2LV9A 1JWFA 4ZDTA 2EGPA 1WEOA 1X4JA 1ZBDB 4WZ0A 1WEMA 2VJEA 3N9NA 4P5OB 1RMDA 3G2VA 4GZCA 3GL6A 3D9IA 5D1LB 4ZQLA 2HDPA 3RRUA 5FB0A 4I7DA 1WILA 2H0DB 1EYHA 4PTBA 3GV4A 1F62A 3ZVZB 1X4UA 1WENA 5I3LA 5FB1A 1JPLA 4FO9A 1HX8A 4R8PK 2F42A 5J3XA 1HF8A 2LGGA 1WESA 4YADA 3M63A 2MIQA 2Y43A 4YABA 4Q6FA 4ZUXU 5LKZA 1LDJB 3SOWA 4AUQB 4N4FA 1XGWA 3G2WA 4W4UA 3ONLA 3CLJA 4FU3A 4AYCB 1HYJA 2VPDA 4PPEA 1VYXA 2XB1A 2D8SA 1K2FA 1MM2A 3HCUA 2F6NA 1DVPA 3U5MA 4WZ2A 4A0CD 3LQJA 2I50A 2MUMA 5G05B 3L1ZB 3DPLR 1E4UA 2YW8A 2VNFA 2DCPA 2K1JA 5TDRA 4X3GA 1VDYA 2QIZA 4YBMA 1VFYA 3HCSA 3T6RA 1WE9A 1JM7A 4L58A 3VK6A 5AIUA 2LQ6A 2M85A 5B76A 1WFKA 5KH7A 2VJEB 2MNYA 3D9PA 4YAXA 3O35A 3N9MA 4NN2A 5G04B 4B86C 4YBSA 4CCGX 2KYUA 3C5KA 2YT5A 3ZYQA 1JOCA 3PURA 4O64A 1X4IA 2YURA 2FUIA 1WIMA 2KFTA 2KWJA 5EYAF 3SOXA 4LKAA 5B8DA 3D9KA 2RI7A 1LDKC 2ECGA 4A49A 4BHWA 2UZGA 3ONKA 3ZYMA 4V3LC 2C2LA 2FUUA 2VPEA 1WEVA 3ASLA 2E6SA 1WGMA 4LJNA 1Z6UA 2KWKA 1SZAA 4AP4A 4UP5A 3C6WA 4TKPB 3M62A 1WEPA 3RPGB 3L1XA 1HYIA 2YU4A 4NACA 2OXQC 5D1MB 5AITA 2L5UA 1PY1A 2ECNA 2EA6A 3NG2A 4UP0A 2YSJA 2NAAA 2L0IA 5CMWA 3G2SA 3ZTGA 2XEUA 3O7AA 1H0AA 4FIPA 2C2VS 3EB6A 5C11A 2JMDA 2JMJA 3RPGC 2YQMA 2CKLB 2F6JA 4IC3A 2M6MA 5H1VA 3HTKC 3PUQA 1VD4A 2ECWA 2AN6A 2M1RA 3HCTA 2QICA 2Y1NA 4HFGA 3LRQA 4I7BA 2L43A 3O34A 4Q94A 2YHNA 2HYED 1X5BA 1HG5A 3ZPV1 3U5PA 2KE1A 4JXTA 5DKAA 1Z60A 5KH9A 2QJ0A 4GNDA 2L75A 2LN0A 2M3HA 2K4DA 2ECJA 2JMIA 3MHHA 3RTRB 2LDRA 2ECTA 4QF2A 3EB5A 5LKUA 4I7CA 2YREA 1SZ9A 4QF3A 3QZVA 2V8SE 1INZA 5H1TA 2LXHC 2QY7A 5TBNA 1BORA 5H9MA 4MSXA 1JUQA 2CT2A 1UJKA 4S3OB 3ZYKA 2ZETC 2K16A 2VP7A 4UI9B 2K17A 2PUYA 2YYRA 2RSDA 1T1HA 3LQHA 2VJFA 2KU3A 4GNEA 1G25A 4XI1A 1FBVA
chains in the Genus database with same CATH superfamily
3ZXPA 3CQCB 1OXJA 2RFAA 4BTBA 2Y1MA 2V4HC 2KR4A 2R5SA 4LADB 3D9LA 2PZIA 4XI0A 4YVQC 1KT0A 4NURA 2RFMA 2XGMA 4N2SA 4JA7A 5AQ7A 4E6HA 3KV6A 4Q96A 2J08A 4DX2A 1DC2A 2DJAA 3O48A 4UQZA 4DRXE 5AENA 3ML8A 4CZ2D 1OWOA 4KZ0A 2H6HA 4YATA 2IDAA 1IYMA 3DPDA 4AVXA 3FU3A 2LRIC 4GA1A 4A4BA 5ENQD 2WXHA 3QB2A 3CHPA 5EILA 3S7FA 5AYWD 3AS4A 3PE3A 4GYOA 4YDOA 3E4BA 3TJPA 1JM7B 4HI9A 5TABA 1D8DA 4N3BA 5AQ9A 3I5PA 2NSZA 2VPGA 2PQNA 3U5OA 4GZDA 2WXMA 2R59A 4DLOA 1HU3A 5T4YA 1Y6IA 1QZ2A 4L2YA 4L7XA 3QNKA 1XNFA 1MX2A 2LAHA 4JW1A 4WUYA 2GRLA 2LGLA 2P9SG 4N5CA 4JEUA 3HXDA 5J08A 3CVYA 2WQ7A 3N9LA 2BAYA 3V2OA 3B7RL 4UWHA 2MD8C 5JG6A 1WY6A 3U3WA 4G1TA 4QQIA 4N3CA 4FK5A 5KJMA 3D9MA 2EODA 4MRUA 4O6FA 3QWVA 4FJCA 2CHZA 2XEEA 2Y1LE 5AAOA 5D1KB 1LD8A 1H6OA 1UJJA 3FL2A 5A23A 3DRAA 2YSMA 3KEAA 4I6EA 1BI8B 4HOSA 5LCWB 1V55E 1OCRE 2WMNA 4ANUA 4ZFHA 4GZ6A 2KM4A 2OEVA 5SVIA 4GYYA 1TNUA 1GW6A 4BT9A 3OAWA 5CEAA 2G43A 4FHKA 4I17A 3ZVYA 5JJ7A 1JWFA 3QWPA 4K03A 3OXGA 2EIKE 1Z3XA 2KCVA 2FEZA 1E90A 4URKA 1MBMA 4G26A 3N9NA 2PQRA 3GYZA 3U9WA 2YNQA 3FM8C 1G3NB 3CHOA 2HDPA 3FY4A 4B8CB 4I1AA 4ATGA 3RRUA 5CCMA 4AM9A 3FUDA 2RR4A 3CK8A 3FUNA 2H0DB 3B7SA 1MYOA 4C0EA 1HX8A 4OVVA 4R8PK 3BG0B 4K0RA 4LNBA 3TWTA 3C3OA 3Q9UC 3HVEB 3ZU7B 5AQAA 3FJUB 5C2YA 2L6BA 3ESLA 2X38A 2ILRA 2RG8A 5B3SE 1XGWA 4XI9A 5H7PA 4V3IA 3FEXA 3IHVA 4OGCA 4W4UA 4KMOA 1HE8A 5DBKA 1A5EA 4EZKA 4AV7A 4NQ0A 1HYJA 2JUNA 2YVRA 3IV0A 5KJNA 3Q78A 3NQPA 4KXKB 2FD4A 3SBSA 3RRNB 3FFLA 1E8ZA 4FJYA 3UT4A 5FIOA 4G2VA 3HCUA 4A63B 2EIJE 3L22A 3FH7A 2DYSE 4FA6A 1QNFA 4IULA 2YW8A 2OWAA 4WWOA 4BESA 2QIZA 1VFYA 2D8UA 3HCSA 2VGXB 1JM7A 2IOLA 3L54A 2FO1E 4PH4B 5KH7A 3ASGA 3MDBC 2XENA 5G04B 3LS8A 2X3MA 5K3QA 4U07A 4YBSA 4CCGX 2KYUA 2YT5A 3TG5A 4KBQA 1S70B 1TEZA 1TN6A 2YURA 2FUIA 2Y4TA 2KFTA 5E76A 5EYAF 1A17A 3SOXA 2FFWA 4LKAA 3L16A 4Y6WA 4EPZA 3MKQB 3E30A 2A5UA 1OCZE 2EXUA 2RI7A 3MV2B 1H6KA 2IY0C 1O1TA 2UZGA 3ONKA 4V3LC 2FUUA 5FQ6A 3DEOA 1D8EA 3ASDA 4AP4A 3L6AA 2PNNA 3M62A 3ISMC 1N94A 3EHQA 5AIJA 3L1XA 2KZTA 4JZYA 4OGEA 3SUBA 2ZXWE 2OXQC 4G24A 5AITA 2WXGA 1PY1A 3ZVVA 5HRYA 3RRMB 4UP0A 3GZSA 3PEVB 2YSJA 2NAAA 1NL4A 5HI7A 4N39A 2WQ6A 3L82A 1H0AA 2VJ8A 1WDYA 2HYZA 2JMDA 2EILE 4GTVA 2WXFA 2KKXA 4CEMA 5KBAA 2XGSA 5ANLA 4OAUC 3PUQA 4GTTA 3C98A 3FWVA 3ZHEB 4DK5A 2M1RA 5FT9A 4AXHA 1RW2A 3NOGD 3PVLA 2QICA 4L23A 4A3TA 3CR3A 3QDNA 3LJ3A 4G11A 4PS8A 3ZPV1 4BSZB 4CDMA 1B89A 3B7UX 2EGMA 4GNDA 4I9CA 4AY6A 1Y8MA 3UX4A 4OAVB 3PH0C 4Z0OA 3TWRA 3CHSA 2M63A 3HIZA 4BWRA 4NIKA 1OCCE 1IHGA 1UN9A 4ILGA 1OWMA 4U63A 1FPPA 3HVEA 1N95A 5H1TA 1N4RA 3IHYA 3L13A 2J8SD 2QY7A 5LFAA 4MSXA 1UJKA 3DXKG 5HKPA 2YYRA 1H2TC 3WXXA 3CK7A 1U2VG 4GTMA 4FHJA 3RJVA 5CBNA 5D0QD 3SHBA 2IFUA 1N4QA 5LKXA 4UQYA 3S7JA 2L0BA 1O1SA 3UT7A 1Z2QA 3MA5A 5B78A 4GZ5A 1TR4A 4LK9A 3LCAA 3S7DA 3C72A 4OVUA 4UI9C 3LDZA 4AP2A 2MD7B 3JXJA 2Q7FA 2J49A 2J9QA 2KGGA 1H2VC 3V30A 4I2ZA 3ABLE 4TUUA 5ITZF 4PS3A 3CVUA 5ENTD 5FQ7A 2VGXA 3LJNA 1YA0A 4W9RA 2E2EA 4FLBA 3D9JA 1MX6A 2KCKA 1E7VA 1EDUA 4IN3B 4G8LA 5JJ6A 3U4TA 5TDWA 1WM5A 2KIZA 1N4SA 3CHQA 4GA2A 2PM7A 2LXLA 3N9QA 2KREA 4AY5A 2WB2A 1L5JA 4WA6A 5KJKA 2G45A 3CVXA 3FU6A 5DINA 4CYMD 1YYHA 1TJFA 3MKQA 3ASHA 3VTXA 3KS2A 3ZRHA 2ECVA 2XCBA 1Q2ZA 2MA6A 2LAUA 3O33A 4DPRA 1MHQA 4MLPA 2VJFB 5G0FA 5HQ8A 3HXCA 2WXQA 3M99A 5FWQA 3H7HA 5EYPF 2XPZA 3MYVA 1NFIE 4BEPA 3PE4A 2VPBA 5B75A 4BX9A 2UWJG 4JEHA 4GNGA 5ARGA 1V87A 3Q73A 4WNGA 2ETBA 2E6RA 4GMJA 4UQXA 3SFYA 3TXMA 3QC1A 4DX5D 3HXBA 2DZOA 3FTSA 2A4ZA 2CRWA 3I2DA 1MM3A 4RQIA 2VQ2A 4I6JA 4TUMA 5FEYA 1O1RA 1HS6A 4LEUA 3ZN3A 3S2AA 1QQEA 5DIZA 1N87A 2I1KA 4IC2A 2L6JA 4A1SA 2XPIA 3DXMG 3AJIA 3G2TA 5LP0A 3BQOA 5C1DA 2MA5A 4GTRA 4I6GA 2P9KG 3SD5A 1WEUA 2EINE 3UTMA 2WQHA 4M3OA 1EF1C 2CSZA 3UT8A 4F52B 1MX4A 3Q49B 4BX8A 4JA9A 4U0UA 3O70A 4GMLA 4JHJA 2LV9A 1S0PA 4ZDTA 1DCQA 2MHKA 2EGPA 4RVBA 3UM2A 1ZBDB 1WEMA 2VJEA 5FINA 1O5MA 4HLLA 4BSXA 4ZQLA 3MJWA 4I7DA 1SW6A 4J8SA 1BLXB 4HLEA 3GV4A 3FULA 2R17C 3LVRE 4I9EA 4XE0A 4XX5A 1SQMA 5I3LA 5FB1A 1FT1A 1JPLA 4HQDA 3BG1B 1RZ4A 3BEEA 3ZNGA 3MV3B 3I4GA 3CVNA 3QARA 2BEDA 4B8AA 5LKZA 1LDJB 4U8VD 3AAAC 3SOWA 4AUQB 4U96D 2P9LG 3G2WA 4WWNA 4N5QA 2QZAA 3EDTB 2BKKB 4FU3A 4AYCB 2IO3C 3BU8A 4UWLA 4JB8P 2J07A 5JJTA 5BUZA 4HXIA 3Q1DA 1K2FA 3F6QA 2Y69E 2DBAA 1OWPA 4I43A 4YDWA 5E75A 2F6NA 3UKUG 2WXLA 1OWLA 3U5MA 2GRPB 4WZ2A 3VTYA 1ZBPA 5FQ8A 3DPLR 3CVPA 1E8WA 4TXRA 5TDRA 3CGHA 4K5AB 1ZB1A 2WXOA 1VDYA 3AG4E 3CV0A 4J0UA 3FANA 4L58A 4JC8A 5AIUA 4J8DA 1QYMA 5EIBE 1WFKA 2B0OE 5CHEE 4GCOA 3T5XA 3TXNA 3FUIA 3N9MA 5KNHD 2XGOA 1TNOA 3T5VA 5EX3A 1FCHA 3C5KA 3ZYQA 2IQCA 3PURA 3VLFA 2P58C 4DJAA 4YVOA 1KT1A 1P5QA 4EECA 3L9TA 3ZEFA 2VGEA 4F1SA 5B8DA 4TRQA 3D9KA 2XS8A 4N2QA 2GRNB 4A49A 4BHWA 4B93B 2XCCA 4A3VA 3PREA 4E85A 5BV0A 2VPEA 3RSEG 2E6SA 4J8EA 1WGMA 4LJNA 4KT6B 4Z0RA 3AS8A 2HO1A 2IQJA 1NA0A 3C6WA 3C3QA 1N52A 1WEPA 3CHRA 4ILIA 3L17A 3NZSA 3NBNB 4U95D 2VGYA 1TNYA 3SFXA 4ACKA 3CVLA 4B0ZA 2QC9A 2IJGX 2HE0A 3NG2A 4AJWA 2BKGA 4U8HA 1OCOE 4QQ4A 2L0IA 2LSUA 2XHEA 2ZGGA 2KCLA 5C11A 3RPGC 4UWGA 4H9DA 4G23A 5LCWJ 3CKCA 5EN5D 2F6JA 2M6MA 5H1VA 3FTWA 3HTKC 3CVWA 4PS7A 3DSTA 3EJNA 1NZNA 1FVHA 4CGWA 3P2BA 