4AVXA

Hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) bound to an ip2 compound at 1.68 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
GTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Tandem Vhs and Fyve Domains of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) Bound to an Ip2 Compound at 1.68 A Resolution
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE SUBSTRATE
total genus 72
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4avxA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4avxA02
1N87A 2DIWA 1ELKA 2C2VS 3O7AA 5J08A 4UI9B 2MOWA 2K1JA 1MM3A 1MM2A 5FEYA 1MHQA 3IHPA 2VPBA 1WEPA 4Q96A 4Q6FA 2L0TB 2QICA 1BORA 2L80A 1LDKC 3ASLA 2MNZA 2H0DA 4YBSA 5D1LB 2CSZA 4W4UA 5B79A 4N3WA 2AN6A 1WILA 2VJEA 2JMJA 3LQIA 4LLBA 4V3LC 2CKLA 2YT5A 2FSAA 2M85A 4R8PK 4LK9A 3N9LA 3D9JA 3NG2A 2YSJA 3MHHA 3G2WA 2ECIA 4YATA 2LXHC 1HG5A 2K4DA 2K16A 2I50A 2PNXA 2LV9A 1JWGA 3FL2A 2L5UA 2MUMA 4PPEA 2YURA 1X5BA 4WZ2A 3HCTA 2JRJA 4IC2A 4A4BA 3DQVR 3C5KA 5I3LA 4AP4A 5LCWB 4QF3A 2OXQC 4B7YC 1HG2A 5TBNA 2CSYA 5TDWA 4AVXA 2VP7A 3N9PA 2MA5A 1INZA 3O34A 1H0AA 1PY1A 1X4JA 4YABA 3HCSA 1XGWA 2QY7A 3D9OA 3N9QA 4LKAA 4I7BA 3PURA 2G45A 3LQJA 5LKUA 5AITA 1DVPA 3DPLR 5D1MB 1VDYA 1T1HA 1HYIA 4NN2A 2KREA 3O33A 4IC3A 4AUQB 3V43A 2FUIA 3N9MA 1LF8A 4GB0A 5FB0A 4NACA 3GL6A 3O36A 3SOXA 2G6QA 3N9OA 5JG6A 3QZVA 2KGIA 2KWNA 5C13A 2IDAA 2XB1A 2KYUA 3HTKC 4MVTA 3C6WA 3GV4A 3ONKA 5LP0A 3I2DA 2LO6A 2YHNA 5G0FA 4QF2A 3ZVYA 4A4CA 4S3OC 5B8DA 5LKZA 1V87A 2G43A 2KR4A 5DKAA 1U6GB 1VYXA 1WEUA 2KM4A 1EYHA 5AIUA 1CHCA 1Z60A 4FLBA 4AYCA 2CKLB 2HYED 3U5NA 2ECTA 4WA6A 1WEVA 2V8SE 3G2TA 2MIQA 4GNDA 2MNYA 5B75A 2ZETC 5DINA 2YQLA 5C11A 4MSXA 3L1XA 2EGPA 3PUQA 1JPLA 3M63A 5CMYA 2C2LA 5H1UA 2MT5A 4LADB 2YW8A 2MD8C 2LDRA 4HFGA 3SOWA 4UP5A 3T6RA 2QJ0A 1LDJB 2E6RA 3PHDA 3D9NA 2ECNA 4V3KC 2F6NA 3D9LA 2JMDA 2VNFA 3SOUA 1Z6UA 3ONLA 4YAXA 1EDUA 4BBQA 1JM7A 5FB1A 2NAAA 3RRUA 3G2SA 1WEOA 3RPGC 4BHWA 2M6MA 3N9NA 3ZYMA 2YU4A 5D1KB 2L43A 3M99A 2LGGA 2Y43A 1ZBDB 3ZPV1 1WENA 1HX8A 5TRBA 2UZGA 4YC9A 2BAYA 3O37A 3U5OA 4FJCA 3O35A 2VJFA 2QIZA 3ZTGA 4WZ3B 4B86C 3U5PA 3KNVA 2L75A 4F52B 4GZDA 4LJNA 2LGKA 1SZAA 1WGMA 3LRQA 2M3HA 1HFAA 2KWOA 1VFYA 4UP0A 1WE9A 4CA1A 3ZVZB 2HDPA 3D9PA 5B77A 2Y1MA 4N4FA 5KH9A 3RPGB 3D9KA 1WEWA 3D9IA 1Z2QA 4GNGA 2D8SA 4FO9A 3M62A 2F42A 2Y1NA 3VK6A 1FP0A 2DX8A 4L7XA 3LQHA 3L11A 1WEMA 4TKPB 4ZDTA 3T7LA 3ZPVE 5FERA 3SHBA 5KH7A 1RMDA 1WEEA 4FK5A 5J3XA 4O64A 3U5MA 1JM7B 2YREA 4WZ0A 4AYCB 3KV5A 2KWKA 4R7EA 2RSDA 2EODA 3RTRB 2XEUA 2LN0A 4I7DA 2ECGA 2KU3A 1UJJA 2LQ6A 2PUYA 5G04B 1WESA 2EA6A 4ZUXU 1JUQA 4YBMA 4L58A 1JWFA 2YHOA 4YADA 4X3GA 5B76A 1SZ9A 1E4UA 2CT2A 4XI1A 2RI7A 3ZYQA 2L0BA 3L1ZB 1K2FA 3KQIA 4Q94A 3EB6A 5LKTA 2K17A 1WEQA 1HF8A 2VPGA 4A49A 2KWJA 5LOZA 5TABA 1WIMA 2L0IA 2LRIC 5H9MA 4YBTA 1G25A 1UJKA 2ECVA 2MD7B 1JOCA 5EYAF 5KH3A 1X4IA 4A0CD 5TDRA 4GNEA 4I7CA 2VPEA 4PTBA 3O70A 3LDZA 2KIZA 5G05B 3G2UA 4FU3A 2LGVA 1F62A 2DCPA 4P5OB 2BF0X 2MA6A 3CLJA 5LKXA 2YUCA 2KFTA 3ZYLA 5H1TA 4GNFA 1XWHA 1VD4A 1IYMA 2H0DB 2KGGA 3ZYKA 4JXTA 2E6SA 2LGLA 2VJFB 5CMWA 5H1VA 2LXPC 4C9ZA 2YYRA 5B78A 3HCUA 4ZQLA 2VPDA 1HYJA 3MHSA 3G2VA 1FBVA 2ECJA 3EB5A 4S3OB 2M1RA 4FIPA 4R2YA 2ECWA 2F6JA 2VJEB 2FUUA 4GZCA 2YQMA 3ZNIA 2JMIA 2KE1A 1WFKA 3KV6A 3D9MA 4CCGX 1X4UA 2YSMA
chains in the Genus database with same CATH superfamily
2RFMA 3DPDA 3W9GA 3EJNA 1N94A 4UI9C 4F7AA 1MX2A 3IXEA 4DRXE 4U0UA 2GRPB 2PQNA 4OAVB 3AS8A 4EHMA 4XKBA 2DJAA 5CHEE 1LDKC 2H0DA 4YBSA 1JCRA 2VSOE 4GU5A 2VJEA 1AWCB 2JMJA 1OUVA 5FWQA 2FF4A 5EYPF 2FSAA 3MX3A 4AXHA 3BG0B 3CKBA 2YSJA 3FU3A 3NG2A 3WXXA 4HOUA 4EECA 3FUEA 3U4TA 1HG5A 2Y0BG 4BX9A 1JWGA 1TYQG 4PPEA 2I2OA 3WG7E 4GTRA 1DNPA 3DSUA 3V2XA 5CECB 4IC2A 4A4BA 2KCLA 5I3LA 3DEOA 3EHQA 3E2DA 5LFAA 5E75A 3DSSA 4UWLA 1L5JA 4RVBA 5ENRD 4TXRA 1INZA 3O34A 1OWOA 5BT1A 1PY1A 3CHRA 3LY8A 4F1PA 4J6IA 1X4JA 2J9QA 3EUVA 3AS5A 3TWRA 3OAWA 1XGWA 2WXIA 2J08A 3SUBA 3N9QA 5KNHD 1FPPA 4LG6A 5LKUA 3Q15A 5EILA 5AITA 2Y69E 3PEUB 3ZPJA 2XZDG 3GYZA 3SQVA 3O33A 3OTNA 4WNDA 3V43A 3T5XA 2FUIA 4GTVA 5BUZA 5T4YA 5T3RA 3RO3A 3GL6A 3SOXA 1PC2A 3PH0C 3L16A 3TWQA 4YDWA 3DEPA 5AJDA 2FO1E 2KWNA 3TWXA 2XB1A 1XNFA 3HTKC 3FY4A 3CGHA 2X3MA 3B7SA 5G55A 3I2DA 4BSZB 2PL2A 4QF2A 3L17A 1UOHA 4XI0A 1GW6A 2WXPA 5B1AE 4GPKA 5LKZA 4GZ5A 3HRAA 4B8AA 2LUHA 3J5QB 1OCCE 4TRQA 1N52A 1D8DA 1EYHA 2AXVA 2WXMA 2XOCA 4UI9J 4HRMB 5FQ8A 3JUIA 1TEZA 3CVNA 2A5UA 2ONDA 2R17C 4I1AA 1WG0A 5CERB 4E6HA 3EDTB 2MNYA 2YQLA 1TNZA 4IULA 5C11A 4U07A 5ITZF 3ASDA 2EGPA 1JPLA 2C2LA 5H1UA 2GRMA 1NL4A 3CQGB 3ML8A 4LADB 2MD8C 4U8VD 4HFGA 4KZCA 3SOWA 3UTMA 2YVRA 4CGVA 3FU5A 3T6RA 2E6RA 4HOQA 5BV1A 2J07A 2WXFA 3D9NA 2P9KG 5SVIB 2F6NA 3PRZA 3CVYA 3APCA 3RSEG 5E76A 5FB1A 2NAAA 3RRUA 1WEOA 1MJ0A 3PVLA 3CIAA 2XRYA 3MA5A 4BHWA 2CRWA 3ZYMA 5D1KB 3FHEA 1G3NB 1TN6A 3ZPV1 4JEUA 4HOSA 2CG2A 1H2UA 4YC9A 3FTXA 2WMNA 3U5OA 3IKOB 2DZNA 3TL5A 2QIZA 5BPPA 3JQ1A 4B86C 4WZ3B 2V5FA 2KZTA 4O1PA 3U5PA 3KNVA 3CHMA 5HRYA 5C2YA 4F52B 4FLHA 1HH8A 3HXFA 3L6AA 4LJNA 4N5QA 1FVFA 4XI9A 1WE9A 2XOYA 4J8DA 4GTSA 2MRIA 3NOGD 2PZIA 5ARFA 2JABA 5KBAA 4N4FA 2MYOA 4GNGA 1NZNA 3RJVA 2GRNB 4OAUC 3O48A 1TN8A 4LERA 3NBNB 3TAXA 5SVYA 4TKPB 3T8KA 3CSFA 3FUIA 4ANUA 4PUCA 3SHBA 3HXCA 3Q7AA 5J3XA 3N71A 4O64A 3SFZA 2GRLA 4DX2A 4YDEA 4HQDA 2V5QC 1UJJA 3PZ2A 2F37A 4FADA 4GYYA 4PS7A 3ML9A 2FFWA 1JWFA 2YHOA 4YADA 3TG5A 3NOCD 1O1TA 4WUYA 3U66A 5B76A 2CT2A 4GTOA 2WXKA 5JMND 2IO2C 4HORA 3FTVA 1WM5A 1Z5SC 4KVOA 2LAUA 3SY2A 2B0OE 1YMPA 4A49A 2CHZA 4AIFA 5TABA 2XPZA 2R02A 2L0IA 1H6PA 2KC7A 3H7HA 4JL0A 5FIOA 4R7LA 4KBQA 3C72A 2CONA 2NC9A 4GCNA 4W9RA 4WNEA 1JOCA 4EQFA 3DSWA 1S63A 3ASHA 4G24A 2XGOA 4NIKA 3LDZA 2RD0A 5G05B 3SHFA 4K0RA 3HIZA 2Y1LE 2R05A 2UY1B 4ANVA 4P5OB 2BF0X 3RKVA 4AJWA 3MYVA 3CK9A 1QYMA 1BU9A 4GNFA 5K3QA 2WXRA 1VD4A 3FUFA 3ZYKA 3P1UA 4C0EA 2J09A 4N3BA 3NZSA 4GZ6A 4ZQLA 2OVFA 4ANXA 2AWIA 2XZTG 4TUMA 1IQRA 2IFUA 4FIPA 2ECWA 2VJEB 1E8XA 3FU6A 5KJMA 3R7QA 5ENOD 3ZNIA 2KCVA 3QB2A 3QWVA 3EU9A 2JMIA 1WFKA 2X6KA 5EYLA 2KKXA 1IXVA 4YDYA 2ZISA 2YSMA 3LJNA 3UKRG 4CDMA 4CT4A 2DIWA 1ELKA 2C2VS 4MS6A 3TWVA 2K1JA 4WWPA 2QFCA 4Z68A 3L22A 5FEYA 3QJZA 3S7DA 3IHPA 4ATZD 1Y8MA 2A4ZA 2XHEA 3ASFA 3S7BA 4GYOA 4Q6FA 5C1DA 2QICA 1YYHA 2BKGA 2ZXWE 4HI8A 2MNZA 3EHMA 1OXJA 4X8QA 5JJTA 4Z0RA 3KEAA 3Q9UC 3C3OA 4HLEA 2AN6A 3FWVA 1WILA 3TG4A 1N0QA 4N3AA 2C0LA 3FUMA 3IEGA 3DSVA 3LQIA 2YT5A 2B6CA 5DBKA 4LK9A 3CK8A 4U95D 3N9LA 1N11A 3V79K 1N9AA 4WNFA 3G2WA 1Z6TA 4UQXA 2K4DA 2K16A 2GGFA 4DX7D 5KJLA 4AY6A 4U0SA 2LV9A 4OVUA 4PDXA 2X38A 4TUUA 4P29A 2DSMA 2J8SD 4WZ2A 3UI2A 3D3MA 4H7YA 3C5KA 4I2ZA 2CFUA 1NI1A 3MKQB 5LX8A 4QF3A 3JYSA 5LCWB 2H6HA 5CEDB 4B7YC 4JZYA 4ACKA 4IYPA 2CSYA 3Q78A 3AS4A 3ABME 3CVPA 2I1KA 4KXKB 2IU1A 4CZ2D 3MKQA 2AJAA 4C0MA 2FO7A 4KVMA 4H7XA 4GA0A 3HCSA 2CFZA 3LEWA 3ASGA 4XKCA 3E32A 2QY7A 3FUJA 4LNGA 4RSYA 3D9OA 3PREA 4J8YA 3TWUA 4I6GA 4APOA 4BX8A 3DWDA 4URKA 2V4HC 4NN2A 2KREA 3CVXA 3B7TA 3AJIA 4DK5A 2LSVA 4N2QA 3SF4A 5SVXA 5CRUA 4NACA 3ZFWA 4ABNA 2I1JA 5G04C 1A17A 3N9OA 1WY6A 4APFA 5H7PA 2WQ7A 5D66A 5LP0A 5G0FA 1W3BA 3M7KA 3PZ3A 5FQ7A 2G43A 2EINE 2KR4A 1JCQA 2ILRA 4AY5A 4DLQA 1U6GB 3APDA 1OWPA 1WEUA 1S70B 4WAFA 1E7VA 2PM7A 2KM4A 3MV2B 1N95A 2LSUA 1IKND 1CHCA 4N5CA 1E90A 4HXIA 2IOLA 4AYCA 2CKLB 3U5NA 5EX3A 4WA6A 2QC9A 3JCKC 3G2TA 4QQIA 4L1BA 2MIQA 4GNDA 1ELRA 5D0OD 1PAQA 1V54E 2V0PA 1EF1C 1Q2ZA 3PS6A 4A3TA 2NSZA 2Y4UA 4LSZE 3PUQA 3M63A 1HU3A 5CMYA 4HVBA 3AG1E 2MT5A 3HXDA 2HR2A 1TJCA 4HRNA 3V31A 5ANRA 5CBNA 4GTQA 2V4LA 4F3VA 4UP5A 3PDNA 1O1SA 4FP7A 3ZU7B 1LDJB 3FUKA 1SA4A 1IHBA 1FT1A 3UPVA 5IY5E 2KXPC 1Z6UA 4BEPA 4Z0OA 2OVBA 3ZHEB 3Q1DA 3PZDA 3ZIMA 5BXUA 5AQBA 3CSTA 2P9SG 4XIFA 1LTXA 5G04J 1E8WA 1HX8A 3KSLA 2H6FA 4I6EA 5JHAA 4BTBA 2UZGA 3ZRHA 2BAYA 5FQ6A 2VJFA 1TNYA 5JA4D 5ANLA 5DIZA 4CYMD 3PNTB 3GZ2A 4GZDA 4J7WA 5FINA 4I9CA 2LGKA 1WGMA 2P9NG 3URZA 3CHPA 1NFIE 1N4QA 5AQ7A 3PE4A 3PEVB 3RPGB 1WEWA 3BUAA 3KDEC 3E33A 3QAQA 4KT6B 3EIQC 2X6HA 4FO9A 3LPZA 4A1SA 2QYJA 3FDHA 3TXNA 4NRHB 4L7XA 3L11A 3ZN3A 4KMOA 2AXUA 5EDSA 3RO2A 4UQZA 4FK5A 2LXMA 1UG3A 3U5MA 5KWDA 2XCBA 2WXGA 3KV5A 3AU4A 3RTRB 4N2SA 2XEUA 2EIJE 2KU3A 2XS8A 2LQ6A 2PUYA 5G04B 2EA6A 3LVRE 4L58A 4A1GA 2VGXA 3UIOC 5FJYA 4AP2A 1SZ9A 1E4UA 4I1MA 3UM1A 4F1SA 2IJGX 4J8SA 3ZYQA 5G05C 3VTYA 2L0BA 3L1ZB 1K2FA 2KZTB 1KT1A 3EB6A 4B8CB 3FEHA 2K17A 3LJUX 4HLLA 3B7RL 1DCEA 3B13A 2HE0A 4U04A 4I6JA 4JHRA 3ZVVA 4GB9A 3CVWA 4UWGA 1SQMA 3UXGA 2WVIA 4PS3A 2ECVA 2MD7B 5EYAF 2P9LG 3MV3B 2OOEA 3ZHEA 3UKUG 3ASOE 3R7RA 4BY6A 3ZW3A 1KLXA 4A0CD 4JA9A 5JHBA 4I7CA 2VGEA 4B93B 2CRRA 3O70A 4E85A 3Q9NC 1ZBPA 1F62A 2XOZA 3EU5A 2YHEA 3SBSA 3FTSA 5BNWA 4DLOA 2MA6A 4I1OB 2LXLA 3LDYA 3VTXA 5EKQD 2H0DB 5FTPA 2LGLA 2VJFB 3SZ7A 3CKCA 4C9ZA 2LNIA 5FZSA 3HCUA 4CEMA 3JXIA 3LJ3A 2Y3AA 2VPDA 1LD8A 4OGCA 2WXHA 4O6FA 1FBVA 3EB5A 1D8EA 2I9CA 4WWNA 1V55E 4FULA 4GZCA 4RLYA 3DXMG 4G1TA 4CCGX 1OWMA 3SD5A 4AM9A 3T9KA 3FUDA 3CHOA 3B7BA 3Q47B 3EIJA 2HM8A 3UMVA 2H6IA 2XEHA 1UN9A 2MOWA 5CBOA 4FHJA 3IHYA 2QZAA 2WXLA 4TXQA 1WEPA 4Q96A 4ZHBA 3FU0A 2E2EA 3CVVA 2PQRA 1BORA 1IHGA 4G8LA 3MCXA 4UWHA 5FQ4A 2H6GA 2VJ8A 3HXBA 3W9FA 3LY9A 5D1LB 4W4UA 5B79A 2VYIA 3S2AA 1BD8A 4DI4A 4V3LC 2CKLA 4A63B 2IY0C 1TR4A 4WWOA 2HO1A 2ETAA 3MHHA 4GTPA 4YATA 1OWNA 2A5EA 1E96B 2I50A 4CDRA 3NQPA 4L9PA 3B7UX 3FL2A 2L5UA 3NZUA 1Z3YA 2VSYA 2MUMA 1X5BA 3MGBA 5ENQD 3HCTA 2JRJA 4HBDA 1MX4A 3LXUX 1WAO1 1AP7A 3SI5A 3DQVR 2AXZA 2XP0A 3B95A 4AP4A 3KEZA 2Q7FA 4KYOB 4AVXA 2WB2A 5TDWA 3MZLB 1B89A 2XCCA 4FHKA 2VP7A 3N9PA 3QARA 4GCOA 4JHKA 5AN8A 3KS2A 5AAOA 4AOFA 1ZU2A 3ENEA 2XS1A 4JA7A 3X2QE 5KJNA 5A7DB 4LKAA 4A55A 2RG8A 3KSQA 5EIDA 4BETA 5D2MC 2FI7A 3L82A 1QNFA 2X6JA 5AQAA 3DPLR 1VDYA 1T1HA 3AAAC 1HYIA 2IQJA 3IV0A 2P2CP 2M63A 1OWLA 1U3DA 4IC3A 4AUQB 2F0YA 2MKEA 4DX6D 3JUEA 3O4ZA 2WMOA 4GB0A 4HRLA 5FB0A 1SA5A 4G23A 3ASNE 5LCWJ 2IF4A 2LAHA 3O36A 2G6QA 5JG6A 3RIBA 1NA0A 4CGWA 2KGIA 4M7CA 1E8YA 3PLWA 2IDAA 2KYUA 2R5SA 4MVTA 3OXFA 1KPSB 1JCSA 5AIJA 2XENA 5B8DA 1V87A 2WPVA 3CVUA 3UQ3A 1X81A 5AJLA 3VLDA 3HYMB 3DRAA 4I2WA 4K03A 1HS6A 5AIUA 2ETCA 3S7JA 3ZNGA 4YNDA 3QOUA 4C48B 4FLBA 4CDNA 2HYED 2ECTA 5CCLA 4YVQC 3QWWA 1WEVA 2V8SE 2GRQB 1E8ZA 2ZETC 3BQOA 3L1XA 3FM8C 2M13A 1RW2A 4K5CA 5JJ6A 1SVXA 2D8UA 3PE3A 2LDRA 4DI3A 4LEUA 1K1BA 4BESA 3GW4A 4K5AB 2QJ0A 3PHDA 2BEDA 2ECNA 3TWTA 4N3CA 4KZ0A 3GZSA 4N39A 5EN5D 3D9LA 2JMDA 4J8EA 4U0ZA 2VNFA 3SOUA 4JC8A 2E61A 3ONLA 1EDUA 3UUXA 4BBQA 1QZ2A 3AG2E 1OY3D 1JM7A 1EPUA 1S64A 3CEQA 4Q69A 3G2SA 4NQ0A 2J49A 4G2VA 3EHRA 3N9NA 4HB5A 2L43A 3M99A 2KCKA 1D9SA 3TWSA 3AU5A 2Y43A 3HG0D 2UWJG 2VSNA 3ESLA 3HVEB 1MBMA 3UM3A 3RRMB 4J0UA 3Q75A 5ENSD 2EIKE 1DC2A 3ZUVB 2NXPA 5KCMA 2FEZA 1KT0A 4U8YD 2R03A 4XEIG 5HKPA 5AENA 1MX6A 3FH8A 2AVPA 1SZAA 4XX5A 2JUNA 2M3HA 3LRQA 2KWOA 3MEKA 2VTBB 4GAAA 4UP0A 3LS8A 5HQ8A 3ZVZB 1Y6IA 2RKKA 2ZU6B 4XE0A 3TWWA 4BWRA 2Y1MA 2WXOA 5KH9A 3D9KA 3GZ1A 3PUJA 2X6IA 3DSXA 3ZEFA 2D8SA 2JEKA 5AQ9A 2J4BA 4F6RD 3P2BA 3UIPC 1FP0A 2DX8A 1TNOA 2BUGA 3U64A 3LQHA 4EZLA 4ZDTA 3T7LA 4EPZA 2R2LA 2CSVA 5FERA 3FP3A 5KH7A 4I9EA 2XPIA 5ARGA 2VGYA 1WEEA 2I6HA 5CEAA 3HHMA 4JW1A 4BSXA 1ZB1A 5ENPD 2YREA 4AYCB 4MKTA 2KWKA 2RSDA 4I7DA 3S7FA 4FJZA 4B89A 1BPOA 1WESA 4ZUXU 1OCOE 4YVOA 3SFXA 2E0IA 3ZKJA 3C3RA 3ISMC 4MRUA 2XQ0A 2RI7A 2L7PA 1TJFA 5G2NA 2KATA 4K5BA 4TV3A 3HDXA 3V2OA 2OEVA 3KD7A 5LKTA 1KZPA 3UT4A 5HI7A 4ME2A 1U2VG 1IYGA 4IN3B 2VPGA 3F6QA 2KWJA 3FUHA 3C3QA 3RK6A 4G25A 5JJ7A 1H2TC 2CG3A 3DPYA 3UX4A 2ETBA 2LRIC 2IOSA 3CK7A 1G25A 1H2VC 3PZ4A 5T8IA 4GMLA 3CVLA 5KH3A 2GW1A 1FCHA 1YCSB 2UY1A 1X4IA 3NF1A 2EILE 5TDRA 4L23A 4TXPA 3VLFA 2J4DA 2KIZA 1BI7B 2RR4A 4FU3A 4D10C 3PNLB 2YQ8A 2DCPA 2VQ2A 3L54A 4FA6A 2DVWA 5LKXA 3CLJA 3LY7A 4JB8P 5H1TA 1BI8B 2GROB 1XWHA 1IYMA 4PH4B 4EBAG 3CHQA 3ABLE 4B94A 3MJWA 2E6SA 1UN8A 3FFLA 5CMWA 5H1VA 4EZKA 4ACLA 2LXPC 4HI9A 5B78A 4L7TA 3SBTB 4O62A 3RU0A 3NAWA 5KNGA 1HYJA 1FVHA 4BT9A 3FTUA 3G2VA 2XRZA 4S3OB 4H9DA 1TN7A 3FEYA 1MQSA 4HNAD 4R2YA 2FUUA 4AEZC 3E4BA 4B0ZA 3NB2A 3SGHA 3O47A 2YQMA 3I3NA 2KE1A 1H19A 3KV6A 1N0RA 3D9MA 4WNGA 1X4UA 4JD2G 5AARA 4ATGA 1N87A 4GMRA 3O7AA 2OWAA 5J08A 4UI9B 3ZXPA 2FULA 1MM3A 1MM2A 1MHQA 2DYRE 1FT2A 1WDYA 2VSXE 3QWPA 2VPBA 2EXUA 2RFAA 1E7UA 2WXNA 3FTYA 4GPMA 2PNNA 2L0TB 2XEVA 2L80A 3BEEA 5M72A 3JXJA 4A3VA 3ASLA 3SO8A 4EZJA 1OCZE 3J5PA 3L13A 4CRWA 2CSZA 4N3WA 1OT8A 2DBAA 2CHXA 1U3CA 4LLBA 4LRZA 5ENNA 2M85A 4R8PK 1N4PA 3D9JA 2WQHA 2L6BA 5AYWD 5FZQA 1RZ4A 2YNQA 2ECIA 2LXHC 4L2LA 2PNXA 2YURA 3PZ1A 2DZOA 3E34A 5BV0A 4LNUD 4C9BB 2FBNA 4G8KA 4UUCA 4DUIA 2OXQC 4BT8A 1HG2A 5TBNA 4RQIA 1YA0A 3VLEA 3SFYA 4GA2A 4DX5D 5BW8C 3UT7A 3FEXA 3Q5MA 2MA5A 4BFRA 2IQCA 5EIBE 1H0AA 1QQEA 2F8YA 4OVVA 4QQ4A 3DDTA 4YABA 4GA1A 2KKYA 2VTBA 1SW6A 3FAOA 3QC1A 4I7BA 4LNBA 3PURA 3E37A 5EX0A 2G45A 3QDNA 3LQJA 1DVPA 5D1MB 1HO8A 3KAEA 4XZ4A 2ZIRA 1NP7A 2XGSA 3C5RA 3L08A 1H6OA 3CR3A 4EBAA 2AW6A 3AG4E 4UI9K 1O1RA 3N9MA 1LF8A 1K3ZD 3TGOA 1HXIA 2GRRB 4ZFHA 2L9BA 1LD7A 3LYAA 3ESKA 3QZVA 2IONA 5C13A 3T8MA 4CT0A 3C6WA 4CCAA 3PUKA 3ULEG 3GV4A 3ONKA 2LO6A 2YHNA 4FC8A 3T5VA 4J8FA 3ZVYA 4A4CA 3ABKE 5KJKA 4HOTA 4Y6CA 4S3OC 3ZGQA 4IRUA 3U3WA 3IHVA 3MDBC 5DKAA 1ELWA 3DSTA 3HXEA 1VYXA 5HS0A 4LCTA 2IEJA 2EIME 2QYUA 4JPSA 1N4RA 2DWZA 3UM2A 