4AEZC 3HCTA 1LTXA 3HHMA 2L43A 2YHNA 3ASFA 2EIME 1HG5A 5JMND 3RAUA 4HNAD 3SO8A 4UI9K 1Z60A 2QJ0A 2X6HA 2L75A 1Z6TA 1OY3D 3SNXA 3ASNE 2K4DA 3TWWA 3FTUA 3E32A 2ECJA 5BPPA 4XKCA 2IO2C 1QBQA 2V5QC 2ECTA 4HB5A 4XKBA 2LXMA 1PAQA 3E37A 1W3BA 3APFA 2KC7A 4QF3A 4MS6A 4FJZA 1DNPA 3QZVA 3UUXA 1INZA 1SA4A 4K5BA 3V2XA 1TN7A 1K1BA 1JUQA 2IU1A 2X6IA 5HS0A 3RK6A 3JUEA 4KVMA 4S3OB 2ZETC 4UI9B 1MJ0A 2K17A 2RSDA 3LQHA 3OXFA 2KU3A 4GNEA 1IQUA 4Z68A 1G25A 1FBVA 3EIQC 1YMPA 4JVSA 1LF8A 3TWVA 3MEKA 1WEEA 4GAAA 3W9GA 4I2WA 1N54A 3KAEA 3IHPA 4LRZA 3Q4AB 2A5EA 4YNDA 3DWDA 1HO8A 1LD7A 4MBGA 4R7EA 5LKTA 5CMYA 5IY5E 3ZPJA 1K3ZD 2PNXA 3KDEC 3LY8A 3DQVR 1UN8A 2AW6A 4HI8A 1D9SA 2WXNA 2FBNA 1WG0A 3KQIA 2FF4A 1IHBA 4FLHA 2DZNA 4C9ZA 4BFRA 4YC9A 4BETA 4C48B 3LJUX 5C13A 2XP0A 3FTXA 4J7WA 4O1PA 2CONA 1U3DA 3EUVA 2G6QA 2MOWA 2FULA 1WEQA 3UKRG 2LGKA 3TL5A 2JRJA 3UI2A 3D9OA 4WZ3B 3PUJA 3BUAA 3E2DA 2XZDG 1OWNA 1EPUA 2E61A 2ECIA 4N3WA 4EQFA 4GTPA 4MVTA 2IF4A 3B13A 1SVXA 3SY2A 3D9NA 3L08A 3KNVA 5AJLA 3L11A 3MHSA 2BUGA 5FZSA 2LO6A 3JQ1A 3Q7AA 5ARFA 4GNFA 1N0QA 2XQ0A 2H0DA 3MCXA 5KWDA 4A4CA 5AQBA 5FZRA 3PS6A 4O1OA 4DUIA 4P29A 4CA1A 1FP0A 3P1UA 3M7KA 3J5PA 3FUFA 2YQLA 5B77A 5AJDA 3QJZA 5BNWA 4HRLA 2RD0A 4DX1A 3LY7A 4WWPA 3APDA 3SHFA 2KATA 4IRUA 3ZIMA 5FERA 4DX6D 2X6FA 2KXPC 3PNLB 3SFZA 5CERB 3W9FA 2LXPC 4F1PA 5B79A 1AWCB 1XWHA 3ZNIA 2L0TB 3ZGQA 2YQ8A 3KSLA 3O37A 1S64A 4GB0A 1IQRA 2GW1A 4EZJA 3TG4A 1TYQG 3LKUA 4FP7A 3FUEA 3RO3A 2P9UG 1Z5SC 3R9MA 3SF4A 4S3OC 4LLBA 4YDYA 2HM8A 4APFA 2NYJA 2ZGDA 3O4ZA 3N9OA 1TN8A 2CRRA 1DCEA 3UQ3A 3CKBA 1ELKA 1JWGA 2KGIA 5BXOA 2Y4UA 4GU5A 3ZW3A 5G05J 2IONA 4XZ4A 4WZ0A 3TWUA 2Y3AA 3PDNA 2F8XK 3IBEA 4GZCA 3GZ1A 3D9IA 4F53A 5FB0A 2NXPA 3T8KA 5M72A 5A7DB 4UWFA 2XEVA 2QFCA 3FHEA 2GRMA 1FVFA 4EBAG 4PDXA 2F42A 5J3XA 1HF8A 1WESA 4J8YA 3M63A 2MIQA 4YADA 3Q5MA 1SA5A 3GZ2A 4N4FA 3ONLA 3O47A 2WVIA 3TWQA 3CLJA 1JCSA 2GROB 5BXUA 2GGFA 2VPDA 1VYXA 4OYSA 2XB1A 4U7EB 4UWKA 5KCMA 2D8SA 2R02A 1UG3A 1UOHA 2X6KA 3D9HA 2CG2A 2XRYA 4ME2A 1MM2A 3UXGA 2Y0BG 3EHMA 4G8KA 1DVPA 5SVIB 1BI7B 3B7BA 3HXFA 4A0CD 3HDXA 3LQJA 4F7AA 2MUMA 3SZ7A 3L1ZB 1E4UA 4J6IA 2CG3A 2F0YA 2K1JA 3DPYA 3SBTB 4L9PA 2I9CA 3FEYA 1BPOA 3PZ2A 1WE9A 3MZLB 3NAWA 5B1BE 3DSWA 4J8FA 3ZHEA 3FP3A 5G55A 3X2QE 2FI7A 1IYGA 3T8MA 5CRVA 4NN2A 1TJCA 4B86C 2VSXE 1H6PA 4O64A 1X4IA 3ABME 4O62A 2KBXA 1ZU2A 1WIMA 3CIAA 2KWJA 2XPYA 3LYAA 2XEHA 2WXRA 1KLXA 4U0SA 4AOFA 1AP7A 3JUIA 3LPZA 4FULA 5KJLA 3QAQA 2ECGA 1ELWA 5G2NA 1S63A 4LG6A 2ETAA 2DWZA 4U0ZA 1WEVA 2VSOE 3ASLA 4WNDA 3RKVA 1SZAA 3CSTA 4ZHBA 3FU0A 4HS2A 3R7RA 4UP5A 4FC8A 4TKPB 4BTAA 3SGHA 4L7TA 3ASOE 5SVXA 2PM6A 3URZA 1NA3A 3RPGB 4NRHB 1HYIA 4WAFA 5EDSA 2I2OA 2YU4A 4BT8A 2VSNA 4JHRA 3FUHA 4CT4A 2J4DA 2ECNA 2EA6A 4ANVA 3CEQA 5BV1A 1V54E 3FEHA 3IKOB 3NZUA 3G2SA 3QWWA 2XEUA 2AXVA 3FAOA 5EIDA 4FIPA 3EB6A 3Q75A 2YQMA 2CKLB 2XS1A 1E96B 2MRIA 2C0MA 4IC3A 3Q47B 4F3VA 2QYUA 1FT2A 2IOSA 2AXZA 4ANXA 2AN6A 2LSVA 4LNGA 2MYOA 2WXIA 2Y1NA 3HYMB 1YCSB 3Q9NC 4Q94A 2XOZA 3U5PA 1ELRA 5DKAA 3ABKE 5KH9A 4ACLA 4BERA 2V5FA 2M3HA 1NI1A 1KZPA 2JMIA 1HH8A 3RIBA 4GTQA 4I1OB 1WAO1 2OV8A 3QOUA 3RTRB 2ETCA 2LDRA 4QF2A 3EB5A 2WXKA 4B89A 2YREA 3DDTA 1SZ9A 2NC9A 4HRMB 4ANWA 3HXEA 3LVQE 4RLYA 3Q79A 1BORA 5H9MA 2LAIA 2CT2A 3T9KA 3UPVA 3ZYKA 3ML9A 5JA4D 2K16A 5SVYA 3KSQA 2KZTB 2VJFA 3CQGB 3AG3E 2XRZA 5BT1A 2GRQB 2H6IA 2C0LA 4IYPA 5CECB 3OXLA 4XI1A 3UM3A 4RG6A 2ZISA 4HVBA 4V3KC 2UY1B 4N3AA 2YINA 3PLWA 4HRNA 3NOCD 4R2YA 1MQSA 3ZPVE 3ZYLA 2XOCA 4AIFA 2ZIRA 4LERA 4HORA 5EYLA 5AARA 3E33A 2I1JA 3N9PA 5ENRD 1N4PA 3KEZA 2JM3A 1E8YA 2DSMA 4GCNA 4BBQA 4XIFA 5EKQD 3VLEA 3I4RB 4HOTA 2AJAA 3UM1A 4K5CA 2H6GA 3Q7FA 3FUJA 2JLBA 3EHRA 2L7PA 3CVVA 3AS5A 5KH3A 2CSVA 2KWOA 4GA0A 2FSAA 1H2UA 3MKRA 4I1MA 3PHDA 1H19A 4GPMA 2P9IG 2OCCE 1BD8A 4CT0A 3V43A 1HG2A 2AVPA 1OT8A 2DX8A 3PUKA 3U5NA 3QKYA 4CDRA 4APOA 3PEUB 3D3MA 5CRUA 5A6CA 1U6GB 2J4BA 3I3NA 2YUCA 4EHMA 4Y6CA 5LOZA 4CGVA 2MKEA 3UMVA 3O36A 3FH8A 5BW8C 4UUCA 3DBSA 2L9BA 4C9BB 2CFZA 1NP7A 4DX7D 5T8IA 2VTBB 2BF0X 3IXEA 3NB2A 4GTOA 3WG7E 2XOYA 3LQIA 3CVQA 5FTPA 2WMOA 3T7LA 4XEIG 2ONDA 3R7QA 1HFAA 5ENOD 2B6CA 3PZ4A 5FJYA 1PC2A 4B94A 2ZU6B 3ENEA 4U04A 2LGVA 5TRBA 2H6FA 3APCA 2KWNA 2CSYA 3JQ0A 2LUHA 3JXIA 2R05A 2CKLA 4H7YA 1JCQA 2WXJA 3SI5A 1WEWA 4G25A 3EU5A 3UIOC 1E8XA 3AG1E 2YHOA 4AYCA 2WM9A 4GMRA 2CHWA 5D2MC 4A55A 2MT5A 3KV5A 2OVFA 3SOUA 4YBTA 3RU0A 5H1UA 3HRAA 1CHCA 4LUNU 3SQVA 3G2UA 2L80A 2V0PA 1TNBA 2OEWA 2DIWA 2MNZA 5ENSD 3FTYA 4B7YC 3C3RA 5LCWC 5JHAA 1WEOA 2R2LA 1X4JA 1E7UA 4P5OB 4WNEA 5JHBA 1RMDA 4YDEA 4GB9A 2DYRE 3G2VA 3LXUX 3GL6A 3FDHA 2EQXA 3ULQA 5FQ4A 5D1LB 4ATZD 4R7LA 4H7XA 4ABNA 3ULEG 4HOUA 4O60A 1WILA 5CBOA 1EYHA 4PTBA 3K9IA 1F62A 3ZVZB 1X4UA 1WENA 5G04J 2X6JA 4DLQA 4JHKA 4FO9A 4WNFA 2UY1A 4LNUD 3TGOA 2LGGA 3ZFWA 2CHXA 3JYSA 4UI9J 4L1BA 4F6RD 2IEJA 2Y43A 4YABA 4Q6FA 1N9AA 4ZUXU 3NF1A 3PNTB 2JEKA 3LDYA 3UIPC 3ESKA 3U64A 4X8QA 3GW4A 1MZCA 4JD2G 4PPEA 3DEPA 4GZ3A 3AU4A 4CRWA 4DI3A 5CEDB 1UW4B 4RG9A 3CHMA 2DVWA 3Q15A 2BTDA 5T3RA 3ZKJA 2I50A 5G05B 3MGBA 4A1GA 3J5QB 4CDNA 2VNFA 3CSFA 1IKND 2DCPA 4X3GA 3S7BA 5KNGA 4YBMA 3T6RA 3V31A 2JABA 1HXIA 3TWXA 3VK6A 2LQ6A 2M85A 5B76A 2OOEA 5B1AE 2VJEB 2MNYA 3D9PA 4YAXA 4GTSA 3VLDA 3O35A 3DSSA 3AG2E 4TXPA 5AN8A 3FUKA 1N0RA 5D66A 2P9NG 1JOCA 5ENPD 3HG0D 3FTVA 2LNIA 2WPVA 2VTBA 3E34A 3PZDA 3IEGA 5J90A 3FU5A 2QYJA 2GRRB 4TV3A 4BY6A 3EHNA 3PRZA 2YHCA 3UINC 1LDKC 1TNZA 2YHEA 5G04C 3ZYMA 2C2LA 4LCTA 2AXUA 3MX3A 3TWSA 4C0MA 3B95A 2VSYA 1Z6UA 1Z3YA 2KWKA 2OVBA 3JCKC 5FZQA 3EIJA 4U8YD 4RSYA 4Q69A 4KVOA 2P2CP 5D0OD 3DSUA 5EX0A 2WXPA 2FO7A 3PZ1A 3ZXSA 3N71A 2J09A 4NACA 4HBDA 5D1MB 2L5UA 4GPKA 3B7TA 2PL2A 3AU5A 3ZUVB 5ANRA 5CMWA 3ZTGA 4MKTA 4HOQA 3O7AA 1IXVA 3LY9A 2C2VS 1U3CA 5CCLA 3QK0A 2P9PG 4JL0A 2JMJA 2F37A 4JPSA 1VD4A 4GYWA 3PZ3A 2ECWA 3DWLG 3DSXA 4KYOB 3UM0A 3KD7A 3U66A 3LEWA 4HFGA 3LRQA 2XZTG 3O34A 4I7BA 1K8KG 4EBAA 2HYED 1X5BA 4TXQA 3V79K 2RKKA 3OTNA 2KE1A 4JXTA 4L2LA 2AWIA 1KZOA 2CFUA 2LN0A 2E0IA 1HZ4A 3CK9A 3FTZA 3DSVA 2VYIA 4M7CA 1OUVA 3MHHA 4D10C 2F8YA 2I6HA 5LKUA 4I7CA 2R03A 4PUCA 3EU9A 5LX8A 2HR2A 2V8SE 2KKYA 4DI4A 1N11A 2V4LA 4EZLA 3C5RA 2LXHC 4LSZE 3TAXA 5TBNA 3FUMA 5G05C 5ENNA 4FADA 1K1AA 4ILHB 1JCRA 4CCAA 4QFVA 3R9AB 2VP7A 3RO2A 2PUYA 1X81A 3ULYA 1T1HA 2P57A 1BU9A 3FH5A 4KZCA 2M13A 1KPSB
chains in the Genus database with same CATH topology