1Z60A 2ZGDA 3FTZA 1K1AA 2CHWA 2WXJA 3OXLA 5B75A 5DINA 1UW4B 4M3OA 3Q79A 4F53A 3FTWA 4MSXA 5A6CA 5BXOA 3Q7FA 2OEWA 5FT9A 4G26A 1OCRE 3RRNB 1MYOA 2P58C 4JVSA 2YW8A 3EHNA 2DYSE 4JHJA 3K9IA 2JM3A 4O60A 4HS2A 4V3KC 2KBXA 3OXGA 5B1BE 3DWLG 3I4GA 4YAXA 2X6FA 4DJAA 4V3IA 2BTDA 2NYJA 1HZ4A 4I17A 5J90A 3Q73A 2P9PG 3DBSA 4OYSA 4OGEA 2OCCE 3RPGC 4DX1A 4PS8A 2M6MA 2P57A 2WXQA 3R9MA 3UT8A 2YU4A 3CQCB 2BKKB 2JLBA 2P9IG 2EGMA 2LGGA 1ZBDB 2FD4A 5ENTD 4BTAA 1WENA 4JEHA 5TRBA 3BG1B 3I5PA 3O37A 3Q4AB 4FJCA 3O35A 1TNBA 2PM6A 1DCQA 3ZTGA 3LVQE 2LAIA 4U7EB 2L75A 3LCAA 3QKYA 2WQ6A 1HFAA 1VFYA 4CA1A 2HDPA 3TXMA 3DXKG 3D9PA 5B77A 5A23A 1TNUA 4U8HA 2YINA 3D9IA 1Z2QA 3M62A 3FH5A 3JQ0A 2R59A 2F42A 2P9UG 2Y1NA 2ZGGA 3ULYA 3VK6A 3MKRA 4NURA 2WM9A 1WEMA 4U96D 3HVEA 3Q49B 2IO3C 2F8XK 3ZPVE 4L2YA 3QK0A 1RMDA 3FH7A 1HE8A 3E30A 4Y6WA 1K8KG 5FZRA 4MLPA 1JM7B 4WZ0A 2VGXB 4R7EA 2EODA 4GTTA 4G11A 2LN0A 3R9AB 4AV7A 2ECGA 3TJPA 3AG3E 1JUQA 4YBMA 1QBQA 3CHSA 4ILIA 4X3GA 5B3SE 3LKUA 5CRVA 3CVQA 4XI1A 3FULA 3I4RB 4UQYA 2OV8A 4O1OA 3KQIA 4Q94A 3UM0A 2EQXA 2C0MA 4FJYA 1WEQA 5SVIA 1HF8A 4ILGA 2XEEA 4GYWA 4QFVA 3SNXA 4ANWA 5LOZA 3FUNA 1WIMA 3APFA 3L9TA 4UWFA 5H9MA 4YBTA 3BU8A 1H6KA 4RG9A 4BERA 1UJKA 5G05J 2L6JA 3RAUA 1NA3A 1S0PA 4GMJA 1MZCA 3FJUB 4GNEA 2VPEA 4PTBA 4I43A 5CCMA 3G2UA 1A5EA 2LGVA 1Z3XA 1N4SA 3D9HA 4MBGA 3V30A 4YDOA 3IBEA 3U9WA 4GTMA 3QNKA 2XPYA 2YUCA 2KFTA 4UWKA 3ZYLA 4ILHB 4GZ3A 2KGGA 4DPRA 1O5MA 4JXTA 1N54A 2MHKA 1KZOA 2YYRA 2XGMA 3UINC 4LUNU 1BLXB 2Y4TA 3ULQA 4RG6A 3FANA 2HYZA 1IQUA 3MHSA 2ECJA 2M1RA 2F6JA 3ZXSA 4U63A 2YHCA 5LCWC 3CV0A 5D0QD 1P5QA 3C98A
chains in the Genus database with same CATH topology
3DPDA 4ATGA 2HM8A 1N87A 3UMVA 4CDMA 4CT4A 2DIWA 1ELKA 3EJNA 2C2VS 4MS6A 3O7AA 5J08A 1UN9A 4UI9C 4UI9B 2MOWA 2K1JA 2FULA 4WWPA 1MM3A 2QFCA 1MM2A 3L22A 5FEYA 3QJZA 4F7AA 4FHJA 1MHQA 3S7DA 3QWPA 2VSXE 3IHYA 3IHPA 2VPBA 1Y8MA 4U0UA 2A4ZA 2WXLA 1WEPA 2XHEA 3ASFA 2PQNA 4Q96A 3FU0A 4CA1A 2E2EA 3AS8A 1E7UA 3S7BA 2WXNA 3FTYA 3CVVA 4GYOA 4Q6FA 2L0TB 2PQRA 5C1DA 2QICA 2XEVA 4XKBA 1BORA 5CHEE 1IHGA 3BEEA 2L80A 1LDKC 3MCXA 4UWHA 5M72A 4A3VA 2MNZA 3EHMA 5FQ4A 3ASLA 2VJ8A 4EZJA 2H0DA 5JJTA 4YBSA 3LY9A 3L13A 5D1LB 2VSOE 4HLEA 4CRWA 2CSZA 4GU5A 4N3WA 2AN6A 4W4UA 5B79A 3FWVA 1WILA 2DBAA 2VYIA 3S2AA 3TG4A 4DI4A 4A4CA 2VJEA 4N3AA 2JMJA 2C0LA 3FUMA 3IEGA 3LQIA 1OUVA 5FWQA 2CHXA 1U3CA 2FF4A 4LLBA 4LRZA 2CKLA 2YT5A 2FSAA 5ENNA 2M85A 4V3LC 5DBKA 4R8PK 3MX3A 4AXHA 4LK9A 3CK8A 3N9LA 3BG0B 4WWOA 3D9JA 2HO1A 2WQHA 3CKBA 3FU3A 2YSJA 3WXXA 3MHHA 3NG2A 4HOUA 3G2WA 4WNFA 5FZQA 5AYWD 4EECA 2YNQA 2ECIA 3FUEA 3U4TA 1OWNA 1Z6TA 1HG5A 4UQXA 4L2LA 1E96B 2GGFA 4BX9A 2K16A 5KJLA 2I50A 4CDRA 2K4DA 3NQPA 4AY6A 3B7UX 4U0SA 2LV9A 1JWGA 4OVUA 4PDXA 2X38A 2PNXA 2L5UA 3FL2A 3NZUA 1Z3YA 2VSYA 2MUMA 4TUUA 2I2OA 4P29A 2YURA 4PPEA 1X5BA 4WZ2A 3MGBA 3D3MA 5BV0A 1DNPA 3HCTA 2JRJA 3LXUX 1WAO1 4C9BB 2FBNA 4IC2A 3SI5A 3DQVR 4A4BA 2KCLA 4H7YA 3C5KA 4I2ZA 5I3LA 2AXZA 2CFUA 4AP4A 3MKQB 5LX8A 4QF3A 3JYSA 3KEZA 2OXQC 5LCWB 4B7YC 4JZYA 1HG2A 4BT8A 4ACKA 5TBNA 4IYPA 2CSYA 4AYCA 3U5NA 2Q7FA 4KYOB 4AVXA 5E75A 3AS4A 5LFAA 2WB2A 5TDWA 1YA0A 3CVPA 4UWLA 3VLEA 2I1KA 3MZLB 4GA2A 1L5JA 4KXKB 4RVBA 1B89A 2XCCA 4FHKA 5BW8C 3UT7A 2VP7A 2IU1A 3QARA 2LXHC 3N9PA 3FEXA 3Q5MA 4GCOA 4JHKA 4BFRA 3KS2A 2MA5A 2IQCA 1INZA 4AOFA 1ZU2A 3MKQA 3O34A 1H0AA 1OWOA 4C0MA 5BT1A 1QQEA 1PY1A 3CHRA 3ENEA 3LY8A 4OVVA 2FO7A 4JA7A 4KVMA 4J6IA 1X4JA 2J9QA 4YABA 4GA1A 3AS5A 4H7XA 4GA0A 3HCSA 3OAWA 1XGWA 2CFZA 2WXIA 2J08A 3ASGA 3LEWA 2QY7A 3FUJA 4XKCA 4RSYA 3D9OA 5KJNA 3N9QA 3PREA 5A7DB 4LKAA 3QC1A 4A55A 4I7BA 2RG8A 3PURA 4I6GA 5EX0A 3QDNA 2G45A 3LQJA 5LKUA 3Q15A 5AITA 3PEUB 1DVPA 2FI7A 3DPLR 1QNFA 1HO8A 2X6JA 3ZPJA 4APOA 4BX8A 5D1MB 3KAEA 4URKA 1VDYA 3GYZA 4XZ4A 1T1HA 1HYIA 1NP7A 2XGSA 3L08A 2KREA 4NN2A 3CR3A 3IV0A 4EBAA 3O33A 2AW6A 2M63A 3CVXA 1OWLA 1U3DA 4IC3A 3OTNA 4WNDA 3V43A 4AUQB 3T5XA 4UI9K 3B7TA 3O4ZA 2FUIA 5BUZA 3N9MA 4DK5A 1LF8A 5T4YA 2WMOA 4GB0A 5FB0A 2LSVA 4G23A 5LCWJ 4N2QA 3SF4A 5T3RA 3TGOA 1HXIA 4NACA 3RO3A 3ZFWA 2IF4A 4ABNA 3GL6A 2LAHA 2I1JA 5G04C 3O36A 3SOXA 1A17A 1PC2A 2L9BA 3PH0C 3LYAA 2G6QA 3ESKA 3L16A 3N9OA 1WY6A 3RIBA 1NA0A 4APFA 4CGWA 2KGIA 5AJDA 3QZVA 1E8YA 2IONA 2KWNA 5C13A 2IDAA 2XB1A 3T8MA 2KYUA 1XNFA 2R5SA 3FY4A 4CT0A 3HTKC 4MVTA 3C6WA 3CGHA 2WQ7A 2X3MA 3B7SA 5G55A 3OXFA 3PUKA 4CCAA 3GV4A 3ONKA 5LP0A 3I2DA 2LO6A 2YHNA 5G0FA 4FC8A 3T5VA 2PL2A 4QF2A 3L17A 1W3BA 4J8FA 5AIJA 4XI0A 1GW6A 5KJKA 2WXPA 4Y6CA 4HOTA 4S3OC 3ZVYA 3ZGQA 4IRUA 3U3WA 4GPKA 5FQ7A 5B8DA 3IHVA 5LKZA 1V87A 4GZ5A 2WPVA 3CVUA 2G43A 3UQ3A 4B8AA 2KR4A 2ILRA 5AJLA 3VLDA 5DKAA 3HYMB 4AY5A 4DLQA 1U6GB 3APDA 1ELWA 4TRQA 1OWPA 1N52A 1VYXA 1WEUA 4WAFA 1E7VA 4LCTA 2PM7A 4K03A 2KM4A 4I2WA 3MV2B 1HS6A 1EYHA 2LSUA 3S7JA 5AIUA 4JPSA 4YNDA 3QOUA 4N5CA 1E90A 2AXVA 4HXIA 1CHCA 2WXMA 1Z60A 4FLBA 2IOLA 4UI9J 4CDNA 5FQ8A 3JUIA 2CKLB 2HYED 5EX3A 3FTZA 1TEZA 2ECTA 5CCLA 3CVNA 2A5UA 3QWWA 2ONDA 2R17C 4YVQC 1WEVA 2V8SE 3JCKC 3G2TA 1E8ZA 4L1BA 4I1AA 2MIQA 4GNDA 1ELRA 4E6HA 2CHWA 2WXJA 3EDTB 3OXLA 1PAQA 5D0OD 2MNYA 2ZETC 5DINA 1UW4B 2V0PA 5B75A 1EF1C 4M3OA 2YQLA 4F53A 3PS6A 3FTWA 4IULA 4MSXA 4A3TA 5C11A 5A6CA 4U07A 2NSZA 3L1XA 2EGPA 2Y4UA 3ASDA 4G26A 5FT9A 1JPLA 3M63A 3PUQA 1HU3A 5CMYA 2C2LA 3RRNB 4HVBA 5H1UA 2GRMA 2MT5A 2P58C 3CQGB 3ML8A 5JJ6A 2HR2A 1TJCA 4JVSA 5ANRA 4LADB 2YW8A 3EHNA 2MD8C 3PE3A 2LDRA 4HFGA 2V4LA 4KZCA 4F3VA 3SOWA 4UP5A 4DI3A 3PDNA 4CGVA 3FU5A 4LEUA 3T6RA 3GW4A 2QJ0A 4FP7A 1LDJB 4JHJA 3K9IA 2E6RA 4HOQA 3FUKA 3PHDA 5BV1A 2J07A 2WXFA 3D9NA 2ECNA 4HS2A 4N3CA 4KZ0A 3UPVA 3GZSA 4N39A 4V3KC 3OXGA 2F6NA 3PRZA 3D9LA 2JMDA 3CVYA 3APCA 4J8EA 3I4GA 4U0ZA 2VNFA 3SOUA 4JC8A 1Z6UA 3ONLA 4YAXA 1EDUA 2X6FA 3UUXA 4DJAA 4BBQA 1QZ2A 4V3IA 2OVBA 5E76A 3ZHEB 2BTDA 3PZDA 1HZ4A 1EPUA 4I17A 3ZIMA 5J90A 2NAAA 5FB1A 1JM7A 3CEQA 3RRUA 4Q69A 3G2SA 4NQ0A 1WEOA 3DBSA 4OYSA 3RPGC 2J49A 3PVLA 3CIAA 2XRYA 3MA5A 4G2VA 3CSTA 4BHWA 4PS8A 2M6MA 3N9NA 2WXQA 3UT8A 3ZYMA 4XIFA 2YU4A 5D1KB 5G04J 3FHEA 2L43A 3M99A 3CQCB 2JLBA 2KCKA 2LGGA 1E8WA 3AU5A 2Y43A 1ZBDB 3ZPV1 4BTAA 4JEUA 2UWJG 2VSNA 3ESLA 3HVEB 1HX8A 2CG2A 3Q47B 4HOSA 1WENA 4JEHA 5TRBA 1H2UA 4I6EA 5JHAA 4BTBA 2UZGA 3RRMB 4YC9A 4J0UA 3BG1B 3I5PA 3FTXA 3ZRHA 2WMNA 2BAYA 3Q4AB 3O37A 3U5OA 4FJCA 5FQ6A 3IKOB 3O35A 2VJFA 3TL5A 2NXPA 2PM6A 5KCMA 2QIZA 5BPPA 3JQ1A 3ZTGA 2FEZA 3LVQE 5ANLA 2LAIA 2KZTA 1KT0A 2V5FA 5DIZA 4WZ3B 3U5PA 3KNVA 3CHMA 3PNTB 5AENA 3GZ2A 2L75A 5C2YA 4F52B 4GZDA 4FLHA 1HH8A 3L6AA 4LJNA 5LKXA 4I9CA 3FH8A 2LGKA 3LCAA 2AVPA 3QKYA 1SZAA 4XX5A 2WQ6A 1WGMA 1HFAA 2KWOA 2M3HA 1VFYA 3LRQA 1FVFA 3MEKA 4GAAA 4XI9A 3LS8A 2VTBB 5HQ8A 1WE9A 4UP0A 2HDPA 3ZVZB 3TXMA 3CHPA 4J8DA 1Y6IA 3URZA 2ZU6B 3D9PA 4XE0A 5A23A 5B77A 2MRIA 5ARFA 2PZIA 4BWRA 3PE4A 3PEVB 4U8HA 2Y1MA 2WXOA 2YINA 4N4FA 5KH9A 3RPGB 3D9KA 3GZ1A 3PUJA 2X6IA 3D9IA 1WEWA 1Z2QA 3QAQA 3ZEFA 4KT6B 3EIQC 1NZNA 2D8SA 2X6HA 3RJVA 4FO9A 4GNGA 3LPZA 4A1SA 3M62A 3FH5A 2JEKA 3JQ0A 2R59A 2F42A 3FDHA 3O48A 4LERA 2Y1NA 2J4BA 3P2BA 3TXNA 3VK6A 1FP0A 3MKRA 4NRHB 3TAXA 2BUGA 3U64A 2DX8A 4NURA 3LQHA 4L7XA 3L11A 2WM9A 1WEMA 4EZLA 4TKPB 4ZDTA 3T7LA 3ZN3A 3HVEA 3Q49B 4EPZA 3CSFA 4KMOA 3FUIA 4ANUA 4PUCA 3ZPVE 4L2YA 5FERA 3SHBA 3FP3A 2AXUA 3QK0A 1RMDA 5KH7A 3FH7A 3RO2A 5EDSA 1HE8A 4I9EA 4UQZA 2XPIA 5ARGA 4Y6WA 2VGYA 1WEEA 2I6HA 4FK5A 3N71A 1UG3A 5J3XA 5FZRA 3HHMA 4JW1A 4O64A 4MLPA 3U5MA 2XCBA 4BSXA 1JM7B 2YREA 4WZ0A 4MKTA 4AYCB 2VGXB 2WXGA 3SFZA 3KV5A 2KWKA 2GRLA 4R7EA 2RSDA 2EODA 3AU4A 3RTRB 4N2SA 4G11A 2LN0A 2XEUA 4I7DA 3S7FA 4FJZA 3R9AB 4B89A 4AV7A 2ECGA 1UJJA 3TJPA 2KU3A 2LQ6A 2PUYA 1BPOA 5G04B 1WESA 2EA6A 4FADA 4ZUXU 3LVRE 4GYYA 4PS7A 4YVOA 1JUQA 4YBMA 3ML9A 4L58A 1JWFA 2E0IA 4A1GA 5JG6A 2VGXA 2YHOA 3CHSA 3TG5A 4YADA 5FJYA 4ILIA 4X3GA 4AP2A 4WUYA 3U66A 5B76A 1SZ9A 1E4UA 4MRUA 3LKUA 2XQ0A 2KE1A 2CT2A 4I1MA 3CVQA 2RI7A 4XI1A 4F1SA 3FULA 1TJFA 2IJGX 5G2NA 2KATA 4TV3A 3HDXA 4J8SA 3ZYQA 2WXKA 5G05C 3I4RB 3VTYA 4UQYA 2L0BA 3L1ZB 1K2FA 2OV8A 2KZTB 1KT1A 1WM5A 3FTVA 4Q94A 4HORA 2EQXA 3KQIA 3KD7A 3EB6A 4B8CB 2C0MA 5LKTA 2K17A 4KVOA 4FJYA 1WEQA 1HF8A 4ILGA 3UT4A 5HI7A 4ME2A 3B7RL 4B86C 4GYWA 1IYGA 4QFVA 3B13A 4IN3B 3SNXA 4ANWA 2VPGA 4A49A 2KWJA 3FUHA 5LOZA 3FUNA 4G25A 3RK6A 1H2TC 5JJ7A 2CG3A 4WA6A 2CHZA 3UX4A 4AIFA 5TABA 4U04A 2XPZA 1WIMA 1WFKA 3APFA 2L0IA 2KC7A 4I6JA 4JHRA 2LRIC 3ZVVA 4UWFA 4YATA 5H9MA 4GB9A 4YBTA 4JL0A 3CVWA 4R7LA 4KBQA 1H6KA 2IOSA 3CK7A 4RG9A 1UJKA 1SQMA 4UWGA 1H2VC 5G05J 1G25A 5T8IA 2L6JA 2NC9A 2WVIA 4GCNA 4GMLA 4PS3A 4W9RA 4WNEA 3CVLA 2ECVA 1NA3A 1S0PA 3MV3B 1JOCA 2MD7B 5EYAF 2OOEA 4GMJA 3ZHEA 2GW1A 4EQFA 5KH3A 1FCHA 2UY1A 1X4IA 3R7RA 4BY6A 3NF1A 3ZW3A 1KLXA 4A0CD 5TDRA 4JA9A 4L23A 5JHBA 3VLFA 4GNEA 3ASHA 4I7CA 2VPEA 4G24A 2XGOA 4PTBA 4I43A 3O70A 2VTBA 2J4DA 4E85A 3LDZA 5CCMA 1ZBPA 2RD0A 2KIZA 5G05B 3SHFA 3G2UA 4FU3A 4D10C 2LGVA 3PNLB 4K0RA 1F62A 1Z3XA 3HIZA 2YHEA 2YQ8A 2DCPA 2UY1B 3SBSA 3FTSA 2VQ2A 3L54A 4ANVA 4FA6A 4P5OB 2BF0X 3RKVA 4AJWA 4DLOA 3MYVA 3IBEA 3CK9A 3U9WA 5BNWA 2MA6A 3CLJA 3LY7A 2XPYA 3QNKA 4I1OB 2KFTA 2YUCA 4UWKA 3ZYLA 4GNFA 5H1TA 2WXRA 4ILHB 3VTXA 1VD4A 1XWHA 4GZ3A 4PH4B 5EKQD 3CHQA 4EBAG 1IYMA 4B94A 3MJWA 2H0DB 4DPRA 5FTPA 2KGGA 3FUFA 3ZYKA 4JXTA 2E6SA 2LGLA 1N54A 2MHKA 2VJFB 1UN8A 3SZ7A 3P1UA 3FFLA 5CMWA 5H1VA 4EZKA 3CKCA 4ACLA 2LXPC 2YYRA 4C9ZA 4C0EA 5B78A 2XGMA 2J09A 4N3BA 2LNIA 5FZSA 3NZSA 4L7TA 4GZ6A 4LUNU 3SBTB 2JMIA 3HCUA 4CEMA 4ZQLA 3RU0A 2Y4TA 3LJ3A 2OVFA 3ULQA 2Y3AA 4RG6A 4ANXA 2VPDA 2HYZA 1HYJA 1IQUA 1FVHA 3MHSA 2WXHA 2AWIA 4O6FA 4BT9A 3FTUA 3G2VA 2XRZA 1FBVA 1IQRA 2I9CA 2ECJA 4WWNA 3EB5A 4S3OB 2IFUA 3FEYA 1MQSA 2M1RA 4FIPA 2ECWA 4R2YA 2F6JA 4FULA 2VJEB 1E8XA 3FU6A 2FUUA 4AEZC 3E4BA 4B0ZA 4GZCA 3SGHA 5KJMA 3R7QA 3ZXSA 2YQMA 3ZNIA 2KCVA 3QB2A 3QWVA 3I3NA 4U63A 2YHCA 1H19A 2X6KA 4G1TA 5LCWC 4WNGA 3CV0A 3D9MA 5D0QD 1OWMA 3KV6A 1P5QA 4CCGX 3SD5A 4AM9A 1X4UA 3FUDA 3C98A 2YSMA 3CHOA 3EIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N87 A;  2DIW A;  1ELK A;  2C2V S;  3O7A A;  5J08 A;  4UI9 B;  2MOW A;  2K1J A;  1MM3 A;  1MM2 A;  5FEY A;  1MHQ A;  3IHP A;  2VPB A;  1WEP A;  4Q96 A;  4Q6F A;  2L0T B;  2QIC A;  1BOR A;  2L80 A;  1LDK C;  3ASL A;  2MNZ A;  2H0D A;  4YBS A;  5D1L B;  2CSZ A;  4W4U A;  5B79 A;  4N3W A;  2AN6 A;  1WIL A;  2VJE A;  2JMJ A;  3LQI A;  4LLB A;  4V3L C;  2CKL A;  2YT5 A;  2FSA A;  2M85 A;  4R8P K;  4LK9 A;  3N9L A;  3D9J A;  3NG2 A;  2YSJ A;  3MHH A;  3G2W A;  2ECI A;  4YAT A;  2LXH C;  1HG5 A;  2K4D A;  2K16 A;  2I50 A;  2PNX A;  2LV9 A;  1JWG A;  3FL2 A;  2L5U A;  2MUM A;  4PPE A;  2YUR A;  1X5B A;  4WZ2 A;  3HCT A;  2JRJ A;  4IC2 A;  4A4B A;  3DQV R;  3C5K A;  5I3L A;  4AP4 A;  5LCW B;  4QF3 A;  2OXQ C;  4B7Y C;  1HG2 A;  5TBN A;  2CSY A;  5TDW A;  4AVX A;  2VP7 A;  3N9P A;  2MA5 A;  1INZ A;  3O34 A;  1H0A A;  1PY1 A;  1X4J A;  4YAB A;  3HCS A;  1XGW A;  2QY7 A;  3D9O A;  3N9Q A;  4LKA A;  4I7B A;  3PUR A;  2G45 A;  3LQJ A;  5LKU A;  5AIT A;  1DVP A;  3DPL R;  5D1M B;  1VDY A;  1T1H A;  1HYI A;  4NN2 A;  2KRE A;  3O33 A;  4IC3 A;  4AUQ B;  3V43 A;  2FUI A;  3N9M A;  1LF8 A;  4GB0 A;  5FB0 A;  4NAC A;  3GL6 A;  3O36 A;  3SOX A;  2G6Q A;  3N9O A;  5JG6 A;  3QZV A;  2KGI A;  2KWN A;  5C13 A;  2IDA A;  2XB1 A;  2KYU A;  3HTK C;  4MVT A;  3C6W A;  3GV4 A;  3ONK A;  5LP0 A;  3I2D A;  2LO6 A;  2YHN A;  5G0F A;  4QF2 A;  3ZVY A;  4A4C A;  4S3O C;  5B8D A;  5LKZ A;  1V87 A;  2G43 A;  2KR4 A;  5DKA A;  1U6G B;  1VYX A;  1WEU A;  2KM4 A;  1EYH A;  5AIU A;  1CHC A;  1Z60 A;  4FLB A;  4AYC A;  2CKL B;  2HYE D;  3U5N A;  2ECT A;  4WA6 A;  1WEV A;  2V8S E;  3G2T A;  2MIQ A;  4GND A;  2MNY A;  5B75 A;  2ZET C;  5DIN A;  2YQL A;  5C11 A;  4MSX A;  3L1X A;  2EGP A;  3PUQ A;  1JPL A;  3M63 A;  5CMY A;  2C2L A;  5H1U A;  2MT5 A;  4LAD B;  2YW8 A;  2MD8 C;  2LDR A;  4HFG A;  3SOW A;  4UP5 A;  3T6R A;  2QJ0 A;  1LDJ B;  2E6R A;  3PHD A;  3D9N A;  2ECN A;  4V3K C;  2F6N A;  3D9L A;  2JMD A;  2VNF A;  3SOU A;  1Z6U A;  3ONL A;  4YAX A;  1EDU A;  4BBQ A;  1JM7 A;  5FB1 A;  2NAA A;  3RRU A;  3G2S A;  1WEO A;  3RPG C;  4BHW A;  2M6M A;  3N9N A;  3ZYM A;  2YU4 A;  5D1K B;  2L43 A;  3M99 A;  2LGG A;  2Y43 A;  1ZBD B;  3ZPV 1;  1WEN A;  1HX8 A;  5TRB A;  2UZG A;  4YC9 A;  2BAY A;  3O37 A;  3U5O A;  4FJC A;  3O35 A;  2VJF A;  2QIZ A;  3ZTG A;  4WZ3 B;  4B86 C;  3U5P A;  3KNV A;  2L75 A;  4F52 B;  4GZD A;  4LJN A;  2LGK A;  1SZA A;  1WGM A;  3LRQ A;  2M3H A;  1HFA A;  2KWO A;  1VFY A;  4UP0 A;  1WE9 A;  4CA1 A;  3ZVZ B;  2HDP A;  3D9P A;  5B77 A;  2Y1M A;  4N4F A;  5KH9 A;  3RPG B;  3D9K A;  1WEW A;  3D9I A;  1Z2Q A;  4GNG A;  2D8S A;  4FO9 A;  3M62 A;  2F42 A;  2Y1N A;  3VK6 A;  1FP0 A;  2DX8 A;  4L7X A;  3LQH A;  3L11 A;  1WEM A;  4TKP B;  4ZDT A;  3T7L A;  3ZPV E;  5FER A;  3SHB A;  5KH7 A;  1RMD A;  1WEE A;  4FK5 A;  5J3X A;  4O64 A;  3U5M A;  1JM7 B;  2YRE A;  4WZ0 A;  4AYC B;  3KV5 A;  2KWK A;  4R7E A;  2RSD A;  2EOD A;  3RTR B;  2XEU A;  2LN0 A;  4I7D A;  2ECG A;  2KU3 A;  1UJJ A;  2LQ6 A;  2PUY A;  5G04 B;  1WES A;  2EA6 A;  4ZUX U;  1JUQ A;  4YBM A;  4L58 A;  1JWF A;  2YHO A;  4YAD A;  4X3G A;  5B76 A;  1SZ9 A;  1E4U A;  2CT2 A;  4XI1 A;  2RI7 A;  3ZYQ A;  2L0B A;  3L1Z B;  1K2F A;  3KQI A;  4Q94 A;  3EB6 A;  5LKT A;  2K17 A;  1WEQ A;  1HF8 A;  2VPG A;  4A49 A;  2KWJ A;  5LOZ A;  5TAB A;  1WIM A;  2L0I A;  2LRI C;  5H9M A;  4YBT A;  1G25 A;  1UJK A;  2ECV A;  2MD7 B;  1JOC A;  5EYA F;  5KH3 A;  1X4I A;  4A0C D;  5TDR A;  4GNE A;  4I7C A;  2VPE A;  4PTB A;  3O70 A;  3LDZ A;  2KIZ A;  5G05 B;  3G2U A;  4FU3 A;  2LGV A;  1F62 A;  2DCP A;  4P5O B;  2BF0 X;  2MA6 A;  3CLJ A;  5LKX A;  2YUC A;  2KFT A;  3ZYL A;  5H1T A;  4GNF A;  1XWH A;  1VD4 A;  1IYM A;  2H0D B;  2KGG A;  3ZYK A;  4JXT A;  2E6S A;  2LGL A;  2VJF B;  5CMW A;  5H1V A;  2LXP C;  4C9Z A;  2YYR A;  5B78 A;  3HCU A;  4ZQL A;  2VPD A;  1HYJ A;  3MHS A;  3G2V A;  1FBV A;  2ECJ A;  3EB5 A;  4S3O B;  2M1R A;  4FIP A;  4R2Y A;  2ECW A;  2F6J A;  2VJE B;  2FUU A;  4GZC A;  2YQM A;  3ZNI A;  2JMI A;  2KE1 A;  1WFK A;  3KV6 A;  3D9M A;  4CCG X;  1X4U A;  2YSM A; 