3CQCB 4BTBA 2Y1MA 2KR4A 2R5SA 4LADB 3D9LA 2PZIA 4XI0A 4YVQC 1KT0A 4NURA 2XGMA 4N2SA 4JA7A 4E6HA 3KV6A 4Q96A 2J08A 3O48A 4UQZA 5AENA 3ML8A 1OWOA 4KZ0A 4YATA 2IDAA 1IYMA 3DPDA 4AVXA 3FU3A 2LRIC 4GA1A 4A4BA 2WXHA 3QB2A 3CHPA 3S7FA 5AYWD 3AS4A 3PE3A 4GYOA 3E4BA 3TJPA 1JM7B 5TABA 4N3BA 3I5PA 2NSZA 2VPGA 2PQNA 3U5OA 4GZDA 2WXMA 2R59A 4DLOA 1HU3A 5T4YA 1Y6IA 1QZ2A 4L2YA 4L7XA 3QNKA 1XNFA 2LAHA 4JW1A 4WUYA 2GRLA 2LGLA 4N5CA 4JEUA 5J08A 3CVYA 2WQ7A 3N9LA 2BAYA 3B7RL 4UWHA 2MD8C 5JG6A 1WY6A 3U3WA 4G1TA 4N3CA 4FK5A 5KJMA 3D9MA 2EODA 4MRUA 4O6FA 3QWVA 4FJCA 2CHZA 5D1KB 1UJJA 3FL2A 5A23A 2YSMA 4I6EA 4HOSA 5LCWB 2WMNA 4ANUA 4GZ6A 2KM4A 4GYYA 1GW6A 4BT9A 3OAWA 2G43A 4FHKA 4I17A 3ZVYA 5JJ7A 1JWFA 3QWPA 4K03A 3OXGA 1Z3XA 2KCVA 2FEZA 1E90A 4URKA 4G26A 3N9NA 2PQRA 3GYZA 3U9WA 2YNQA 3CHOA 2HDPA 3FY4A 4B8CB 4I1AA 3RRUA 4ATGA 5CCMA 4AM9A 3FUDA 3CK8A 3FUNA 2H0DB 3B7SA 4C0EA 1HX8A 4OVVA 4R8PK 3BG0B 4K0RA 3HVEB 5C2YA 3ESLA 2X38A 2ILRA 2RG8A 1XGWA 4XI9A 4V3IA 3FEXA 3IHVA 4W4UA 4KMOA 1HE8A 5DBKA 4EZKA 4AV7A 4NQ0A 1HYJA 3IV0A 5KJNA 3NQPA 4KXKB 3SBSA 3RRNB 3FFLA 1E8ZA 4FJYA 3UT4A 4G2VA 3HCUA 3L22A 3FH7A 4FA6A 1QNFA 4IULA 2YW8A 4WWOA 2QIZA 1VFYA 3HCSA 2VGXB 1JM7A 2IOLA 3L54A 4PH4B 5KH7A 3ASGA 5G04B 3LS8A 2X3MA 4U07A 4YBSA 4CCGX 2KYUA 2YT5A 4KBQA 3TG5A 1TEZA 2YURA 2FUIA 2Y4TA 2KFTA 5E76A 5EYAF 1A17A 3SOXA 4LKAA 3L16A 4Y6WA 4EPZA 3MKQB 2A5UA 2RI7A 3MV2B 1H6KA 2UZGA 4V3LC 3ONKA 2FUUA 5FQ6A 3ASDA 4AP4A 3L6AA 3M62A 5AIJA 3L1XA 2KZTA 4JZYA 2OXQC 4G24A 5AITA 2WXGA 1PY1A 3ZVVA 3RRMB 4UP0A 3GZSA 3PEVB 2YSJA 2NAAA 5HI7A 4N39A 2WQ6A 1H0AA 2VJ8A 2HYZA 2JMDA 2WXFA 4CEMA 2XGSA 5ANLA 3PUQA 3C98A 3FWVA 3ZHEB 4DK5A 2M1RA 5FT9A 4AXHA 3PVLA 2QICA 4L23A 4A3TA 3CR3A 3QDNA 3LJ3A 4G11A 4PS8A 3ZPV1 4CDMA 1B89A 3B7UX 4GNDA 4I9CA 4AY6A 1Y8MA 3UX4A 3PH0C 3CHSA 2M63A 3HIZA 4BWRA 1IHGA 1UN9A 4ILGA 1OWMA 4U63A 3HVEA 5H1TA 3IHYA 3L13A 2QY7A 5LFAA 4MSXA 1UJKA 2YYRA 1H2TC 3WXXA 3CK7A 4FHJA 3RJVA 5D0QD 3SHBA 2IFUA 5LKXA 4UQYA 3S7JA 2L0BA 3UT7A 1Z2QA 3MA5A 5B78A 4GZ5A 4LK9A 3LCAA 3S7DA 4OVUA 4UI9C 3LDZA 4AP2A 2MD7B 2Q7FA 2J49A 2J9QA 2KGGA 1H2VC 4I2ZA 4TUUA 4PS3A 3CVUA 5FQ7A 2VGXA 1YA0A 4W9RA 2E2EA 4FLBA 3D9JA 2KCKA 1E7VA 1EDUA 4IN3B 5JJ6A 3U4TA 5TDWA 1WM5A 2KIZA 3CHQA 4GA2A 2PM7A 3N9QA 2KREA 4AY5A 2WB2A 1L5JA 4WA6A 5KJKA 2G45A 3CVXA 3FU6A 5DINA 1TJFA 3MKQA 3ASHA 3VTXA 3KS2A 3ZRHA 2ECVA 2XCBA 2MA6A 3O33A 4DPRA 1MHQA 4MLPA 2VJFB 5G0FA 5HQ8A 2WXQA 3M99A 5FWQA 2XPZA 3MYVA 3PE4A 2VPBA 5B75A 4BX9A 2UWJG 4JEHA 4GNGA 5ARGA 1V87A 4WNGA 2E6RA 4GMJA 4UQXA 3TXMA 3QC1A 3FTSA 2A4ZA 3I2DA 1MM3A 2VQ2A 4I6JA 5FEYA 1HS6A 4LEUA 3ZN3A 3S2AA 1QQEA 5DIZA 1N87A 2I1KA 4IC2A 2L6JA 4A1SA 2XPIA 3G2TA 5LP0A 5C1DA 2MA5A 4I6GA 3SD5A 1WEUA 2WQHA 4M3OA 1EF1C 2CSZA 3UT8A 4F52B 3Q49B 4BX8A 4JA9A 4U0UA 3O70A 4GMLA 4JHJA 2LV9A 1S0PA 4ZDTA 2MHKA 2EGPA 4RVBA 1ZBDB 1WEMA 2VJEA 4BSXA 4ZQLA 3MJWA 4I7DA 4J8SA 4HLEA 3GV4A 3FULA 2R17C 3LVRE 4I9EA 4XE0A 4XX5A 1SQMA 5I3LA 5FB1A 1JPLA 3BG1B 3BEEA 3MV3B 3I4GA 3CVNA 3QARA 4B8AA 5LKZA 1LDJB 3SOWA 4AUQB 4WWNA 3G2WA 3EDTB 4FU3A 4AYCB 4UWLA 2J07A 5JJTA 5BUZA 4HXIA 1K2FA 2DBAA 1OWPA 4I43A 5E75A 2F6NA 2WXLA 1OWLA 3U5MA 4WZ2A 3VTYA 1ZBPA 5FQ8A 3DPLR 3CVPA 1E8WA 5TDRA 3CGHA 2WXOA 1VDYA 3CV0A 4J0UA 4L58A 4JC8A 5AIUA 4J8DA 1WFKA 5CHEE 4GCOA 3T5XA 3TXNA 3FUIA 3N9MA 2XGOA 3T5VA 5EX3A 1FCHA 3C5KA 3ZYQA 2IQCA 3PURA 3VLFA 2P58C 4DJAA 4YVOA 1KT1A 1P5QA 4EECA 3ZEFA 4F1SA 5B8DA 4TRQA 3D9KA 4N2QA 4A49A 4BHWA 2XCCA 3PREA 4A3VA 4E85A 5BV0A 2VPEA 2E6SA 4J8EA 1WGMA 4LJNA 4KT6B 3AS8A 2HO1A 1NA0A 3C6WA 1N52A 1WEPA 3CHRA 4ILIA 3L17A 3NZSA 2VGYA 4ACKA 3CVLA 4B0ZA 2IJGX 3NG2A 4AJWA 4U8HA 2L0IA 2LSUA 2XHEA 2KCLA 5C11A 3RPGC 4UWGA 4G23A 5LCWJ 3CKCA 2F6JA 2M6MA 5H1VA 3FTWA 3HTKC 3CVWA 4PS7A 3EJNA 1NZNA 1FVHA 4CGWA 3P2BA 4AEZC 3HCTA 3HHMA 2L43A 2YHNA 3ASFA 1HG5A 4UI9K 1Z60A 2QJ0A 2X6HA 2L75A 1Z6TA 3SNXA 2K4DA 3FTUA 2ECJA 5BPPA 4XKCA 2ECTA 4XKBA 1PAQA 1W3BA 3APFA 2KC7A 4QF3A 4MS6A 4FJZA 1DNPA 3QZVA 3UUXA 1INZA 1JUQA 2IU1A 2X6IA 3RK6A 4KVMA 4S3OB 2ZETC 4UI9B 2K17A 2RSDA 3LQHA 3OXFA 2KU3A 4GNEA 1IQUA 1G25A 1FBVA 3EIQC 4JVSA 1LF8A 3MEKA 1WEEA 4GAAA 4I2WA 1N54A 3KAEA 3IHPA 4LRZA 3Q4AB 4YNDA 1HO8A 4R7EA 5LKTA 5CMYA 3ZPJA 2PNXA 3LY8A 3DQVR 1UN8A 2AW6A 2WXNA 2FBNA 3KQIA 2FF4A 4FLHA 4C9ZA 4BFRA 4YC9A 5C13A 3FTXA 1U3DA 2G6QA 2MOWA 2FULA 1WEQA 2LGKA 3TL5A 2JRJA 3D9OA 4WZ3B 3PUJA 1OWNA 1EPUA 2ECIA 4N3WA 4EQFA 4MVTA 2IF4A 3B13A 3D9NA 3L08A 3KNVA 5AJLA 3L11A 3MHSA 2BUGA 5FZSA 2LO6A 3JQ1A 5ARFA 4GNFA 2XQ0A 2H0DA 3MCXA 4A4CA 5FZRA 3PS6A 4P29A 4CA1A 1FP0A 3P1UA 3FUFA 2YQLA 5B77A 5AJDA 3QJZA 5BNWA 2RD0A 3LY7A 4WWPA 3APDA 3SHFA 2KATA 4IRUA 3ZIMA 5FERA 2X6FA 3PNLB 3SFZA 2LXPC 5B79A 1XWHA 3ZNIA 2L0TB 3ZGQA 2YQ8A 3O37A 4GB0A 1IQRA 2GW1A 4EZJA 3TG4A 3LKUA 4FP7A 3FUEA 3RO3A 3SF4A 4S3OC 4LLBA 2HM8A 4APFA 3O4ZA 3N9OA 3UQ3A 3CKBA 1ELKA 1JWGA 2KGIA 2Y4UA 4GU5A 3ZW3A 5G05J 2IONA 4XZ4A 4WZ0A 2Y3AA 3PDNA 3IBEA 4GZCA 3GZ1A 3D9IA 4F53A 5FB0A 2NXPA 5M72A 5A7DB 4UWFA 2XEVA 2QFCA 3FHEA 2GRMA 1FVFA 4EBAG 4PDXA 2F42A 5J3XA 1HF8A 1WESA 4YADA 3M63A 2MIQA 3Q5MA 3GZ2A 4N4FA 3ONLA 2WVIA 3CLJA 2GGFA 2VPDA 1VYXA 4OYSA 2XB1A 4UWKA 5KCMA 2D8SA 1UG3A 2X6KA 2CG2A 2XRYA 4ME2A 1MM2A 3EHMA 1DVPA 4A0CD 3HDXA 3LQJA 4F7AA 2MUMA 3SZ7A 3L1ZB 1E4UA 4J6IA 2CG3A 2K1JA 3SBTB 2I9CA 3FEYA 1BPOA 1WE9A 3MZLB 4J8FA 3ZHEA 3FP3A 5G55A 2FI7A 1IYGA 3T8MA 4NN2A 1TJCA 4B86C 2VSXE 4O64A 1X4IA 1ZU2A 1WIMA 3CIAA 2KWJA 2XPYA 3LYAA 2WXRA 1KLXA 4U0SA 4AOFA 3JUIA 3LPZA 4FULA 5KJLA 3QAQA 2ECGA 1ELWA 5G2NA 4U0ZA 1WEVA 2VSOE 3ASLA 4WNDA 3RKVA 1SZAA 3CSTA 3FU0A 4HS2A 3R7RA 4UP5A 4FC8A 4TKPB 4BTAA 3SGHA 4L7TA 2PM6A 3URZA 1NA3A 3RPGB 4NRHB 1HYIA 4WAFA 5EDSA 2I2OA 2YU4A 4BT8A 2VSNA 4JHRA 3FUHA 4CT4A 2J4DA 2ECNA 2EA6A 4ANVA 3CEQA 5BV1A 3IKOB 3NZUA 3G2SA 3QWWA 2XEUA 2AXVA 4FIPA 3EB6A 2YQMA 2CKLB 1E96B 2MRIA 2C0MA 4IC3A 3Q47B 4F3VA 2IOSA 2AXZA 4ANXA 2AN6A 2LSVA 2WXIA 2Y1NA 3HYMB 4Q94A 3U5PA 1ELRA 5DKAA 5KH9A 4ACLA 2V5FA 2M3HA 2JMIA 1HH8A 3RIBA 2OV8A 1WAO1 4I1OB 3QOUA 3RTRB 2LDRA 4QF2A 3EB5A 2WXKA 4B89A 2YREA 1SZ9A 2NC9A 4ANWA 3LVQE 1BORA 5H9MA 2LAIA 2CT2A 3UPVA 3ZYKA 3ML9A 2K16A 2KZTB 2VJFA 3CQGB 2XRZA 5BT1A 4IYPA 2C0LA 4XI1A 3OXLA 4RG6A 4HVBA 4V3KC 2UY1B 4N3AA 2YINA 4R2YA 1MQSA 3ZPVE 3ZYLA 4AIFA 4LERA 4HORA 2I1JA 3N9PA 3KEZA 1E8YA 4GCNA 4BBQA 4XIFA 5EKQD 3VLEA 3I4RB 4HOTA 3FUJA 2JLBA 3CVVA 3AS5A 5KH3A 2KWOA 4GA0A 2FSAA 1H2UA 3MKRA 4I1MA 3PHDA 1H19A 4CT0A 3V43A 1HG2A 2AVPA 2DX8A 3PUKA 3U5NA 3QKYA 4CDRA 4APOA 3PEUB 3D3MA 5A6CA 1U6GB 2J4BA 3I3NA 2YUCA 4Y6CA 5LOZA 4CGVA 3UMVA 3O36A 3FH8A 5BW8C 3DBSA 2L9BA 4C9BB 2CFZA 1NP7A 5T8IA 2VTBB 2BF0X 3LQIA 3CVQA 5FTPA 2WMOA 3T7LA 2ONDA 3R7QA 1HFAA 5FJYA 1PC2A 4B94A 2ZU6B 3ENEA 4U04A 2LGVA 5TRBA 3APCA 2KWNA 2CSYA 3JQ0A 2CKLA 4H7YA 2WXJA 3SI5A 1WEWA 4G25A 1E8XA 2YHOA 4AYCA 2WM9A 2CHWA 4A55A 2MT5A 3KV5A 2OVFA 3SOUA 4YBTA 3RU0A 5H1UA 1CHCA 4LUNU 3G2UA 2L80A 2V0PA 2DIWA 2MNZA 3FTYA 4B7YC 5LCWC 5JHAA 1WEOA 1X4JA 1E7UA 4P5OB 4WNEA 5JHBA 1RMDA 3G2VA 4GB9A 3LXUX 3GL6A 3FDHA 2EQXA 3ULQA 5FQ4A 5D1LB 4ABNA 4R7LA 4H7XA 4HOUA 1WILA 1EYHA 4PTBA 3K9IA 1F62A 3ZVZB 1X4UA 1WENA 5G04J 2X6JA 4DLQA 4JHKA 4FO9A 4WNFA 2UY1A 3TGOA 2LGGA 3ZFWA 2CHXA 3JYSA 4UI9J 4L1BA 2Y43A 4YABA 4Q6FA 4ZUXU 3NF1A 3PNTB 2JEKA 3ESKA 3U64A 3GW4A 4PPEA 4GZ3A 3AU4A 4CRWA 4DI3A 1UW4B 4RG9A 3CHMA 3Q15A 2BTDA 5T3RA 2I50A 5G05B 3MGBA 4A1GA 4CDNA 2VNFA 3CSFA 2DCPA 4X3GA 3S7BA 4YBMA 3T6RA 1HXIA 3VK6A 2LQ6A 2M85A 5B76A 2OOEA 2VJEB 2MNYA 3D9PA 4YAXA 3VLDA 3O35A 3FUKA 1JOCA 3FTVA 2LNIA 2WPVA 2VTBA 3PZDA 3IEGA 5J90A 3FU5A 4TV3A 4BY6A 3EHNA 3PRZA 2YHCA 1LDKC 2YHEA 5G04C 3ZYMA 2C2LA 4LCTA 2AXUA 3MX3A 4C0MA 2VSYA 1Z6UA 1Z3YA 2KWKA 2OVBA 3JCKC 5FZQA 3EIJA 4RSYA 4Q69A 4KVOA 5D0OD 5EX0A 2WXPA 2FO7A 3ZXSA 3N71A 2J09A 4NACA 5D1MB 2L5UA 4GPKA 3B7TA 2PL2A 3AU5A 5ANRA 5CMWA 3ZTGA 4MKTA 4HOQA 3O7AA 3LY9A 2C2VS 1U3CA 5CCLA 3QK0A 4JL0A 2JMJA 4JPSA 1VD4A 4GYWA 2ECWA 4KYOB 3KD7A 3U66A 3LEWA 4HFGA 3LRQA 3O34A 4I7BA 4EBAA 2HYED 1X5BA 3OTNA 2KE1A 4JXTA 4L2LA 2AWIA 2CFUA 2LN0A 2E0IA 1HZ4A 3CK9A 3FTZA 2VYIA 1OUVA 3MHHA 4D10C 2I6HA 5LKUA 4I7CA 4PUCA 5LX8A 2HR2A 2V8SE 4DI4A 2V4LA 4EZLA 2LXHC 3TAXA 5TBNA 3FUMA 5G05C 5ENNA 4FADA 4ILHB 4CCAA 4QFVA 3R9AB 2VP7A 3RO2A 2PUYA 1T1HA 3FH5A 4KZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHB A;  1LF8 A;  1WEE A;  4V3K C;  5LKX A;  2Y1M A;  2L0B A;  3IHP A;  2KR4 A;  4LAD B;  4R2Y A;  1Z2Q A;  3D9L A;  3ZYL A;  3ZPV E;  5B78 A;  4LK9 A;  4R7E A;  5LKT A;  5CMY A;  2PNX A;  3N9P A;  3LDZ A;  2MD7 B;  3DQV R;  2KGG A;  4BBQ A;  3KV6 A;  4Q96 A;  3KQI A;  4C9Z A;  4YC9 A;  4FLB A;  3D9J A;  4YAT A;  5C13 A;  5KH3 A;  1EDU A;  2IDA A;  2KWO A;  1IYM A;  2FSA A;  4AVX A;  2LRI C;  5TDW A;  3PHD A;  2G6Q A;  2KIZ A;  4A4B A;  2MOW A;  1WEQ A;  3V43 A;  2LGK A;  1HG2 A;  3N9Q A;  2KRE A;  2DX8 A;  2JRJ A;  3D9O A;  4WA6 A;  4WZ3 B;  3U5N A;  2G45 A;  1JM7 B;  5DIN A;  5TAB A;  2ECI A;  4N3W A;  1U6G B;  2VPG A;  2YUC A;  5LOZ A;  3U5O A;  2ECV A;  4MVT A;  4GZD A;  3D9N A;  3O36 A;  3KNV A;  2MA6 A;  3L11 A;  3MHS A;  3O33 A;  1MHQ A;  4L7X A;  2VJF B;  5G0F A;  2LO6 A;  2BF0 X;  3LQI A;  4GNF A;  2LGL A;  3M99 A;  5J08 A;  2H0D A;  3T7L A;  1HFA A;  2VPB A;  2BAY A;  3N9L A;  4A4C A;  5B75 A;  4GNG A;  1V87 A;  4CA1 A;  1FP0 A;  2E6R A;  2LGV A;  2MD8 C;  5TRB A;  5JG6 A;  2YQL A;  5B77 A;  4FK5 A;  2KWN A;  3D9M A;  2CSY A;  2EOD A;  4FJC A;  3I2D A;  1MM3 A;  5FEY A;  2CKL A;  5FER A;  5D1K B;  1WEW A;  1UJJ A;  3FL2 A;  1N87 A;  4IC2 A;  2YHO A;  4AYC A;  2LXP C;  5B79 A;  1XWH A;  3G2T A;  3ZNI A;  2L0T B;  5LP0 A;  3O37 A;  2YSM A;  2MA5 A;  4GB0 A;  2MT5 A;  3KV5 A;  5LCW B;  3SOU A;  4YBT A;  5H1U A;  1CHC A;  1WEU A;  3G2U A;  2L80 A;  2KM4 A;  4S3O C;  4LLB A;  2CSZ A;  4F52 B;  2DIW A;  2MNZ A;  2G43 A;  3N9O A;  1ELK A;  1JWG A;  4B7Y C;  2KGI A;  3O70 A;  3ZVY A;  2LV9 A;  1JWF A;  4ZDT A;  2EGP A;  1WEO A;  1X4J A;  1ZBD B;  4WZ0 A;  1WEM A;  2VJE A;  3N9N A;  4P5O B;  1RMD A;  3G2V A;  4GZC A;  3GL6 A;  3D9I A;  5D1L B;  4ZQL A;  2HDP A;  3RRU A;  5FB0 A;  4I7D A;  1WIL A;  2H0D B;  1EYH A;  4PTB A;  3GV4 A;  1F62 A;  3ZVZ B;  1X4U A;  1WEN A;  5I3L A;  5FB1 A;  1JPL A;  4FO9 A;  1HX8 A;  4R8P K;  2F42 A;  5J3X A;  1HF8 A;  2LGG A;  1WES A;  4YAD A;  3M63 A;  2MIQ A;  2Y43 A;  4YAB A;  4Q6F A;  4ZUX U;  5LKZ A;  1LDJ B;  3SOW A;  4AUQ B;  4N4F A;  1XGW A;  3G2W A;  4W4U A;  3ONL A;  3CLJ A;  4FU3 A;  4AYC B;  1HYJ A;  2VPD A;  4PPE A;  1VYX A;  2XB1 A;  2D8S A;  1K2F A;  1MM2 A;  3HCU A;  2F6N A;  1DVP A;  3U5M A;  4WZ2 A;  4A0C D;  3LQJ A;  2I50 A;  2MUM A;  5G05 B;  3L1Z B;  3DPL R;  1E4U A;  2YW8 A;  2VNF A;  2DCP A;  2K1J A;  5TDR A;  4X3G A;  1VDY A;  2QIZ A;  4YBM A;  1VFY A;  3HCS A;  3T6R A;  1WE9 A;  1JM7 A;  4L58 A;  3VK6 A;  5AIU A;  2LQ6 A;  2M85 A;  5B76 A;  1WFK A;  5KH7 A;  2VJE B;  2MNY A;  3D9P A;  4YAX A;  3O35 A;  3N9M A;  4NN2 A;  5G04 B;  4B86 C;  4YBS A;  4CCG X;  2KYU A;  3C5K A;  2YT5 A;  3ZYQ A;  1JOC A;  3PUR A;  4O64 A;  1X4I A;  2YUR A;  2FUI A;  1WIM A;  2KFT A;  2KWJ A;  5EYA F;  3SOX A;  4LKA A;  5B8D A;  3D9K A;  2RI7 A;  1LDK C;  2ECG A;  4A49 A;  4BHW A;  2UZG A;  3ONK A;  3ZYM A;  4V3L C;  2C2L A;  2FUU A;  2VPE A;  1WEV A;  3ASL A;  2E6S A;  1WGM A;  4LJN A;  1Z6U A;  2KWK A;  1SZA A;  4AP4 A;  4UP5 A;  3C6W A;  4TKP B;  3M62 A;  1WEP A;  3RPG B;  3L1X A;  1HYI A;  2YU4 A;  4NAC A;  2OXQ C;  5D1M B;  5AIT A;  2L5U A;  1PY1 A;  2ECN A;  2EA6 A;  3NG2 A;  4UP0 A;  2YSJ A;  2NAA A;  2L0I A;  5CMW A;  3G2S A;  3ZTG A;  2XEU A;  3O7A A;  1H0A A;  4FIP A;  2C2V S;  3EB6 A;  5C11 A;  2JMD A;  2JMJ A;  3RPG C;  2YQM A;  2CKL B;  2F6J A;  4IC3 A;  2M6M A;  5H1V A;  3HTK C;  3PUQ A;  1VD4 A;  2ECW A;  2AN6 A;  2M1R A;  3HCT A;  2QIC A;  2Y1N A;  4HFG A;  3LRQ A;  4I7B A;  2L43 A;  3O34 A;  4Q94 A;  2YHN A;  2HYE D;  1X5B A;  1HG5 A;  3ZPV 1;  3U5P A;  2KE1 A;  4JXT A;  5DKA A;  1Z60 A;  5KH9 A;  2QJ0 A;  4GND A;  2L75 A;  2LN0 A;  2M3H A;  2K4D A;  2ECJ A;  2JMI A;  3MHH A;  3RTR B;  2LDR A;  2ECT A;  4QF2 A;  3EB5 A;  5LKU A;  4I7C A;  2YRE A;  1SZ9 A;  4QF3 A;  3QZV A;  2V8S E;  1INZ A;  5H1T A;  2LXH C;  2QY7 A;  5TBN A;  1BOR A;  5H9M A;  4MSX A;  1JUQ A;  2CT2 A;  1UJK A;  4S3O B;  3ZYK A;  2ZET C;  2K16 A;  2VP7 A;  4UI9 B;  2K17 A;  2PUY A;  2YYR A;  2RSD A;  1T1H A;  3LQH A;  2VJF A;  2KU3 A;  4GNE A;  1G25 A;  4XI1 A;  1FBV A; 
#chains in the Genus database with same CATH topology
 3ZXP A;  3CQC B;  1OXJ A;  2RFA A;  4BTB A;  2Y1M A;  2V4H C;  2KR4 A;  2R5S A;  4LAD B;  3D9L A;  2PZI A;  4XI0 A;  4YVQ C;  1KT0 A;  4NUR A;  2RFM A;  2XGM A;  4N2S A;  4JA7 A;  5AQ7 A;  4E6H A;  3KV6 A;  4Q96 A;  2J08 A;  4DX2 A;  1DC2 A;  2DJA A;  3O48 A;  4UQZ A;  4DRX E;  5AEN A;  3ML8 A;  4CZ2 D;  1OWO A;  4KZ0 A;  2H6H A;  4YAT A;  2IDA A;  1IYM A;  3DPD A;  4AVX A;  3FU3 A;  2LRI C;  4GA1 A;  4A4B A;  5ENQ D;  2WXH A;  3QB2 A;  3CHP A;  5EIL A;  3S7F A;  5AYW D;  3AS4 A;  3PE3 A;  4GYO A;  4YDO A;  3E4B A;  3TJP A;  1JM7 B;  4HI9 A;  5TAB A;  1D8D A;  4N3B A;  5AQ9 A;  3I5P A;  2NSZ A;  2VPG A;  2PQN A;  3U5O A;  4GZD A;  2WXM A;  2R59 A;  4DLO A;  1HU3 A;  5T4Y A;  1Y6I A;  1QZ2 A;  4L2Y A;  4L7X A;  3QNK A;  1XNF A;  1MX2 A;  2LAH A;  4JW1 A;  4WUY A;  2GRL A;  2LGL A;  2P9S G;  4N5C A;  4JEU A;  3HXD A;  5J08 A;  3CVY A;  2WQ7 A;  3N9L A;  2BAY A;  3V2O A;  3B7R L;  4UWH A;  2MD8 C;  5JG6 A;  1WY6 A;  3U3W A;  4G1T A;  4QQI A;  4N3C A;  4FK5 A;  5KJM A;  3D9M A;  2EOD A;  4MRU A;  4O6F A;  3QWV A;  4FJC A;  2CHZ A;  2XEE A;  2Y1L E;  5AAO A;  5D1K B;  1LD8 A;  1H6O A;  1UJJ A;  3FL2 A;  5A23 A;  3DRA A;  2YSM A;  3KEA A;  4I6E A;  1BI8 B;  4HOS A;  5LCW B;  1V55 E;  1OCR E;  2WMN A;  4ANU A;  4ZFH A;  4GZ6 A;  2KM4 A;  2OEV A;  5SVI A;  4GYY A;  1TNU A;  1GW6 A;  4BT9 A;  3OAW A;  5CEA A;  2G43 A;  4FHK A;  4I17 A;  3ZVY A;  5JJ7 A;  1JWF A;  3QWP A;  4K03 A;  3OXG A;  2EIK E;  1Z3X A;  2KCV A;  2FEZ A;  1E90 A;  4URK A;  1MBM A;  4G26 A;  3N9N A;  2PQR A;  3GYZ A;  3U9W A;  2YNQ A;  3FM8 C;  1G3N B;  3CHO A;  2HDP A;  3FY4 A;  4B8C B;  4I1A A;  4ATG A;  3RRU A;  5CCM A;  4AM9 A;  3FUD A;  2RR4 A;  3CK8 A;  3FUN A;  2H0D B;  3B7S A;  1MYO A;  4C0E A;  1HX8 A;  4OVV A;  4R8P K;  3BG0 B;  4K0R A;  4LNB A;  3TWT A;  3C3O A;  3Q9U C;  3HVE B;  3ZU7 B;  5AQA A;  3FJU B;  5C2Y A;  2L6B A;  