#chains in the Genus database with same CATH topology
 2RFM A;  3DPD A;  3W9G A;  3EJN A;  1N94 A;  4UI9 C;  4F7A A;  1MX2 A;  3IXE A;  4DRX E;  4U0U A;  2GRP B;  2PQN A;  4OAV B;  3AS8 A;  4EHM A;  4XKB A;  2DJA A;  5CHE E;  1LDK C;  2H0D A;  4YBS A;  1JCR A;  2VSO E;  4GU5 A;  2VJE A;  1AWC B;  2JMJ A;  1OUV A;  5FWQ A;  2FF4 A;  5EYP F;  2FSA A;  3MX3 A;  4AXH A;  3BG0 B;  3CKB A;  2YSJ A;  3FU3 A;  3NG2 A;  3WXX A;  4HOU A;  4EEC A;  3FUE A;  3U4T A;  1HG5 A;  2Y0B G;  4BX9 A;  1JWG A;  1TYQ G;  4PPE A;  2I2O A;  3WG7 E;  4GTR A;  1DNP A;  3DSU A;  3V2X A;  5CEC B;  4IC2 A;  4A4B A;  2KCL A;  5I3L A;  3DEO A;  3EHQ A;  3E2D A;  5LFA A;  5E75 A;  3DSS A;  4UWL A;  1L5J A;  4RVB A;  5ENR D;  4TXR A;  1INZ A;  3O34 A;  1OWO A;  5BT1 A;  1PY1 A;  3CHR A;  3LY8 A;  4F1P A;  4J6I A;  1X4J A;  2J9Q A;  3EUV A;  3AS5 A;  3TWR A;  3OAW A;  1XGW A;  2WXI A;  2J08 A;  3SUB A;  3N9Q A;  5KNH D;  1FPP A;  4LG6 A;  5LKU A;  3Q15 A;  5EIL A;  5AIT A;  2Y69 E;  3PEU B;  3ZPJ A;  2XZD G;  3GYZ A;  3SQV A;  3O33 A;  3OTN A;  4WND A;  3V43 A;  3T5X A;  2FUI A;  4GTV A;  5BUZ A;  5T4Y A;  5T3R A;  3RO3 A;  3GL6 A;  3SOX A;  1PC2 A;  3PH0 C;  3L16 A;  3TWQ A;  4YDW A;  3DEP A;  5AJD A;  2FO1 E;  2KWN A;  3TWX A;  2XB1 A;  1XNF A;  3HTK C;  3FY4 A;  3CGH A;  2X3M A;  3B7S A;  5G55 A;  3I2D A;  4BSZ B;  2PL2 A;  4QF2 A;  3L17 A;  1UOH A;  4XI0 A;  1GW6 A;  2WXP A;  5B1A E;  4GPK A;  5LKZ A;  4GZ5 A;  3HRA A;  4B8A A;  2LUH A;  3J5Q B;  1OCC E;  4TRQ A;  1N52 A;  1D8D A;  1EYH A;  2AXV A;  2WXM A;  2XOC A;  4UI9 J;  4HRM B;  5FQ8 A;  3JUI A;  1TEZ A;  3CVN A;  2A5U A;  2OND A;  2R17 C;  4I1A A;  1WG0 A;  5CER B;  4E6H A;  3EDT B;  2MNY A;  2YQL A;  1TNZ A;  4IUL A;  5C11 A;  4U07 A;  5ITZ F;  3ASD A;  2EGP A;  1JPL A;  2C2L A;  5H1U A;  2GRM A;  1NL4 A;  3CQG B;  3ML8 A;  4LAD B;  2MD8 C;  4U8V D;  4HFG A;  4KZC A;  3SOW A;  3UTM A;  2YVR A;  4CGV A;  3FU5 A;  3T6R A;  2E6R A;  4HOQ A;  5BV1 A;  2J07 A;  2WXF A;  3D9N A;  2P9K G;  5SVI B;  2F6N A;  3PRZ A;  3CVY A;  3APC A;  3RSE G;  5E76 A;  5FB1 A;  2NAA A;  3RRU A;  1WEO A;  1MJ0 A;  3PVL A;  3CIA A;  2XRY A;  3MA5 A;  4BHW A;  2CRW A;  3ZYM A;  5D1K B;  3FHE A;  1G3N B;  1TN6 A;  3ZPV 1;  4JEU A;  4HOS A;  2CG2 A;  1H2U A;  4YC9 A;  3FTX A;  2WMN A;  3U5O A;  3IKO B;  2DZN A;  3TL5 A;  2QIZ A;  5BPP A;  3JQ1 A;  4B86 C;  4WZ3 B;  2V5F A;  2KZT A;  4O1P A;  3U5P A;  3KNV A;  3CHM A;  5HRY A;  5C2Y A;  4F52 B;  4FLH A;  1HH8 A;  3HXF A;  3L6A A;  4LJN A;  4N5Q A;  1FVF A;  4XI9 A;  1WE9 A;  2XOY A;  4J8D A;  4GTS A;  2MRI A;  3NOG D;  2PZI A;  5ARF A;  2JAB A;  5KBA A;  4N4F A;  2MYO A;  4GNG A;  1NZN A;  3RJV A;  2GRN B;  4OAU C;  3O48 A;  1TN8 A;  4LER A;  3NBN B;  3TAX A;  5SVY A;  4TKP B;  3T8K A;  3CSF A;  3FUI A;  4ANU A;  4PUC A;  3SHB A;  3HXC A;  3Q7A A;  5J3X A;  3N71 A;  4O64 A;  3SFZ A;  2GRL A;  4DX2 A;  4YDE A;  4HQD A;  2V5Q C;  1UJJ A;  3PZ2 A;  2F37 A;  4FAD A;  4GYY A;  4PS7 A;  3ML9 A;  2FFW A;  1JWF A;  2YHO A;  4YAD A;  3TG5 A;  3NOC D;  1O1T A;  4WUY A;  3U66 A;  5B76 A;  2CT2 A;  4GTO A;  2WXK A;  5JMN D;  2IO2 C;  4HOR A;  3FTV A;  1WM5 A;  1Z5S C;  4KVO A;  2LAU A;  3SY2 A;  2B0O E;  1YMP A;  4A49 A;  2CHZ A;  4AIF A;  5TAB A;  2XPZ A;  2R02 A;  2L0I A;  1H6P A;  2KC7 A;  3H7H A;  4JL0 A;  5FIO A;  4R7L A;  4KBQ A;  3C72 A;  2CON A;  2NC9 A;  4GCN A;  4W9R A;  4WNE A;  1JOC A;  4EQF A;  3DSW A;  1S63 A;  3ASH A;  4G24 A;  2XGO A;  4NIK A;  3LDZ A;  2RD0 A;  5G05 B;  3SHF A;  4K0R A;  3HIZ A;  2Y1L E;  2R05 A;  2UY1 B;  4ANV A;  4P5O B;  2BF0 X;  3RKV A;  4AJW A;  3MYV A;  3CK9 A;  1QYM A;  1BU9 A;  4GNF A;  5K3Q A;  2WXR A;  1VD4 A;  3FUF A;  3ZYK A;  3P1U A;  4C0E A;  2J09 A;  4N3B A;  3NZS A;  4GZ6 A;  4ZQL A;  2OVF A;  4ANX A;  2AWI A;  2XZT G;  4TUM A;  1IQR A;  2IFU A;  4FIP A;  2ECW A;  2VJE B;  1E8X A;  3FU6 A;  5KJM A;  3R7Q A;  5ENO D;  3ZNI A;  2KCV A;  3QB2 A;  3QWV A;  3EU9 A;  2JMI A;  1WFK A;  2X6K A;  5EYL A;  2KKX A;  1IXV A;  4YDY A;  2ZIS A;  2YSM A;  3LJN A;  3UKR G;  4CDM A;  4CT4 A;  2DIW A;  1ELK A;  2C2V S;  4MS6 A;  3TWV A;  2K1J A;  4WWP A;  2QFC A;  4Z68 A;  3L22 A;  5FEY A;  3QJZ A;  3S7D A;  3IHP A;  4ATZ D;  1Y8M A;  2A4Z A;  2XHE A;  3ASF A;  3S7B A;  4GYO A;  4Q6F A;  5C1D A;  2QIC A;  1YYH A;  2BKG A;  2ZXW E;  4HI8 A;  2MNZ A;  3EHM A;  1OXJ A;  4X8Q A;  5JJT A;  4Z0R A;  3KEA A;  3Q9U C;  3C3O A;  4HLE A;  2AN6 A;  3FWV A;  1WIL A;  3TG4 A;  1N0Q A;  4N3A A;  2C0L A;  3FUM A;  3IEG A;  3DSV A;  3LQI A;  2YT5 A;  2B6C A;  5DBK A;  4LK9 A;  3CK8 A;  4U95 D;  3N9L A;  1N11 A;  3V79 K;  1N9A A;  4WNF A;  3G2W A;  1Z6T A;  4UQX A;  2K4D A;  2K16 A;  2GGF A;  4DX7 D;  5KJL A;  4AY6 A;  4U0S A;  2LV9 A;  4OVU A;  4PDX A;  2X38 A;  4TUU A;  4P29 A;  2DSM A;  2J8S D;  4WZ2 A;  3UI2 A;  3D3M A;  4H7Y A;  3C5K A;  4I2Z A;  2CFU A;  1NI1 A;  3MKQ B;  5LX8 A;  4QF3 A;  3JYS A;  5LCW B;  2H6H A;  5CED B;  4B7Y C;  4JZY A;  4ACK A;  4IYP A;  2CSY A;  3Q78 A;  3AS4 A;  3ABM E;  3CVP A;  2I1K A;  4KXK B;  2IU1 A;  4CZ2 D;  3MKQ A;  2AJA A;  4C0M A;  2FO7 A;  4KVM A;  4H7X A;  4GA0 A;  3HCS A;  2CFZ A;  3LEW A;  3ASG A;  4XKC A;  3E32 A;  2QY7 A;  3FUJ A;  4LNG A;  4RSY A;  3D9O A;  3PRE A;  4J8Y A;  3TWU A;  4I6G A;  4APO A;  4BX8 A;  3DWD A;  4URK A;  2V4H C;  4NN2 A;  2KRE A;  3CVX A;  3B7T A;  3AJI A;  4DK5 A;  2LSV A;  4N2Q A;  3SF4 A;  5SVX A;  5CRU A;  4NAC A;  3ZFW A;  4ABN A;  2I1J A;  5G04 C;  1A17 A;  3N9O A;  1WY6 A;  4APF A;  5H7P A;  2WQ7 A;  5D66 A;  5LP0 A;  5G0F A;  1W3B A;  3M7K A;  3PZ3 A;  5FQ7 A;  2G43 A;  2EIN E;  2KR4 A;  1JCQ A;  2ILR A;  4AY5 A;  4DLQ A;  1U6G B;  