3ESL A;  2X38 A;  2ILR A;  2RG8 A;  5B3S E;  1XGW A;  4XI9 A;  5H7P A;  4V3I A;  3FEX A;  3IHV A;  4OGC A;  4W4U A;  4KMO A;  1HE8 A;  5DBK A;  1A5E A;  4EZK A;  4AV7 A;  4NQ0 A;  1HYJ A;  2JUN A;  2YVR A;  3IV0 A;  5KJN A;  3Q78 A;  3NQP A;  4KXK B;  2FD4 A;  3SBS A;  3RRN B;  3FFL A;  1E8Z A;  4FJY A;  3UT4 A;  5FIO A;  4G2V A;  3HCU A;  4A63 B;  2EIJ E;  3L22 A;  3FH7 A;  2DYS E;  4FA6 A;  1QNF A;  4IUL A;  2YW8 A;  2OWA A;  4WWO A;  4BES A;  2QIZ A;  1VFY A;  2D8U A;  3HCS A;  2VGX B;  1JM7 A;  2IOL A;  3L54 A;  2FO1 E;  4PH4 B;  5KH7 A;  3ASG A;  3MDB C;  2XEN A;  5G04 B;  3LS8 A;  2X3M A;  5K3Q A;  4U07 A;  4YBS A;  4CCG X;  2KYU A;  2YT5 A;  3TG5 A;  4KBQ A;  1S70 B;  1TEZ A;  1TN6 A;  2YUR A;  2FUI A;  2Y4T A;  2KFT A;  5E76 A;  5EYA F;  1A17 A;  3SOX A;  2FFW A;  4LKA A;  3L16 A;  4Y6W A;  4EPZ A;  3MKQ B;  3E30 A;  2A5U A;  1OCZ E;  2EXU A;  2RI7 A;  3MV2 B;  1H6K A;  2IY0 C;  1O1T A;  2UZG A;  3ONK A;  4V3L C;  2FUU A;  5FQ6 A;  3DEO A;  1D8E A;  3ASD A;  4AP4 A;  3L6A A;  2PNN A;  3M62 A;  3ISM C;  1N94 A;  3EHQ A;  5AIJ A;  3L1X A;  2KZT A;  4JZY A;  4OGE A;  3SUB A;  2ZXW E;  2OXQ C;  4G24 A;  5AIT A;  2WXG A;  1PY1 A;  3ZVV A;  5HRY A;  3RRM B;  4UP0 A;  3GZS A;  3PEV B;  2YSJ A;  2NAA A;  1NL4 A;  5HI7 A;  4N39 A;  2WQ6 A;  3L82 A;  1H0A A;  2VJ8 A;  1WDY A;  2HYZ A;  2JMD A;  2EIL E;  4GTV A;  2WXF A;  2KKX A;  4CEM A;  5KBA A;  2XGS A;  5ANL A;  4OAU C;  3PUQ A;  4GTT A;  3C98 A;  3FWV A;  3ZHE B;  4DK5 A;  2M1R A;  5FT9 A;  4AXH A;  1RW2 A;  3NOG D;  3PVL A;  2QIC A;  4L23 A;  4A3T A;  3CR3 A;  3QDN A;  3LJ3 A;  4G11 A;  4PS8 A;  3ZPV 1;  4BSZ B;  4CDM A;  1B89 A;  3B7U X;  2EGM A;  4GND A;  4I9C A;  4AY6 A;  1Y8M A;  3UX4 A;  4OAV B;  3PH0 C;  4Z0O A;  3TWR A;  3CHS A;  2M63 A;  3HIZ A;  4BWR A;  4NIK A;  1OCC E;  1IHG A;  1UN9 A;  4ILG A;  1OWM A;  4U63 A;  1FPP A;  3HVE A;  1N95 A;  5H1T A;  1N4R A;  3IHY A;  3L13 A;  2J8S D;  2QY7 A;  5LFA A;  4MSX A;  1UJK A;  3DXK G;  5HKP A;  2YYR A;  1H2T C;  3WXX A;  3CK7 A;  1U2V G;  4GTM A;  4FHJ A;  3RJV A;  5CBN A;  5D0Q D;  3SHB A;  2IFU A;  1N4Q A;  5LKX A;  4UQY A;  3S7J A;  2L0B A;  1O1S A;  3UT7 A;  1Z2Q A;  3MA5 A;  5B78 A;  4GZ5 A;  1TR4 A;  4LK9 A;  3LCA A;  3S7D A;  3C72 A;  4OVU A;  4UI9 C;  3LDZ A;  4AP2 A;  2MD7 B;  3JXJ A;  2Q7F A;  2J49 A;  2J9Q A;  2KGG A;  1H2V C;  3V30 A;  4I2Z A;  3ABL E;  4TUU A;  5ITZ F;  4PS3 A;  3CVU A;  5ENT D;  5FQ7 A;  2VGX A;  3LJN A;  1YA0 A;  4W9R A;  2E2E A;  4FLB A;  3D9J A;  1MX6 A;  2KCK A;  1E7V A;  1EDU A;  4IN3 B;  4G8L A;  5JJ6 A;  3U4T A;  5TDW A;  1WM5 A;  2KIZ A;  1N4S A;  3CHQ A;  4GA2 A;  2PM7 A;  2LXL A;  3N9Q A;  2KRE A;  4AY5 A;  2WB2 A;  1L5J A;  4WA6 A;  5KJK A;  2G45 A;  3CVX A;  3FU6 A;  5DIN A;  4CYM D;  1YYH A;  1TJF A;  3MKQ A;  3ASH A;  3VTX A;  3KS2 A;  3ZRH A;  2ECV A;  2XCB A;  1Q2Z A;  2MA6 A;  2LAU A;  3O33 A;  4DPR A;  1MHQ A;  4MLP A;  2VJF B;  5G0F A;  5HQ8 A;  3HXC A;  2WXQ A;  3M99 A;  5FWQ A;  3H7H A;  5EYP F;  2XPZ A;  3MYV A;  1NFI E;  4BEP A;  3PE4 A;  2VPB A;  5B75 A;  4BX9 A;  2UWJ G;  4JEH A;  4GNG A;  5ARG A;  1V87 A;  3Q73 A;  4WNG A;  2ETB A;  2E6R A;  4GMJ A;  4UQX A;  3SFY A;  3TXM A;  3QC1 A;  4DX5 D;  3HXB A;  2DZO A;  3FTS A;  2A4Z A;  2CRW A;  3I2D A;  1MM3 A;  4RQI A;  2VQ2 A;  4I6J A;  4TUM A;  5FEY A;  1O1R A;  1HS6 A;  4LEU A;  3ZN3 A;  3S2A A;  1QQE A;  5DIZ A;  1N87 A;  2I1K A;  4IC2 A;  2L6J A;  4A1S A;  2XPI A;  3DXM G;  3AJI A;  3G2T A;  5LP0 A;  3BQO A;  5C1D A;  2MA5 A;  4GTR A;  4I6G A;  2P9K G;  3SD5 A;  1WEU A;  2EIN E;  3UTM A;  2WQH A;  4M3O A;  1EF1 C;  2CSZ A;  3UT8 A;  4F52 B;  1MX4 A;  3Q49 B;  4BX8 A;  4JA9 A;  4U0U A;  3O70 A;  4GML A;  4JHJ A;  2LV9 A;  1S0P A;  4ZDT A;  1DCQ A;  2MHK A;  2EGP A;  4RVB A;  3UM2 A;  1ZBD B;  1WEM A;  2VJE A;  5FIN A;  1O5M A;  4HLL A;  4BSX A;  4ZQL A;  3MJW A;  4I7D A;  1SW6 A;  4J8S A;  1BLX B;  4HLE A;  3GV4 A;  3FUL A;  2R17 C;  3LVR E;  4I9E A;  4XE0 A;  4XX5 A;  1SQM A;  5I3L A;  5FB1 A;  1FT1 A;  1JPL A;  4HQD A;  3BG1 B;  1RZ4 A;  3BEE A;  3ZNG A;  3MV3 B;  3I4G A;  3CVN A;  3QAR A;  2BED A;  4B8A A;  5LKZ A;  1LDJ B;  4U8V D;  3AAA C;  3SOW A;  4AUQ B;  4U96 D;  2P9L G;  3G2W A;  4WWN A;  4N5Q A;  2QZA A;  3EDT B;  2BKK B;  4FU3 A;  4AYC B;  2IO3 C;  3BU8 A;  4UWL A;  4JB8 P;  2J07 A;  5JJT A;  5BUZ A;  4HXI A;  3Q1D A;  1K2F A;  3F6Q A;  2Y69 E;  2DBA A;  1OWP A;  4I43 A;  4YDW A;  5E75 A;  2F6N A;  3UKU G;  2WXL A;  1OWL A;  3U5M A;  2GRP B;  4WZ2 A;  3VTY A;  1ZBP A;  5FQ8 A;  3DPL R;  3CVP A;  1E8W A;  4TXR A;  5TDR A;  3CGH A;  4K5A B;  1ZB1 A;  2WXO A;  1VDY A;  3AG4 E;  3CV0 A;  4J0U A;  3FAN A;  4L58 A;  4JC8 A;  5AIU A;  4J8D A;  1QYM A;  5EIB E;  1WFK A;  2B0O E;  5CHE E;  4GCO A;  3T5X A;  3TXN A;  3FUI A;  3N9M A;  5KNH D;  2XGO A;  1TNO A;  3T5V A;  5EX3 A;  1FCH A;  3C5K A;  3ZYQ A;  2IQC A;  3PUR A;  3VLF A;  2P58 C;  4DJA A;  4YVO A;  1KT1 A;  1P5Q A;  4EEC A;  3L9T A;  3ZEF A;  2VGE A;  4F1S A;  5B8D A;  4TRQ A;  3D9K A;  2XS8 A;  4N2Q A;  2GRN B;  4A49 A;  4BHW A;  4B93 B;  2XCC A;  4A3V A;  3PRE A;  4E85 A;  5BV0 A;  2VPE A;  3RSE G;  2E6S A;  4J8E A;  1WGM A;  4LJN A;  4KT6 B;  4Z0R A;  3AS8 A;  2HO1 A;  2IQJ A;  1NA0 A;  3C6W A;  3C3Q A;  1N52 A;  1WEP A;  3CHR A;  4ILI A;  3L17 A;  3NZS A;  3NBN B;  4U95 D;  2VGY A;  1TNY A;  3SFX A;  4ACK A;  3CVL A;  4B0Z A;  2QC9 A;  2IJG X;  2HE0 A;  3NG2 A;  4AJW A;  2BKG A;  4U8H A;  1OCO E;  4QQ4 A;  2L0I A;  2LSU A;  2XHE A;  2ZGG A;  2KCL A;  5C11 A;  3RPG C;  4UWG A;  4H9D A;  4G23 A;  5LCW J;  3CKC A;  5EN5 D;  2F6J A;  2M6M A;  5H1V A;  3FTW A;  3HTK C;  3CVW A;  4PS7 A;  3DST A;  3EJN A;  1NZN A;  1FVH A;  4CGW A;  3P2B A;  4AEZ C;  3HCT A;  1LTX A;  3HHM A;  2L43 A;  2YHN A;  3ASF A;  2EIM E;  1HG5 A;  5JMN D;  3RAU A;  4HNA D;  3SO8 A;  4UI9 K;  1Z60 A;  2QJ0 A;  2X6H A;  2L75 A;  1Z6T A;  1OY3 D;  3SNX A;  3ASN E;  2K4D A;  3TWW A;  3FTU A;  3E32 A;  2ECJ A;  5BPP A;  4XKC A;  2IO2 C;  1QBQ A;  2V5Q C;  2ECT A;  4HB5 A;  4XKB A;  2LXM A;  1PAQ A;  3E37 A;  1W3B A;  3APF A;  2KC7 A;  4QF3 A;  4MS6 A;  4FJZ A;  1DNP A;  3QZV A;  3UUX A;  1INZ A;  1SA4 A;  4K5B A;  3V2X A;  1TN7 A;  1K1B A;  1JUQ A;  2IU1 A;  2X6I A;  5HS0 A;  3RK6 A;  3JUE A;  4KVM A;  4S3O B;  2ZET C;  4UI9 B;  1MJ0 A;  2K17 A;  2RSD A;  3LQH A;  3OXF A;  2KU3 A;  4GNE A;  1IQU A;  4Z68 A;  1G25 A;  1FBV A;  3EIQ C;  1YMP A;  4JVS A;  1LF8 A;  3TWV A;  3MEK A;  1WEE A;  4GAA A;  3W9G A;  4I2W A;  1N54 A;  3KAE A;  3IHP A;  4LRZ A;  3Q4A B;  2A5E A;  4YND A;  3DWD A;  1HO8 A;  1LD7 A;  4MBG A;  4R7E A;  5LKT A;  5CMY A;  5IY5 E;  3ZPJ A;  1K3Z D;  2PNX A;  3KDE C;  3LY8 A;  3DQV R;  1UN8 A;  2AW6 A;  4HI8 A;  1D9S A;  2WXN A;  2FBN A;  1WG0 A;  3KQI A;  2FF4 A;  1IHB A;  4FLH A;  2DZN A;  4C9Z A;  4BFR A;  4YC9 A;  4BET A;  4C48 B;  3LJU X;  5C13 A;  2XP0 A;  3FTX A;  4J7W A;  4O1P A;  2CON A;  1U3D A;  3EUV A;  2G6Q A;  2MOW A;  2FUL A;  1WEQ A;  3UKR G;  2LGK A;  3TL5 A;  2JRJ A;  3UI2 A;  3D9O A;  4WZ3 B;  3PUJ A;  3BUA A;  3E2D A;  2XZD G;  1OWN A;  1EPU A;  2E61 A;  2ECI A;  4N3W A;  4EQF A;  4GTP A;  4MVT A;  2IF4 A;  3B13 A;  1SVX A;  3SY2 A;  3D9N A;  3L08 A;  3KNV A;  5AJL A;  3L11 A;  3MHS A;  2BUG A;  5FZS A;  2LO6 A;  3JQ1 A;  3Q7A A;  5ARF A;  4GNF A;  1N0Q A;  2XQ0 A;  2H0D A;  3MCX A;  5KWD A;  4A4C A;  5AQB A;  5FZR A;  3PS6 A;  4O1O A;  4DUI A;  4P29 A;  4CA1 A;  1FP0 A;  3P1U A;  3M7K A;  3J5P A;  3FUF A;  2YQL A;  5B77 A;  5AJD A;  3QJZ A;  5BNW A;  4HRL A;  2RD0 A;  4DX1 A;  3LY7 A;  4WWP A;  3APD A;  3SHF A;  2KAT A;  4IRU A;  3ZIM A;  5FER A;  4DX6 D;  2X6F A;  2KXP C;  3PNL B;  3SFZ A;  5CER B;  3W9F A;  2LXP C;  4F1P A;  5B79 A;  1AWC B;  1XWH A;  3ZNI A;  2L0T B;  3ZGQ A;  2YQ8 A;  3KSL A;  3O37 A;  1S64 A;  4GB0 A;  1IQR A;  2GW1 A;  4EZJ A;  3TG4 A;  1TYQ G;  3LKU A;  4FP7 A;  3FUE A;  3RO3 A;  2P9U G;  1Z5S C;  3R9M A;  3SF4 A;  4S3O C;  4LLB A;  4YDY A;  2HM8 A;  4APF A;  2NYJ A;  2ZGD A;  3O4Z A;  3N9O A;  1TN8 A;  2CRR A;  1DCE A;  3UQ3 A;  3CKB A;  1ELK A;  1JWG A;  2KGI A;  5BXO A;  2Y4U A;  4GU5 A;  3ZW3 A;  5G05 J;  2ION A;  4XZ4 A;  4WZ0 A;  3TWU A;  2Y3A A;  3PDN A;  2F8X K;  3IBE A;  4GZC A;  3GZ1 A;  3D9I A;  4F53 A;  5FB0 A;  2NXP A;  3T8K A;  5M72 A;  5A7D B;  4UWF A;  2XEV A;  2QFC A;  3FHE A;  2GRM A;  1FVF A;  4EBA G;  4PDX A;  2F42 A;  5J3X A;  1HF8 A;  1WES A;  4J8Y A;  3M63 A;  2MIQ A;  4YAD A;  3Q5M A;  1SA5 A;  3GZ2 A;  4N4F A;  3ONL A;  3O47 A;  2WVI A;  3TWQ A;  3CLJ A;  1JCS A;  2GRO B;  5BXU A;  2GGF A;  2VPD A;  1VYX A;  4OYS A;  2XB1 A;  4U7E B;  4UWK A;  5KCM A;  2D8S A;  2R02 A;  1UG3 A;  1UOH A;  2X6K A;  3D9H A;  2CG2 A;  2XRY A;  4ME2 A;  1MM2 A;  3UXG A;  2Y0B G;  3EHM A;  4G8K A;  1DVP A;  5SVI B;  1BI7 B;  3B7B A;  3HXF A;  4A0C D;  3HDX A;  3LQJ A;  4F7A A;  2MUM A;  3SZ7 A;  3L1Z B;  1E4U A;  4J6I A;  2CG3 A;  2F0Y A;  2K1J A;  3DPY A;  3SBT B;  4L9P A;  2I9C A;  3FEY A;  1BPO A;  3PZ2 A;  1WE9 A;  3MZL B;  3NAW A;  5B1B E;  3DSW A;  4J8F A;  3ZHE A;  3FP3 A;  5G55 A;  3X2Q E;  2FI7 A;  1IYG A;  3T8M A;  5CRV A;  4NN2 A;  1TJC A;  4B86 C;  2VSX E;  1H6P A;  4O64 A;  1X4I A;  3ABM E;  4O62 A;  2KBX A;  1ZU2 A;  1WIM A;  3CIA A;  2KWJ A;  2XPY A;  3LYA A;  2XEH A;  2WXR A;  1KLX A;  4U0S A;  4AOF A;  1AP7 A;  3JUI A;  3LPZ A;  4FUL A;  5KJL A;  3QAQ A;  2ECG A;  1ELW A;  5G2N A;  1S63 A;  4LG6 A;  2ETA A;  2DWZ A;  4U0Z A;  1WEV A;  2VSO E;  3ASL A;  4WND A;  3RKV A;  1SZA A;  3CST A;  4ZHB A;  3FU0 A;  4HS2 A;  3R7R A;  4UP5 A;  4FC8 A;  4TKP B;  4BTA A;  3SGH A;  4L7T A;  3ASO E;  5SVX A;  2PM6 A;  3URZ A;  1NA3 A;  3RPG B;  4NRH B;  1HYI A;  4WAF A;  5EDS A;  2I2O A;  2YU4 A;  4BT8 A;  2VSN A;  4JHR A;  3FUH A;  4CT4 A;  2J4D A;  2ECN A;  2EA6 A;  4ANV A;  3CEQ A;  5BV1 A;  1V54 E;  3FEH A;  3IKO B;  3NZU A;  3G2S A;  3QWW A;  2XEU A;  2AXV A;  3FAO A;  5EID A;  4FIP A;  3EB6 A;  3Q75 A;  2YQM A;  2CKL B;  2XS1 A;  1E96 B;  2MRI A;  2C0M A;  4IC3 A;  3Q47 B;  4F3V A;  2QYU A;  1FT2 A;  2IOS A;  2AXZ A;  4ANX A;  2AN6 A;  2LSV A;  4LNG A;  2MYO A;  2WXI A;  2Y1N A;  3HYM B;  1YCS B;  3Q9N C;  4Q94 A;  2XOZ A;  3U5P A;  1ELR A;  5DKA A;  3ABK E;  5KH9 A;  4ACL A;  4BER A;  2V5F A;  2M3H A;  1NI1 A;  1KZP A;  2JMI A;  1HH8 A;  3RIB A;  4GTQ A;  4I1O B;  1WAO 1;  2OV8 A;  3QOU A;  3RTR B;  2ETC A;  2LDR A;  4QF2 A;  3EB5 A;  2WXK A;  4B89 A;  2YRE A;  3DDT A;  1SZ9 A;  2NC9 A;  4HRM B;  4ANW A;  3HXE A;  3LVQ E;  4RLY A;  3Q79 A;  1BOR A;  5H9M A;  2LAI A;  2CT2 A;  3T9K A;  3UPV A;  3ZYK A;  3ML9 A;  5JA4 D;  2K16 A;  5SVY A;  3KSQ A;  2KZT B;  2VJF A;  3CQG B;  3AG3 E;  2XRZ A;  5BT1 A;  2GRQ B;  2H6I A;  2C0L A;  4IYP A;  5CEC B;  3OXL A;  4XI1 A;  3UM3 A;  4RG6 A;  2ZIS A;  4HVB A;  4V3K C;  2UY1 B;  4N3A A;  2YIN A;  3PLW A;  4HRN A;  3NOC D;  4R2Y A;  1MQS A;  3ZPV E;  3ZYL A;  2XOC A;  4AIF A;  2ZIR A;  4LER A;  4HOR A;  5EYL A;  5AAR A;  3E33 A;  2I1J A;  3N9P A;  5ENR D;  1N4P A;  3KEZ A;  2JM3 A;  1E8Y A;  2DSM A;  4GCN A;  4BBQ A;  4XIF A;  5EKQ D;  3VLE A;  3I4R B;  4HOT A;  2AJA A;  3UM1 A;  4K5C A;  2H6G A;  3Q7F A;  3FUJ A;  2JLB A;  3EHR A;  2L7P A;  3CVV A;  3AS5 A;  5KH3 A;  2CSV A;  2KWO A;  4GA0 A;  2FSA A;  1H2U A;  3MKR A;  4I1M A;  3PHD A;  1H19 A;  4GPM A;  2P9I G;  2OCC E;  1BD8 A;  4CT0 A;  3V43 A;  1HG2 A;  2AVP A;  1OT8 A;  2DX8 A;  3PUK A;  3U5N A;  3QKY A;  4CDR A;  4APO A;  3PEU B;  3D3M A;  5CRU A;  5A6C A;  1U6G B;  2J4B A;  3I3N A;  2YUC A;  4EHM A;  4Y6C A;  5LOZ A;  4CGV A;  2MKE A;  3UMV A;  3O36 A;  3FH8 A;  5BW8 C;  4UUC A;  3DBS A;  2L9B A;  4C9B B;  2CFZ A;  1NP7 A;  4DX7 D;  5T8I A;  2VTB B;  2BF0 X;  3IXE A;  3NB2 A;  4GTO A;  3WG7 E;  2XOY A;  3LQI A;  3CVQ A;  5FTP A;  2WMO A;  3T7L A;  4XEI G;  2OND A;  3R7Q A;  1HFA A;  5ENO D;  2B6C A;  3PZ4 A;  5FJY A;  1PC2 A;  4B94 A;  2ZU6 B;  3ENE A;  4U04 A;  2LGV A;  5TRB A;  2H6F A;  3APC A;  2KWN A;  2CSY A;  3JQ0 A;  2LUH A;  3JXI A;  2R05 A;  2CKL A;  4H7Y A;  1JCQ A;  2WXJ A;  3SI5 A;  1WEW A;  4G25 A;  3EU5 A;  3UIO C;  1E8X A;  3AG1 E;  2YHO A;  4AYC A;  2WM9 A;  4GMR A;  2CHW A;  5D2M C;  4A55 A;  2MT5 A;  3KV5 A;  2OVF A;  3SOU A;  4YBT A;  3RU0 A;  5H1U A;  3HRA A;  1CHC A;  4LUN U;  3SQV A;  3G2U A;  2L80 A;  2V0P A;  1TNB A;  2OEW A;  2DIW A;  2MNZ A;  5ENS D;  3FTY A;  4B7Y C;  3C3R A;  5LCW C;  5JHA A;  1WEO A;  2R2L A;  1X4J A;  1E7U A;  4P5O B;  4WNE A;  5JHB A;  1RMD A;  4YDE A;  4GB9 A;  2DYR E;  3G2V A;  3LXU X;  3GL6 A;  3FDH A;  2EQX A;  3ULQ A;  5FQ4 A;  5D1L B;  4ATZ D;  4R7L A;  4H7X A;  4ABN A;  3ULE G;  4HOU A;  4O60 A;  1WIL A;  5CBO A;  1EYH A;  4PTB A;  3K9I A;  1F62 A;  3ZVZ B;  1X4U A;  1WEN A;  5G04 J;  2X6J A;  4DLQ A;  4JHK A;  4FO9 A;  4WNF A;  2UY1 A;  4LNU D;  3TGO A;  2LGG A;  3ZFW A;  2CHX A;  3JYS A;  4UI9 J;  4L1B A;  4F6R D;  2IEJ A;  2Y43 A;  4YAB A;  4Q6F A;  1N9A A;  4ZUX U;  3NF1 A;  3PNT B;  2JEK A;  3LDY A;  3UIP C;  3ESK A;  3U64 A;  4X8Q A;  3GW4 A;  1MZC A;  4JD2 G;  4PPE A;  3DEP A;  4GZ3 A;  3AU4 A;  4CRW A;  4DI3 A;  5CED B;  1UW4 B;  4RG9 A;  3CHM A;  2DVW A;  3Q15 A;  2BTD A;  5T3R A;  3ZKJ A;  2I50 A;  5G05 B;  3MGB A;  4A1G A;  3J5Q B;  4CDN A;  2VNF A;  3CSF A;  1IKN D;  2DCP A;  4X3G A;  3S7B A;  5KNG A;  4YBM A;  3T6R A;  3V31 A;  2JAB A;  1HXI A;  3TWX A;  3VK6 A;  2LQ6 A;  2M85 A;  5B76 A;  2OOE A;  5B1A E;  2VJE B;  2MNY A;  3D9P A;  4YAX A;  4GTS A;  3VLD A;  3O35 A;  3DSS A;  3AG2 E;  4TXP A;  5AN8 A;  3FUK A;  1N0R A;  5D66 A;  2P9N G;  1JOC A;  5ENP D;  3HG0 D;  3FTV A;  2LNI A;  2WPV A;  2VTB A;  3E34 A;  3PZD A;  3IEG A;  5J90 A;  3FU5 A;  2QYJ A;  