3APD A;  1OWP A;  1WEU A;  1S70 B;  4WAF A;  1E7V A;  2PM7 A;  2KM4 A;  3MV2 B;  1N95 A;  2LSU A;  1IKN D;  1CHC A;  4N5C A;  1E90 A;  4HXI A;  2IOL A;  4AYC A;  2CKL B;  3U5N A;  5EX3 A;  4WA6 A;  2QC9 A;  3JCK C;  3G2T A;  4QQI A;  4L1B A;  2MIQ A;  4GND A;  1ELR A;  5D0O D;  1PAQ A;  1V54 E;  2V0P A;  1EF1 C;  1Q2Z A;  3PS6 A;  4A3T A;  2NSZ A;  2Y4U A;  4LSZ E;  3PUQ A;  3M63 A;  1HU3 A;  5CMY A;  4HVB A;  3AG1 E;  2MT5 A;  3HXD A;  2HR2 A;  1TJC A;  4HRN A;  3V31 A;  5ANR A;  5CBN A;  4GTQ A;  2V4L A;  4F3V A;  4UP5 A;  3PDN A;  1O1S A;  4FP7 A;  3ZU7 B;  1LDJ B;  3FUK A;  1SA4 A;  1IHB A;  1FT1 A;  3UPV A;  5IY5 E;  2KXP C;  1Z6U A;  4BEP A;  4Z0O A;  2OVB A;  3ZHE B;  3Q1D A;  3PZD A;  3ZIM A;  5BXU A;  5AQB A;  3CST A;  2P9S G;  4XIF A;  1LTX A;  5G04 J;  1E8W A;  1HX8 A;  3KSL A;  2H6F A;  4I6E A;  5JHA A;  4BTB A;  2UZG A;  3ZRH A;  2BAY A;  5FQ6 A;  2VJF A;  1TNY A;  5JA4 D;  5ANL A;  5DIZ A;  4CYM D;  3PNT B;  3GZ2 A;  4GZD A;  4J7W A;  5FIN A;  4I9C A;  2LGK A;  1WGM A;  2P9N G;  3URZ A;  3CHP A;  1NFI E;  1N4Q A;  5AQ7 A;  3PE4 A;  3PEV B;  3RPG B;  1WEW A;  3BUA A;  3KDE C;  3E33 A;  3QAQ A;  4KT6 B;  3EIQ C;  2X6H A;  4FO9 A;  3LPZ A;  4A1S A;  2QYJ A;  3FDH A;  3TXN A;  4NRH B;  4L7X A;  3L11 A;  3ZN3 A;  4KMO A;  2AXU A;  5EDS A;  3RO2 A;  4UQZ A;  4FK5 A;  2LXM A;  1UG3 A;  3U5M A;  5KWD A;  2XCB A;  2WXG A;  3KV5 A;  3AU4 A;  3RTR B;  4N2S A;  2XEU A;  2EIJ E;  2KU3 A;  2XS8 A;  2LQ6 A;  2PUY A;  5G04 B;  2EA6 A;  3LVR E;  4L58 A;  4A1G A;  2VGX A;  3UIO C;  5FJY A;  4AP2 A;  1SZ9 A;  1E4U A;  4I1M A;  3UM1 A;  4F1S A;  2IJG X;  4J8S A;  3ZYQ A;  5G05 C;  3VTY A;  2L0B A;  3L1Z B;  1K2F A;  2KZT B;  1KT1 A;  3EB6 A;  4B8C B;  3FEH A;  2K17 A;  3LJU X;  4HLL A;  3B7R L;  1DCE A;  3B13 A;  2HE0 A;  4U04 A;  4I6J A;  4JHR A;  3ZVV A;  4GB9 A;  3CVW A;  4UWG A;  1SQM A;  3UXG A;  2WVI A;  4PS3 A;  2ECV A;  2MD7 B;  5EYA F;  2P9L G;  3MV3 B;  2OOE A;  3ZHE A;  3UKU G;  3ASO E;  3R7R A;  4BY6 A;  3ZW3 A;  1KLX A;  4A0C D;  4JA9 A;  5JHB A;  4I7C A;  2VGE A;  4B93 B;  2CRR A;  3O70 A;  4E85 A;  3Q9N C;  1ZBP A;  1F62 A;  2XOZ A;  3EU5 A;  2YHE A;  3SBS A;  3FTS A;  5BNW A;  4DLO A;  2MA6 A;  4I1O B;  2LXL A;  3LDY A;  3VTX A;  5EKQ D;  2H0D B;  5FTP A;  2LGL A;  2VJF B;  3SZ7 A;  3CKC A;  4C9Z A;  2LNI A;  5FZS A;  3HCU A;  4CEM A;  3JXI A;  3LJ3 A;  2Y3A A;  2VPD A;  1LD8 A;  4OGC A;  2WXH A;  4O6F A;  1FBV A;  3EB5 A;  1D8E A;  2I9C A;  4WWN A;  1V55 E;  4FUL A;  4GZC A;  4RLY A;  3DXM G;  4G1T A;  4CCG X;  1OWM A;  3SD5 A;  4AM9 A;  3T9K A;  3FUD A;  3CHO A;  3B7B A;  3Q47 B;  3EIJ A;  2HM8 A;  3UMV A;  2H6I A;  2XEH A;  1UN9 A;  2MOW A;  5CBO A;  4FHJ A;  3IHY A;  2QZA A;  2WXL A;  4TXQ A;  1WEP A;  4Q96 A;  4ZHB A;  3FU0 A;  2E2E A;  3CVV A;  2PQR A;  1BOR A;  1IHG A;  4G8L A;  3MCX A;  4UWH A;  5FQ4 A;  2H6G A;  2VJ8 A;  3HXB A;  3W9F A;  3LY9 A;  5D1L B;  4W4U A;  5B79 A;  2VYI A;  3S2A A;  1BD8 A;  4DI4 A;  4V3L C;  2CKL A;  4A63 B;  2IY0 C;  1TR4 A;  4WWO A;  2HO1 A;  2ETA A;  3MHH A;  4GTP A;  4YAT A;  1OWN A;  2A5E A;  1E96 B;  2I50 A;  4CDR A;  3NQP A;  4L9P A;  3B7U X;  3FL2 A;  2L5U A;  3NZU A;  1Z3Y A;  2VSY A;  2MUM A;  1X5B A;  3MGB A;  5ENQ D;  3HCT A;  2JRJ A;  4HBD A;  1MX4 A;  3LXU X;  1WAO 1;  1AP7 A;  3SI5 A;  3DQV R;  2AXZ A;  2XP0 A;  3B95 A;  4AP4 A;  3KEZ A;  2Q7F A;  4KYO B;  4AVX A;  2WB2 A;  5TDW A;  3MZL B;  1B89 A;  2XCC A;  4FHK A;  2VP7 A;  3N9P A;  3QAR A;  4GCO A;  4JHK A;  5AN8 A;  3KS2 A;  5AAO A;  4AOF A;  1ZU2 A;  3ENE A;  2XS1 A;  4JA7 A;  3X2Q E;  5KJN A;  5A7D B;  4LKA A;  4A55 A;  2RG8 A;  3KSQ A;  5EID A;  4BET A;  5D2M C;  2FI7 A;  3L82 A;  1QNF A;  2X6J A;  5AQA A;  3DPL R;  1VDY A;  1T1H A;  3AAA C;  1HYI A;  2IQJ A;  3IV0 A;  2P2C P;  2M63 A;  1OWL A;  1U3D A;  4IC3 A;  4AUQ B;  2F0Y A;  2MKE A;  4DX6 D;  3JUE A;  3O4Z A;  2WMO A;  4GB0 A;  4HRL A;  5FB0 A;  1SA5 A;  4G23 A;  3ASN E;  5LCW J;  2IF4 A;  2LAH A;  3O36 A;  2G6Q A;  5JG6 A;  3RIB A;  1NA0 A;  4CGW A;  2KGI A;  4M7C A;  1E8Y A;  3PLW A;  2IDA A;  2KYU A;  2R5S A;  4MVT A;  3OXF A;  1KPS B;  1JCS A;  5AIJ A;  2XEN A;  5B8D A;  1V87 A;  2WPV A;  3CVU A;  3UQ3 A;  1X81 A;  5AJL A;  3VLD A;  3HYM B;  3DRA A;  4I2W A;  4K03 A;  1HS6 A;  5AIU A;  2ETC A;  3S7J A;  3ZNG A;  4YND A;  3QOU A;  4C48 B;  4FLB A;  4CDN A;  2HYE D;  2ECT A;  5CCL A;  4YVQ C;  3QWW A;  1WEV A;  2V8S E;  2GRQ B;  1E8Z A;  2ZET C;  3BQO A;  3L1X A;  3FM8 C;  2M13 A;  1RW2 A;  4K5C A;  5JJ6 A;  1SVX A;  2D8U A;  3PE3 A;  2LDR A;  4DI3 A;  4LEU A;  1K1B A;  4BES A;  3GW4 A;  4K5A B;  2QJ0 A;  3PHD A;  2BED A;  2ECN A;  3TWT A;  4N3C A;  4KZ0 A;  3GZS A;  4N39 A;  5EN5 D;  3D9L A;  2JMD A;  4J8E A;  4U0Z A;  2VNF A;  3SOU A;  4JC8 A;  2E61 A;  3ONL A;  1EDU A;  3UUX A;  4BBQ A;  1QZ2 A;  3AG2 E;  1OY3 D;  1JM7 A;  1EPU A;  1S64 A;  3CEQ A;  4Q69 A;  3G2S A;  4NQ0 A;  2J49 A;  4G2V A;  3EHR A;  3N9N A;  4HB5 A;  2L43 A;  3M99 A;  2KCK A;  1D9S A;  3TWS A;  3AU5 A;  2Y43 A;  3HG0 D;  2UWJ G;  2VSN A;  3ESL A;  3HVE B;  1MBM A;  3UM3 A;  3RRM B;  4J0U A;  3Q75 A;  5ENS D;  2EIK E;  1DC2 A;  3ZUV B;  2NXP A;  5KCM A;  2FEZ A;  1KT0 A;  4U8Y D;  2R03 A;  4XEI G;  5HKP A;  5AEN A;  1MX6 A;  3FH8 A;  2AVP A;  1SZA A;  4XX5 A;  2JUN A;  2M3H A;  3LRQ A;  2KWO A;  3MEK A;  2VTB B;  4GAA A;  4UP0 A;  3LS8 A;  5HQ8 A;  3ZVZ B;  1Y6I A;  2RKK A;  2ZU6 B;  4XE0 A;  3TWW A;  4BWR A;  2Y1M A;  2WXO A;  5KH9 A;  3D9K A;  3GZ1 A;  3PUJ A;  2X6I A;  3DSX A;  3ZEF A;  2D8S A;  2JEK A;  5AQ9 A;  2J4B A;  4F6R D;  3P2B A;  3UIP C;  1FP0 A;  2DX8 A;  1TNO A;  2BUG A;  3U64 A;  3LQH A;  4EZL A;  4ZDT A;  3T7L A;  4EPZ A;  2R2L A;  2CSV A;  5FER A;  3FP3 A;  5KH7 A;  4I9E A;  2XPI A;  5ARG A;  2VGY A;  1WEE A;  2I6H A;  5CEA A;  3HHM A;  4JW1 A;  4BSX A;  1ZB1 A;  5ENP D;  2YRE A;  4AYC B;  4MKT A;  2KWK A;  2RSD A;  4I7D A;  3S7F A;  4FJZ A;  4B89 A;  1BPO A;  1WES A;  4ZUX U;  1OCO E;  4YVO A;  3SFX A;  2E0I A;  3ZKJ A;  3C3R A;  3ISM C;  4MRU A;  2XQ0 A;  2RI7 A;  2L7P A;  1TJF A;  5G2N A;  2KAT A;  4K5B A;  4TV3 A;  3HDX A;  3V2O A;  2OEV A;  3KD7 A;  5LKT A;  1KZP A;  3UT4 A;  5HI7 A;  4ME2 A;  1U2V G;  1IYG A;  4IN3 B;  2VPG A;  3F6Q A;  2KWJ A;  3FUH A;  3C3Q A;  3RK6 A;  4G25 A;  5JJ7 A;  1H2T C;  2CG3 A;  3DPY A;  3UX4 A;  2ETB A;  2LRI C;  2IOS A;  3CK7 A;  1G25 A;  1H2V C;  3PZ4 A;  5T8I A;  4GML A;  3CVL A;  5KH3 A;  2GW1 A;  1FCH A;  1YCS B;  2UY1 A;  1X4I A;  3NF1 A;  2EIL E;  5TDR A;  4L23 A;  