2GRR B;  4TV3 A;  4BY6 A;  3EHN A;  3PRZ A;  2YHC A;  3UIN C;  1LDK C;  1TNZ A;  2YHE A;  5G04 C;  3ZYM A;  2C2L A;  4LCT A;  2AXU A;  3MX3 A;  3TWS A;  4C0M A;  3B95 A;  2VSY A;  1Z6U A;  1Z3Y A;  2KWK A;  2OVB A;  3JCK C;  5FZQ A;  3EIJ A;  4U8Y D;  4RSY A;  4Q69 A;  4KVO A;  2P2C P;  5D0O D;  3DSU A;  5EX0 A;  2WXP A;  2FO7 A;  3PZ1 A;  3ZXS A;  3N71 A;  2J09 A;  4NAC A;  4HBD A;  5D1M B;  2L5U A;  4GPK A;  3B7T A;  2PL2 A;  3AU5 A;  3ZUV B;  5ANR A;  5CMW A;  3ZTG A;  4MKT A;  4HOQ A;  3O7A A;  1IXV A;  3LY9 A;  2C2V S;  1U3C A;  5CCL A;  3QK0 A;  2P9P G;  4JL0 A;  2JMJ A;  2F37 A;  4JPS A;  1VD4 A;  4GYW A;  3PZ3 A;  2ECW A;  3DWL G;  3DSX A;  4KYO B;  3UM0 A;  3KD7 A;  3U66 A;  3LEW A;  4HFG A;  3LRQ A;  2XZT G;  3O34 A;  4I7B A;  1K8K G;  4EBA A;  2HYE D;  1X5B A;  4TXQ A;  3V79 K;  2RKK A;  3OTN A;  2KE1 A;  4JXT A;  4L2L A;  2AWI A;  1KZO A;  2CFU A;  2LN0 A;  2E0I A;  1HZ4 A;  3CK9 A;  3FTZ A;  3DSV A;  2VYI A;  4M7C A;  1OUV A;  3MHH A;  4D10 C;  2F8Y A;  2I6H A;  5LKU A;  4I7C A;  2R03 A;  4PUC A;  3EU9 A;  5LX8 A;  2HR2 A;  2V8S E;  2KKY A;  4DI4 A;  1N11 A;  2V4L A;  4EZL A;  3C5R A;  2LXH C;  4LSZ E;  3TAX A;  5TBN A;  3FUM A;  5G05 C;  5ENN A;  4FAD A;  1K1A A;  4ILH B;  1JCR A;  4CCA A;  4QFV A;  3R9A B;  2VP7 A;  3RO2 A;  2PUY A;  1X81 A;  3ULY A;  1T1H A;  2P57 A;  1BU9 A;  3FH5 A;  4KZC A;  2M13 A;  1KPS B; 
#chains in the Genus database with same CATH homology
 3CQC B;  4BTB A;  2Y1M A;  2KR4 A;  2R5S A;  4LAD B;  3D9L A;  2PZI A;  4XI0 A;  4YVQ C;  1KT0 A;  4NUR A;  2XGM A;  4N2S A;  4JA7 A;  4E6H A;  3KV6 A;  4Q96 A;  2J08 A;  3O48 A;  4UQZ A;  5AEN A;  3ML8 A;  1OWO A;  4KZ0 A;  4YAT A;  2IDA A;  1IYM A;  3DPD A;  4AVX A;  3FU3 A;  2LRI C;  4GA1 A;  4A4B A;  2WXH A;  3QB2 A;  3CHP A;  3S7F A;  5AYW D;  3AS4 A;  3PE3 A;  4GYO A;  3E4B A;  3TJP A;  1JM7 B;  5TAB A;  4N3B A;  3I5P A;  2NSZ A;  2VPG A;  2PQN A;  3U5O A;  4GZD A;  2WXM A;  2R59 A;  4DLO A;  1HU3 A;  5T4Y A;  1Y6I A;  1QZ2 A;  4L2Y A;  4L7X A;  3QNK A;  1XNF A;  2LAH A;  4JW1 A;  4WUY A;  2GRL A;  2LGL A;  4N5C A;  4JEU A;  5J08 A;  3CVY A;  2WQ7 A;  3N9L A;  2BAY A;  3B7R L;  4UWH A;  2MD8 C;  5JG6 A;  1WY6 A;  3U3W A;  4G1T A;  4N3C A;  4FK5 A;  5KJM A;  3D9M A;  2EOD A;  4MRU A;  4O6F A;  3QWV A;  4FJC A;  2CHZ A;  5D1K B;  1UJJ A;  3FL2 A;  5A23 A;  2YSM A;  4I6E A;  4HOS A;  5LCW B;  2WMN A;  4ANU A;  4GZ6 A;  2KM4 A;  4GYY A;  1GW6 A;  4BT9 A;  3OAW A;  2G43 A;  4FHK A;  4I17 A;  3ZVY A;  5JJ7 A;  1JWF A;  3QWP A;  4K03 A;  3OXG A;  1Z3X A;  2KCV A;  2FEZ A;  1E90 A;  4URK A;  4G26 A;  3N9N A;  2PQR A;  3GYZ A;  3U9W A;  2YNQ A;  3CHO A;  2HDP A;  3FY4 A;  4B8C B;  4I1A A;  3RRU A;  4ATG A;  5CCM A;  4AM9 A;  3FUD A;  3CK8 A;  3FUN A;  2H0D B;  3B7S A;  4C0E A;  1HX8 A;  4OVV A;  4R8P K;  3BG0 B;  4K0R A;  3HVE B;  5C2Y A;  3ESL A;  2X38 A;  2ILR A;  2RG8 A;  1XGW A;  4XI9 A;  4V3I A;  3FEX A;  3IHV A;  4W4U A;  4KMO A;  1HE8 A;  5DBK A;  4EZK A;  4AV7 A;  4NQ0 A;  1HYJ A;  3IV0 A;  5KJN A;  3NQP A;  4KXK B;  3SBS A;  3RRN B;  3FFL A;  1E8Z A;  4FJY A;  3UT4 A;  4G2V A;  3HCU A;  3L22 A;  3FH7 A;  4FA6 A;  1QNF A;  4IUL A;  2YW8 A;  4WWO A;  2QIZ A;  1VFY A;  3HCS A;  2VGX B;  1JM7 A;  2IOL A;  3L54 A;  4PH4 B;  5KH7 A;  3ASG A;  5G04 B;  3LS8 A;  2X3M A;  4U07 A;  4YBS A;  4CCG X;  2KYU A;  2YT5 A;  4KBQ A;  3TG5 A;  1TEZ A;  2YUR A;  2FUI A;  2Y4T A;  2KFT A;  5E76 A;  5EYA F;  1A17 A;  3SOX A;  4LKA A;  3L16 A;  4Y6W A;  4EPZ A;  3MKQ B;  2A5U A;  2RI7 A;  3MV2 B;  1H6K A;  2UZG A;  4V3L C;  3ONK A;  2FUU A;  5FQ6 A;  3ASD A;  4AP4 A;  3L6A A;  3M62 A;  5AIJ A;  3L1X A;  2KZT A;  4JZY A;  2OXQ C;  4G24 A;  5AIT A;  2WXG A;  1PY1 A;  3ZVV A;  3RRM B;  4UP0 A;  3GZS A;  3PEV B;  2YSJ A;  2NAA A;  5HI7 A;  4N39 A;  2WQ6 A;  1H0A A;  2VJ8 A;  2HYZ A;  2JMD A;  2WXF A;  4CEM A;  2XGS A;  5ANL A;  3PUQ A;  3C98 A;  3FWV A;  3ZHE B;  4DK5 A;  2M1R A;  5FT9 A;  4AXH A;  3PVL A;  2QIC A;  4L23 A;  4A3T A;  3CR3 A;  3QDN A;  3LJ3 A;  4G11 A;  4PS8 A;  3ZPV 1;  4CDM A;  1B89 A;  3B7U X;  4GND A;  4I9C A;  4AY6 A;  1Y8M A;  3UX4 A;  3PH0 C;  3CHS A;  2M63 A;  3HIZ A;  4BWR A;  1IHG A;  1UN9 A;  4ILG A;  1OWM A;  4U63 A;  3HVE A;  5H1T A;  3IHY A;  3L13 A;  2QY7 A;  5LFA A;  4MSX A;  1UJK A;  2YYR A;  1H2T C;  3WXX A;  3CK7 A;  4FHJ A;  3RJV A;  5D0Q D;  3SHB A;  2IFU A;  5LKX A;  4UQY A;  3S7J A;  2L0B A;  3UT7 A;  1Z2Q A;  3MA5 A;  5B78 A;  4GZ5 A;  4LK9 A;  3LCA A;  3S7D A;  4OVU A;  4UI9 C;  3LDZ A;  4AP2 A;  2MD7 B;  2Q7F A;  2J49 A;  2J9Q A;  2KGG A;  1H2V C;  4I2Z A;  4TUU A;  4PS3 A;  3CVU A;  5FQ7 A;  2VGX A;  1YA0 A;  4W9R A;  2E2E A;  4FLB A;  3D9J A;  2KCK A;  1E7V A;  1EDU A;  4IN3 B;  5JJ6 A;  3U4T A;  5TDW A;  1WM5 A;  2KIZ A;  3CHQ A;  4GA2 A;  2PM7 A;  3N9Q A;  2KRE A;  4AY5 A;  2WB2 A;  1L5J A;  4WA6 A;  5KJK A;  2G45 A;  3CVX A;  3FU6 A;  5DIN A;  1TJF A;  3MKQ A;  3ASH A;  3VTX A;  3KS2 A;  3ZRH A;  2ECV A;  2XCB A;  2MA6 A;  3O33 A;  4DPR A;  1MHQ A;  4MLP A;  2VJF B;  5G0F A;  5HQ8 A;  2WXQ A;  3M99 A;  5FWQ A;  2XPZ A;  3MYV A;  3PE4 A;  2VPB A;  5B75 A;  4BX9 A;  2UWJ G;  4JEH A;  4GNG A;  5ARG A;  1V87 A;  4WNG A;  2E6R A;  4GMJ A;  4UQX A;  3TXM A;  3QC1 A;  3FTS A;  2A4Z A;  3I2D A;  1MM3 A;  2VQ2 A;  4I6J A;  5FEY A;  1HS6 A;  4LEU A;  3ZN3 A;  3S2A A;  1QQE A;  5DIZ A;  1N87 A;  2I1K A;  4IC2 A;  2L6J A;  4A1S A;  2XPI A;  3G2T A;  5LP0 A;  5C1D A;  2MA5 A;  4I6G A;  3SD5 A;  1WEU A;  2WQH A;  4M3O A;  1EF1 C;  2CSZ A;  3UT8 A;  4F52 B;  3Q49 B;  4BX8 A;  4JA9 A;  4U0U A;  3O70 A;  4GML A;  4JHJ A;  2LV9 A;  1S0P A;  4ZDT A;  2MHK A;  2EGP A;  4RVB A;  1ZBD B;  1WEM A;  2VJE A;  4BSX A;  4ZQL A;  3MJW A;  4I7D A;  4J8S A;  4HLE A;  3GV4 A;  3FUL A;  2R17 C;  3LVR E;  4I9E A;  4XE0 A;  4XX5 A;  1SQM A;  5I3L A;  5FB1 A;  1JPL A;  3BG1 B;  3BEE A;  3MV3 B;  3I4G A;  3CVN A;  3QAR A;  4B8A A;  5LKZ A;  1LDJ B;  3SOW A;  4AUQ B;  4WWN A;  3G2W A;  3EDT B;  4FU3 A;  4AYC B;  4UWL A;  2J07 A;  5JJT A;  5BUZ A;  4HXI A;  1K2F A;  2DBA A;  1OWP A;  4I43 A;  5E75 A;  2F6N A;  2WXL A;  1OWL A;  3U5M A;  4WZ2 A;  3VTY A;  1ZBP A;  5FQ8 A;  3DPL R;  3CVP A;  1E8W A;  5TDR A;  3CGH A;  2WXO A;  1VDY A;  3CV0 A;  4J0U A;  4L58 A;  4JC8 A;  5AIU A;  4J8D A;  1WFK A;  5CHE E;  4GCO A;  3T5X A;  3TXN A;  3FUI A;  3N9M A;  2XGO A;  3T5V A;  5EX3 A;  1FCH A;  3C5K A;  3ZYQ A;  2IQC A;  3PUR A;  3VLF A;  2P58 C;  4DJA A;  4YVO A;  1KT1 A;  1P5Q A;  4EEC A;  3ZEF A;  4F1S A;  5B8D A;  4TRQ A;  3D9K A;  4N2Q A;  4A49 A;  4BHW A;  2XCC A;  3PRE A;  4A3V A;  4E85 A;  5BV0 A;  2VPE A;  2E6S A;  4J8E A;  1WGM A;  4LJN A;  4KT6 B;  3AS8 A;  2HO1 A;  1NA0 A;  3C6W A;  1N52 A;  1WEP A;  3CHR A;  4ILI A;  3L17 A;  3NZS A;  2VGY A;  4ACK A;  3CVL A;  4B0Z A;  2IJG X;  3NG2 A;  4AJW A;  4U8H A;  2L0I A;  2LSU A;  2XHE A;  2KCL A;  5C11 A;  3RPG C;  4UWG A;  4G23 A;  5LCW J;  3CKC A;  2F6J A;  2M6M A;  5H1V A;  3FTW A;  3HTK C;  3CVW A;  4PS7 A;  3EJN A;  1NZN A;  1FVH A;  4CGW A;  3P2B A;  4AEZ C;  3HCT A;  3HHM A;  2L43 A;  2YHN A;  3ASF A;  1HG5 A;  4UI9 K;  1Z60 A;  2QJ0 A;  2X6H A;  2L75 A;  1Z6T A;  3SNX A;  2K4D A;  3FTU A;  2ECJ A;  5BPP A;  4XKC A;  2ECT A;  4XKB A;  1PAQ A;  1W3B A;  3APF A;  2KC7 A;  4QF3 A;  4MS6 A;  4FJZ A;  1DNP A;  3QZV A;  3UUX A;  1INZ A;  1JUQ A;  2IU1 A;  2X6I A;  3RK6 A;  4KVM A;  4S3O B;  2ZET C;  4UI9 B;  2K17 A;  2RSD A;  3LQH A;  3OXF A;  2KU3 A;  4GNE A;  1IQU A;  1G25 A;  1FBV A;  3EIQ C;  4JVS A;  1LF8 A;  3MEK A;  1WEE A;  4GAA A;  4I2W A;  1N54 A;  3KAE A;  3IHP A;  4LRZ A;  3Q4A B;  4YND A;  1HO8 A;  4R7E A;  5LKT A;  5CMY A;  3ZPJ A;  2PNX A;  3LY8 A;  3DQV R;  1UN8 A;  2AW6 A;  2WXN A;  2FBN A;  3KQI A;  2FF4 A;  4FLH A;  4C9Z A;  4BFR A;  4YC9 A;  5C13 A;  3FTX A;  1U3D A;  2G6Q A;  2MOW A;  2FUL A;  1WEQ A;  2LGK A;  3TL5 A;  2JRJ A;  3D9O A;  4WZ3 B;  3PUJ A;  1OWN A;  1EPU A;  2ECI A;  4N3W A;  4EQF A;  4MVT A;  2IF4 A;  3B13 A;  3D9N A;  3L08 A;  3KNV A;  5AJL A;  3L11 A;  3MHS A;  2BUG A;  5FZS A;  2LO6 A;  3JQ1 A;  5ARF A;  4GNF A;  2XQ0 A;  2H0D A;  3MCX A;  4A4C A;  5FZR A;  3PS6 A;  4P29 A;  4CA1 A;  1FP0 A;  3P1U A;  3FUF A;  2YQL A;  5B77 A;  5AJD A;  3QJZ A;  5BNW A;  2RD0 A;  3LY7 A;  4WWP A;  3APD A;  3SHF A;  2KAT A;  4IRU A;  3ZIM A;  5FER A;  2X6F A;  3PNL B;  3SFZ A;  2LXP C;  5B79 A;  1XWH A;  3ZNI A;  2L0T B;  3ZGQ A;  2YQ8 A;  3O37 A;  4GB0 A;  1IQR A;  2GW1 A;  4EZJ A;  3TG4 A;  3LKU A;  4FP7 A;  3FUE A;  3RO3 A;  3SF4 A;  4S3O C;  4LLB A;  2HM8 A;  4APF A;  3O4Z A;  3N9O A;  3UQ3 A;  3CKB A;  1ELK A;  1JWG A;  2KGI A;  2Y4U A;  4GU5 A;  3ZW3 A;  5G05 J;  2ION A;  4XZ4 A;  4WZ0 A;  2Y3A A;  3PDN A;  3IBE A;  4GZC A;  3GZ1 A;  3D9I A;  4F53 A;  5FB0 A;  2NXP A;  5M72 A;  5A7D B;  4UWF A;  2XEV A;  2QFC A;  3FHE A;  2GRM A;  1FVF A;  4EBA G;  4PDX A;  2F42 A;  5J3X A;  1HF8 A;  1WES A;  4YAD A;  3M63 A;  2MIQ A;  3Q5M A;  3GZ2 A;  4N4F A;  3ONL A;  2WVI A;  3CLJ A;  2GGF A;  2VPD A;  1VYX A;  4OYS A;  2XB1 A;  4UWK A;  5KCM A;  2D8S A;  1UG3 A;  2X6K A;  2CG2 A;  2XRY A;  4ME2 A;  1MM2 A;  3EHM A;  1DVP A;  4A0C D;  3HDX A;  3LQJ A;  4F7A A;  2MUM A;  3SZ7 A;  3L1Z B;  1E4U A;  4J6I A;  2CG3 A;  2K1J A;  3SBT B;  2I9C A;  3FEY A;  1BPO A;  1WE9 A;  3MZL B;  4J8F A;  3ZHE A;  3FP3 A;  5G55 A;  2FI7 A;  1IYG A;  3T8M A;  4NN2 A;  1TJC A;  4B86 C;  2VSX E;  4O64 A;  1X4I A;  1ZU2 A;  1WIM A;  3CIA A;  2KWJ A;  2XPY A;  3LYA A;  2WXR A;  1KLX A;  4U0S A;  4AOF A;  3JUI A;  3LPZ A;  4FUL A;  5KJL A;  3QAQ A;  2ECG A;  1ELW A;  5G2N A;  4U0Z A;  1WEV A;  2VSO E;  3ASL A;  4WND A;  3RKV A;  1SZA A;  3CST A;  3FU0 A;  4HS2 A;  3R7R A;  4UP5 A;  4FC8 A;  4TKP B;  4BTA A;  3SGH A;  4L7T A;  2PM6 A;  3URZ A;  1NA3 A;  3RPG B;  4NRH B;  1HYI A;  4WAF A;  5EDS A;  2I2O A;  2YU4 A;  4BT8 A;  2VSN A;  4JHR A;  3FUH A;  4CT4 A;  2J4D A;  2ECN A;  2EA6 A;  4ANV A;  3CEQ A;  5BV1 A;  3IKO B;  3NZU A;  3G2S A;  3QWW A;  2XEU A;  2AXV A;  4FIP A;  3EB6 A;  2YQM A;  2CKL B;  1E96 B;  2MRI A;  2C0M A;  4IC3 A;  3Q47 B;  4F3V A;  2IOS A;  2AXZ A;  4ANX A;  2AN6 A;  2LSV A;  2WXI A;  2Y1N A;  3HYM B;  4Q94 A;  3U5P A;  1ELR A;  5DKA A;  5KH9 A;  4ACL A;  2V5F A;  2M3H A;  2JMI A;  1HH8 A;  3RIB A;  2OV8 A;  1WAO 1;  4I1O B;  3QOU A;  3RTR B;  2LDR A;  4QF2 A;  3EB5 A;  2WXK A;  4B89 A;  2YRE A;  1SZ9 A;  2NC9 A;  4ANW A;  3LVQ E;  1BOR A;  5H9M A;  2LAI A;  2CT2 A;  3UPV A;  3ZYK A;  3ML9 A;  2K16 A;  2KZT B;  2VJF A;  3CQG B;  2XRZ A;  5BT1 A;  4IYP A;  2C0L A;  4XI1 A;  3OXL A;  4RG6 A;  4HVB A;  4V3K C;  2UY1 B;  4N3A A;  2YIN A;  4R2Y A;  1MQS A;  3ZPV E;  3ZYL A;  4AIF A;  4LER A;  4HOR A;  2I1J A;  3N9P A;  3KEZ A;  1E8Y A;  4GCN A;  4BBQ A;  4XIF A;  5EKQ D;  3VLE A;  3I4R B;  4HOT A;  3FUJ A;  2JLB A;  3CVV A;  3AS5 A;  5KH3 A;  2KWO A;  4GA0 A;  2FSA A;  1H2U A;  3MKR A;  4I1M A;  3PHD A;  1H19 A;  4CT0 A;  3V43 A;  1HG2 A;  2AVP A;  2DX8 A;  3PUK A;  3U5N A;  3QKY A;  4CDR A;  4APO A;  3PEU B;  3D3M A;  5A6C A;  1U6G B;  2J4B A;  3I3N A;  2YUC A;  4Y6C A;  5LOZ A;  4CGV A;  3UMV A;  3O36 A;  3FH8 A;  5BW8 C;  3DBS A;  2L9B A;  4C9B B;  2CFZ A;  1NP7 A;  5T8I A;  2VTB B;  2BF0 X;  3LQI A;  3CVQ A;  5FTP A;  2WMO A;  3T7L A;  2OND A;  3R7Q A;  1HFA A;  5FJY A;  1PC2 A;  4B94 A;  2ZU6 B;  3ENE A;  4U04 A;  2LGV A;  5TRB A;  3APC A;  2KWN A;  2CSY A;  3JQ0 A;  2CKL A;  4H7Y A;  2WXJ A;  3SI5 A;  1WEW A;  4G25 A;  1E8X A;  2YHO A;  4AYC A;  2WM9 A;  2CHW A;  4A55 A;  2MT5 A;  3KV5 A;  2OVF A;  3SOU A;  4YBT A;  3RU0 A;  5H1U A;  1CHC A;  4LUN U;  3G2U A;  2L80 A;  2V0P A;  2DIW A;  2MNZ A;  3FTY A;  4B7Y C;  5LCW C;  5JHA A;  1WEO A;  1X4J A;  1E7U A;  4P5O B;  4WNE A;  5JHB A;  1RMD A;  3G2V A;  4GB9 A;  3LXU X;  3GL6 A;  3FDH A;  2EQX A;  3ULQ A;  5FQ4 A;  5D1L B;  4ABN A;  4R7L A;  4H7X A;  4HOU A;  1WIL A;  1EYH A;  4PTB A;  3K9I A;  1F62 A;  3ZVZ B;  1X4U A;  1WEN A;  5G04 J;  2X6J A;  4DLQ A;  4JHK A;  4FO9 A;  4WNF A;  2UY1 A;  3TGO A;  2LGG A;  3ZFW A;  2CHX A;  3JYS A;  4UI9 J;  4L1B A;  2Y43 A;  4YAB A;  4Q6F A;  4ZUX U;  3NF1 A;  3PNT B;  2JEK A;  3ESK A;  3U64 A;  3GW4 A;  4PPE A;  4GZ3 A;  3AU4 A;  4CRW A;  4DI3 A;  1UW4 B;  4RG9 A;  3CHM A;  3Q15 A;  2BTD A;  5T3R A;  2I50 A;  5G05 B;  3MGB A;  4A1G A;  4CDN A;  2VNF A;  3CSF A;  2DCP A;  4X3G A;  3S7B A;  4YBM A;  3T6R A;  1HXI A;  3VK6 A;  2LQ6 A;  2M85 A;  5B76 A;  2OOE A;  2VJE B;  2MNY A;  3D9P A;  4YAX A;  3VLD A;  3O35 A;  3FUK A;  1JOC A;  3FTV A;  2LNI A;  2WPV A;  2VTB A;  3PZD A;  3IEG A;  5J90 A;  3FU5 A;  4TV3 A;  4BY6 A;  3EHN A;  3PRZ A;  2YHC A;  1LDK C;  2YHE A;  5G04 C;  3ZYM A;  2C2L A;  4LCT A;  2AXU A;  3MX3 A;  4C0M A;  2VSY A;  1Z6U A;  1Z3Y A;  2KWK A;  2OVB A;  3JCK C;  5FZQ A;  3EIJ A;  4RSY A;  4Q69 A;  4KVO A;  5D0O D;  5EX0 A;  2WXP A;  2FO7 A;  3ZXS A;  3N71 A;  2J09 A;  4NAC A;  5D1M B;  2L5U A;  4GPK A;  3B7T A;  2PL2 A;  3AU5 A;  5ANR A;  5CMW A;  3ZTG A;  4MKT A;  4HOQ A;  3O7A A;  3LY9 A;  2C2V S;  1U3C A;  5CCL A;  3QK0 A;  4JL0 A;  2JMJ A;  4JPS A;  1VD4 A;  4GYW A;  2ECW A;  4KYO B;  3KD7 A;  3U66 A;  3LEW A;  4HFG A;  3LRQ A;  3O34 A;  4I7B A;  4EBA A;  2HYE D;  1X5B A;  3OTN A;  2KE1 A;  4JXT A;  4L2L A;  2AWI A;  2CFU A;  2LN0 A;  2E0I A;  1HZ4 A;  3CK9 A;  3FTZ A;  2VYI A;  1OUV A;  3MHH A;  4D10 C;  2I6H A;  5LKU A;  4I7C A;  4PUC A;  5LX8 A;  2HR2 A;  2V8S E;  4DI4 A;  2V4L A;  4EZL A;  2LXH C;  3TAX A;  5TBN A;  3FUM A;  5G05 C;  5ENN A;  4FAD A;  4ILH B;  4CCA A;  4QFV A;  3R9A B;  2VP7 A;  3RO2 A;  2PUY A;  1T1H A;  3FH5 A;  4KZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...