4TXP A;  3VLF A;  2J4D A;  2KIZ A;  1BI7 B;  2RR4 A;  4FU3 A;  4D10 C;  3PNL B;  2YQ8 A;  2DCP A;  2VQ2 A;  3L54 A;  4FA6 A;  2DVW A;  5LKX A;  3CLJ A;  3LY7 A;  4JB8 P;  5H1T A;  1BI8 B;  2GRO B;  1XWH A;  1IYM A;  4PH4 B;  4EBA G;  3CHQ A;  3ABL E;  4B94 A;  3MJW A;  2E6S A;  1UN8 A;  3FFL A;  5CMW A;  5H1V A;  4EZK A;  4ACL A;  2LXP C;  4HI9 A;  5B78 A;  4L7T A;  3SBT B;  4O62 A;  3RU0 A;  3NAW A;  5KNG A;  1HYJ A;  1FVH A;  4BT9 A;  3FTU A;  3G2V A;  2XRZ A;  4S3O B;  4H9D A;  1TN7 A;  3FEY A;  1MQS A;  4HNA D;  4R2Y A;  2FUU A;  4AEZ C;  3E4B A;  4B0Z A;  3NB2 A;  3SGH A;  3O47 A;  2YQM A;  3I3N A;  2KE1 A;  1H19 A;  3KV6 A;  1N0R A;  3D9M A;  4WNG A;  1X4U A;  4JD2 G;  5AAR A;  4ATG A;  1N87 A;  4GMR A;  3O7A A;  2OWA A;  5J08 A;  4UI9 B;  3ZXP A;  2FUL A;  1MM3 A;  1MM2 A;  1MHQ A;  2DYR E;  1FT2 A;  1WDY A;  2VSX E;  3QWP A;  2VPB A;  2EXU A;  2RFA A;  1E7U A;  2WXN A;  3FTY A;  4GPM A;  2PNN A;  2L0T B;  2XEV A;  2L80 A;  3BEE A;  5M72 A;  3JXJ A;  4A3V A;  3ASL A;  3SO8 A;  4EZJ A;  1OCZ E;  3J5P A;  3L13 A;  4CRW A;  2CSZ A;  4N3W A;  1OT8 A;  2DBA A;  2CHX A;  1U3C A;  4LLB A;  4LRZ A;  5ENN A;  2M85 A;  4R8P K;  1N4P A;  3D9J A;  2WQH A;  2L6B A;  5AYW D;  5FZQ A;  1RZ4 A;  2YNQ A;  2ECI A;  2LXH C;  4L2L A;  2PNX A;  2YUR A;  3PZ1 A;  2DZO A;  3E34 A;  5BV0 A;  4LNU D;  4C9B B;  2FBN A;  4G8K A;  4UUC A;  4DUI A;  2OXQ C;  4BT8 A;  1HG2 A;  5TBN A;  4RQI A;  1YA0 A;  3VLE A;  3SFY A;  4GA2 A;  4DX5 D;  5BW8 C;  3UT7 A;  3FEX A;  3Q5M A;  2MA5 A;  4BFR A;  2IQC A;  5EIB E;  1H0A A;  1QQE A;  2F8Y A;  4OVV A;  4QQ4 A;  3DDT A;  4YAB A;  4GA1 A;  2KKY A;  2VTB A;  1SW6 A;  3FAO A;  3QC1 A;  4I7B A;  4LNB A;  3PUR A;  3E37 A;  5EX0 A;  2G45 A;  3QDN A;  3LQJ A;  1DVP A;  5D1M B;  1HO8 A;  3KAE A;  4XZ4 A;  2ZIR A;  1NP7 A;  2XGS A;  3C5R A;  3L08 A;  1H6O A;  3CR3 A;  4EBA A;  2AW6 A;  3AG4 E;  4UI9 K;  1O1R A;  3N9M A;  1LF8 A;  1K3Z D;  3TGO A;  1HXI A;  2GRR B;  4ZFH A;  2L9B A;  1LD7 A;  3LYA A;  3ESK A;  3QZV A;  2ION A;  5C13 A;  3T8M A;  4CT0 A;  3C6W A;  4CCA A;  3PUK A;  3ULE G;  3GV4 A;  3ONK A;  2LO6 A;  2YHN A;  4FC8 A;  3T5V A;  4J8F A;  3ZVY A;  4A4C A;  3ABK E;  5KJK A;  4HOT A;  4Y6C A;  4S3O C;  3ZGQ A;  4IRU A;  3U3W A;  3IHV A;  3MDB C;  5DKA A;  1ELW A;  3DST A;  3HXE A;  1VYX A;  5HS0 A;  4LCT A;  2IEJ A;  2EIM E;  2QYU A;  4JPS A;  1N4R A;  2DWZ A;  3UM2 A;  1Z60 A;  2ZGD A;  3FTZ A;  1K1A A;  2CHW A;  2WXJ A;  3OXL A;  5B75 A;  5DIN A;  1UW4 B;  4M3O A;  3Q79 A;  4F53 A;  3FTW A;  4MSX A;  5A6C A;  5BXO A;  3Q7F A;  2OEW A;  5FT9 A;  4G26 A;  1OCR E;  3RRN B;  1MYO A;  2P58 C;  4JVS A;  2YW8 A;  3EHN A;  2DYS E;  4JHJ A;  3K9I A;  2JM3 A;  4O60 A;  4HS2 A;  4V3K C;  2KBX A;  3OXG A;  5B1B E;  3DWL G;  3I4G A;  4YAX A;  2X6F A;  4DJA A;  4V3I A;  2BTD A;  2NYJ A;  1HZ4 A;  4I17 A;  5J90 A;  3Q73 A;  2P9P G;  3DBS A;  4OYS A;  4OGE A;  2OCC E;  3RPG C;  4DX1 A;  4PS8 A;  2M6M A;  2P57 A;  2WXQ A;  3R9M A;  3UT8 A;  2YU4 A;  3CQC B;  2BKK B;  2JLB A;  2P9I G;  2EGM A;  2LGG A;  1ZBD B;  2FD4 A;  5ENT D;  4BTA A;  1WEN A;  4JEH A;  5TRB A;  3BG1 B;  3I5P A;  3O37 A;  3Q4A B;  4FJC A;  3O35 A;  1TNB A;  2PM6 A;  1DCQ A;  3ZTG A;  3LVQ E;  2LAI A;  4U7E B;  2L75 A;  3LCA A;  3QKY A;  2WQ6 A;  1HFA A;  1VFY A;  4CA1 A;  2HDP A;  3TXM A;  3DXK G;  3D9P A;  5B77 A;  5A23 A;  1TNU A;  4U8H A;  2YIN A;  3D9I A;  1Z2Q A;  3M62 A;  3FH5 A;  3JQ0 A;  2R59 A;  2F42 A;  2P9U G;  2Y1N A;  2ZGG A;  3ULY A;  3VK6 A;  3MKR A;  4NUR A;  2WM9 A;  1WEM A;  4U96 D;  3HVE A;  3Q49 B;  2IO3 C;  2F8X K;  3ZPV E;  4L2Y A;  3QK0 A;  1RMD A;  3FH7 A;  1HE8 A;  3E30 A;  4Y6W A;  1K8K G;  5FZR A;  4MLP A;  1JM7 B;  4WZ0 A;  2VGX B;  4R7E A;  2EOD A;  4GTT A;  4G11 A;  2LN0 A;  3R9A B;  4AV7 A;  2ECG A;  3TJP A;  3AG3 E;  1JUQ A;  4YBM A;  1QBQ A;  3CHS A;  4ILI A;  4X3G A;  5B3S E;  3LKU A;  5CRV A;  3CVQ A;  4XI1 A;  3FUL A;  3I4R B;  4UQY A;  2OV8 A;  4O1O A;  3KQI A;  4Q94 A;  3UM0 A;  2EQX A;  2C0M A;  4FJY A;  1WEQ A;  5SVI A;  1HF8 A;  4ILG A;  2XEE A;  4GYW A;  4QFV A;  3SNX A;  4ANW A;  5LOZ A;  3FUN A;  1WIM A;  3APF A;  3L9T A;  4UWF A;  5H9M A;  4YBT A;  3BU8 A;  1H6K A;  4RG9 A;  4BER A;  1UJK A;  5G05 J;  2L6J A;  3RAU A;  1NA3 A;  1S0P A;  4GMJ A;  1MZC A;  3FJU B;  4GNE A;  2VPE A;  4PTB A;  4I43 A;  5CCM A;  3G2U A;  1A5E A;  2LGV A;  1Z3X A;  1N4S A;  3D9H A;  4MBG A;  3V30 A;  4YDO A;  3IBE A;  3U9W A;  4GTM A;  3QNK A;  2XPY A;  2YUC A;  2KFT A;  4UWK A;  3ZYL A;  4ILH B;  4GZ3 A;  2KGG A;  4DPR A;  1O5M A;  4JXT A;  1N54 A;  2MHK A;  1KZO A;  2YYR A;  2XGM A;  3UIN C;  4LUN U;  1BLX B;  2Y4T A;  3ULQ A;  4RG6 A;  3FAN A;  2HYZ A;  1IQU A;  3MHS A;  2ECJ A;  2M1R A;  2F6J A;  3ZXS A;  4U63 A;  2YHC A;  5LCW C;  3CV0 A;  5D0Q D;  1P5Q A;  3C98 A; 
#chains in the Genus database with same CATH homology
 3DPD A;  4ATG A;  2HM8 A;  1N87 A;  3UMV A;  4CDM A;  4CT4 A;  2DIW A;  1ELK A;  3EJN A;  2C2V S;  4MS6 A;  3O7A A;  5J08 A;  1UN9 A;  4UI9 C;  4UI9 B;  2MOW A;  2K1J A;  2FUL A;  4WWP A;  1MM3 A;  2QFC A;  1MM2 A;  3L22 A;  5FEY A;  3QJZ A;  4F7A A;  4FHJ A;  1MHQ A;  3S7D A;  3QWP A;  2VSX E;  3IHY A;  3IHP A;  2VPB A;  1Y8M A;  4U0U A;  2A4Z A;  2WXL A;  1WEP A;  2XHE A;  3ASF A;  2PQN A;  4Q96 A;  3FU0 A;  4CA1 A;  2E2E A;  3AS8 A;  1E7U A;  3S7B A;  2WXN A;  3FTY A;  3CVV A;  4GYO A;  4Q6F A;  2L0T B;  2PQR A;  5C1D A;  2QIC A;  2XEV A;  4XKB A;  1BOR A;  5CHE E;  1IHG A;  3BEE A;  2L80 A;  1LDK C;  3MCX A;  4UWH A;  5M72 A;  4A3V A;  2MNZ A;  3EHM A;  5FQ4 A;  3ASL A;  2VJ8 A;  4EZJ A;  2H0D A;  5JJT A;  4YBS A;  3LY9 A;  3L13 A;  5D1L B;  2VSO E;  4HLE A;  4CRW A;  2CSZ A;  4GU5 A;  4N3W A;  2AN6 A;  4W4U A;  5B79 A;  3FWV A;  1WIL A;  2DBA A;  2VYI A;  3S2A A;  3TG4 A;  4DI4 A;  4A4C A;  2VJE A;  4N3A A;  2JMJ A;  2C0L A;  3FUM A;  3IEG A;  3LQI A;  1OUV A;  5FWQ A;  2CHX A;  1U3C A;  2FF4 A;  4LLB A;  4LRZ A;  2CKL A;  2YT5 A;  2FSA A;  5ENN A;  2M85 A;  4V3L C;  5DBK A;  4R8P K;  3MX3 A;  4AXH A;  4LK9 A;  3CK8 A;  3N9L A;  3BG0 B;  4WWO A;  3D9J A;  2HO1 A;  2WQH A;  3CKB A;  3FU3 A;  2YSJ A;  3WXX A;  3MHH A;  3NG2 A;  4HOU A;  3G2W A;  4WNF A;  5FZQ A;  5AYW D;  4EEC A;  2YNQ A;  2ECI A;  3FUE A;  3U4T A;  1OWN A;  1Z6T A;  1HG5 A;  4UQX A;  4L2L A;  1E96 B;  2GGF A;  4BX9 A;  2K16 A;  5KJL A;  2I50 A;  4CDR A;  2K4D A;  3NQP A;  4AY6 A;  3B7U X;  4U0S A;  2LV9 A;  1JWG A;  4OVU A;  4PDX A;  2X38 A;  2PNX A;  2L5U A;  3FL2 A;  3NZU A;  1Z3Y A;  2VSY A;  2MUM A;  4TUU A;  2I2O A;  4P29 A;  2YUR A;  4PPE A;  1X5B A;  4WZ2 A;  3MGB A;  3D3M A;  5BV0 A;  1DNP A;  3HCT A;  2JRJ A;  3LXU X;  1WAO 1;  4C9B B;  2FBN A;  4IC2 A;  3SI5 A;  3DQV R;  4A4B A;  2KCL A;  4H7Y A;  3C5K A;  4I2Z A;  5I3L A;  2AXZ A;  2CFU A;  4AP4 A;  3MKQ B;  5LX8 A;  4QF3 A;  3JYS A;  3KEZ A;  2OXQ C;  5LCW B;  4B7Y C;  4JZY A;  1HG2 A;  4BT8 A;  4ACK A;  5TBN A;  4IYP A;  2CSY A;  4AYC A;  3U5N A;  2Q7F A;  4KYO B;  4AVX A;  5E75 A;  3AS4 A;  5LFA A;  2WB2 A;  5TDW A;  1YA0 A;  3CVP A;  4UWL A;  3VLE A;  2I1K A;  3MZL B;  4GA2 A;  1L5J A;  4KXK B;  4RVB A;  1B89 A;  2XCC A;  4FHK A;  5BW8 C;  3UT7 A;  2VP7 A;  2IU1 A;  3QAR A;  2LXH C;  3N9P A;  3FEX A;  3Q5M A;  4GCO A;  4JHK A;  4BFR A;  3KS2 A;  2MA5 A;  2IQC A;  1INZ A;  4AOF A;  1ZU2 A;  3MKQ A;  3O34 A;  1H0A A;  1OWO A;  4C0M A;  5BT1 A;  1QQE A;  1PY1 A;  3CHR A;  3ENE A;  3LY8 A;  4OVV A;  2FO7 A;  4JA7 A;  4KVM A;  4J6I A;  1X4J A;  2J9Q A;  4YAB A;  4GA1 A;  3AS5 A;  4H7X A;  4GA0 A;  3HCS A;  3OAW A;  1XGW A;  2CFZ A;  2WXI A;  2J08 A;  3ASG A;  3LEW A;  2QY7 A;  3FUJ A;  4XKC A;  4RSY A;  3D9O A;  5KJN A;  3N9Q A;  3PRE A;  5A7D B;  4LKA A;  3QC1 A;  4A55 A;  4I7B A;  2RG8 A;  3PUR A;  4I6G A;  5EX0 A;  3QDN A;  2G45 A;  3LQJ A;  5LKU A;  3Q15 A;  5AIT A;  3PEU B;  1DVP A;  2FI7 A;  3DPL R;  1QNF A;  1HO8 A;  2X6J A;  3ZPJ A;  4APO A;  4BX8 A;  5D1M B;  3KAE A;  4URK A;  1VDY A;  3GYZ A;  4XZ4 A;  1T1H A;  1HYI A;  1NP7 A;  2XGS A;  3L08 A;  2KRE A;  4NN2 A;  3CR3 A;  3IV0 A;  4EBA A;  3O33 A;  2AW6 A;  2M63 A;  3CVX A;  1OWL A;  1U3D A;  4IC3 A;  3OTN A;  4WND A;  3V43 A;  4AUQ B;  3T5X A;  4UI9 K;  3B7T A;  3O4Z A;  2FUI A;  5BUZ A;  3N9M A;  4DK5 A;  1LF8 A;  5T4Y A;  2WMO A;  4GB0 A;  5FB0 A;  2LSV A;  4G23 A;  5LCW J;  4N2Q A;  3SF4 A;  5T3R A;  3TGO A;  1HXI A;  4NAC A;  3RO3 A;  3ZFW A;  2IF4 A;  4ABN A;  3GL6 A;  2LAH A;  2I1J A;  5G04 C;  3O36 A;  3SOX A;  1A17 A;  1PC2 A;  2L9B A;  3PH0 C;  3LYA A;  2G6Q A;  3ESK A;  3L16 A;  3N9O A;  1WY6 A;  3RIB A;  1NA0 A;  4APF A;  4CGW A;  2KGI A;  5AJD A;  3QZV A;  1E8Y A;  2ION A;  2KWN A;  5C13 A;  2IDA A;  2XB1 A;  3T8M A;  2KYU A;  1XNF A;  2R5S A;  3FY4 A;  4CT0 A;  3HTK C;  4MVT A;  3C6W A;  3CGH A;  2WQ7 A;  2X3M A;  3B7S A;  5G55 A;  3OXF A;  3PUK A;  4CCA A;  3GV4 A;  3ONK A;  5LP0 A;  3I2D A;  2LO6 A;  2YHN A;  5G0F A;  4FC8 A;  3T5V A;  2PL2 A;  4QF2 A;  3L17 A;  1W3B A;  4J8F A;  5AIJ A;  4XI0 A;  1GW6 A;  5KJK A;  2WXP A;  4Y6C A;  4HOT A;  4S3O C;  3ZVY A;  3ZGQ A;  4IRU A;  3U3W A;  4GPK A;  5FQ7 A;  5B8D A;  3IHV A;  5LKZ A;  1V87 A;  4GZ5 A;  2WPV A;  3CVU A;  2G43 A;  3UQ3 A;  4B8A A;  2KR4 A;  2ILR A;  5AJL A;  3VLD A;  5DKA A;  3HYM B;  4AY5 A;  4DLQ A;  1U6G B;  3APD A;  1ELW A;  4TRQ A;  1OWP A;  1N52 A;  1VYX A;  1WEU A;  4WAF A;  1E7V A;  4LCT A;  2PM7 A;  4K03 A;  2KM4 A;  4I2W A;  3MV2 B;  1HS6 A;  1EYH A;  2LSU A;  3S7J A;  5AIU A;  4JPS A;  4YND A;  3QOU A;  4N5C A;  1E90 A;  2AXV A;  4HXI A;  1CHC A;  2WXM A;  1Z60 A;  4FLB A;  2IOL A;  4UI9 J;  4CDN A;  5FQ8 A;  3JUI A;  2CKL B;  2HYE D;  5EX3 A;  3FTZ A;  1TEZ A;  2ECT A;  5CCL A;  3CVN A;  2A5U A;  3QWW A;  2OND A;  2R17 C;  4YVQ C;  1WEV A;  2V8S E;  3JCK C;  3G2T A;  1E8Z A;  4L1B A;  4I1A A;  2MIQ A;  4GND A;  1ELR A;  4E6H A;  2CHW A;  2WXJ A;  3EDT B;  3OXL A;  1PAQ A;  5D0O D;  2MNY A;  2ZET C;  5DIN A;  1UW4 B;  2V0P A;  5B75 A;  1EF1 C;  4M3O A;  2YQL A;  4F53 A;  3PS6 A;  3FTW A;  4IUL A;  4MSX A;  4A3T A;  5C11 A;  5A6C A;  4U07 A;  2NSZ A;  3L1X A;  2EGP A;  2Y4U A;  3ASD A;  4G26 A;  5FT9 A;  1JPL A;  3M63 A;  3PUQ A;  1HU3 A;  5CMY A;  2C2L A;  3RRN B;  4HVB A;  5H1U A;  2GRM A;  2MT5 A;  2P58 C;  3CQG B;  3ML8 A;  5JJ6 A;  2HR2 A;  1TJC A;  4JVS A;  5ANR A;  4LAD B;  2YW8 A;  3EHN A;  2MD8 C;  3PE3 A;  2LDR A;  4HFG A;  2V4L A;  4KZC A;  4F3V A;  3SOW A;  4UP5 A;  4DI3 A;  3PDN A;  4CGV A;  3FU5 A;  4LEU A;  3T6R A;  3GW4 A;  2QJ0 A;  4FP7 A;  1LDJ B;  4JHJ A;  3K9I A;  2E6R A;  4HOQ A;  3FUK A;  3PHD A;  5BV1 A;  2J07 A;  2WXF A;  3D9N A;  2ECN A;  4HS2 A;  4N3C A;  4KZ0 A;  3UPV A;  3GZS A;  4N39 A;  4V3K C;  3OXG A;  2F6N A;  3PRZ A;  3D9L A;  2JMD A;  3CVY A;  3APC A;  4J8E A;  3I4G A;  4U0Z A;  2VNF A;  3SOU A;  4JC8 A;  1Z6U A;  3ONL A;  4YAX A;  1EDU A;  2X6F A;  3UUX A;  4DJA A;  4BBQ A;  1QZ2 A;  4V3I A;  2OVB A;  5E76 A;  3ZHE B;  2BTD A;  3PZD A;  1HZ4 A;  1EPU A;  4I17 A;  3ZIM A;  5J90 A;  2NAA A;  5FB1 A;  1JM7 A;  3CEQ A;  3RRU A;  4Q69 A;  3G2S A;  4NQ0 A;  1WEO A;  3DBS A;  4OYS A;  3RPG C;  2J49 A;  3PVL A;  3CIA A;  2XRY A;  3MA5 A;  4G2V A;  3CST A;  4BHW A;  4PS8 A;  2M6M A;  3N9N A;  2WXQ A;  3UT8 A;  3ZYM A;  4XIF A;  2YU4 A;  5D1K B;  5G04 J;  3FHE A;  2L43 A;  3M99 A;  3CQC B;  2JLB A;  2KCK A;  2LGG A;  1E8W A;  3AU5 A;  2Y43 A;  1ZBD B;  3ZPV 1;  4BTA A;  4JEU A;  2UWJ G;  2VSN A;  3ESL A;  3HVE B;  1HX8 A;  2CG2 A;  3Q47 B;  4HOS A;  1WEN A;  4JEH A;  5TRB A;  1H2U A;  4I6E A;  5JHA A;  4BTB A;  2UZG A;  3RRM B;  4YC9 A;  4J0U A;  3BG1 B;  3I5P A;  3FTX A;  3ZRH A;  2WMN A;  2BAY A;  3Q4A B;  3O37 A;  3U5O A;  4FJC A;  5FQ6 A;  3IKO B;  3O35 A;  2VJF A;  3TL5 A;  2NXP A;  2PM6 A;  5KCM A;  2QIZ A;  5BPP A;  3JQ1 A;  3ZTG A;  2FEZ A;  3LVQ E;  5ANL A;  2LAI A;  2KZT A;  1KT0 A;  2V5F A;  5DIZ A;  4WZ3 B;  3U5P A;  3KNV A;  3CHM A;  3PNT B;  5AEN A;  3GZ2 A;  2L75 A;  5C2Y A;  4F52 B;  4GZD A;  4FLH A;  1HH8 A;  3L6A A;  4LJN A;  5LKX A;  4I9C A;  3FH8 A;  2LGK A;  3LCA A;  2AVP A;  3QKY A;  1SZA A;  4XX5 A;  2WQ6 A;  1WGM A;  1HFA A;  2KWO A;  2M3H A;  1VFY A;  3LRQ A;  1FVF A;  3MEK A;  4GAA A;  4XI9 A;  3LS8 A;  2VTB B;  5HQ8 A;  1WE9 A;  4UP0 A;  2HDP A;  3ZVZ B;  3TXM A;  3CHP A;  4J8D A;  1Y6I A;  3URZ A;  2ZU6 B;  3D9P A;  4XE0 A;  5A23 A;  5B77 A;  2MRI A;  5ARF A;  2PZI A;  4BWR A;  3PE4 A;  3PEV B;  4U8H A;  2Y1M A;  2WXO A;  2YIN A;  4N4F A;  5KH9 A;  3RPG B;  3D9K A;  3GZ1 A;  3PUJ A;  2X6I A;  3D9I A;  1WEW A;  1Z2Q A;  3QAQ A;  3ZEF A;  4KT6 B;  3EIQ C;  1NZN A;  2D8S A;  2X6H A;  3RJV A;  4FO9 A;  4GNG A;  3LPZ A;  4A1S A;  3M62 A;  3FH5 A;  2JEK A;  3JQ0 A;  2R59 A;  2F42 A;  3FDH A;  3O48 A;  4LER A;  2Y1N A;  2J4B A;  3P2B A;  3TXN A;  3VK6 A;  1FP0 A;  3MKR A;  4NRH B;  3TAX A;  2BUG A;  3U64 A;  2DX8 A;  4NUR A;  3LQH A;  4L7X A;  3L11 A;  2WM9 A;  1WEM A;  4EZL A;  4TKP B;  4ZDT A;  3T7L A;  3ZN3 A;  3HVE A;  3Q49 B;  4EPZ A;  3CSF A;  4KMO A;  3FUI A;  4ANU A;  4PUC A;  3ZPV E;  4L2Y A;  5FER A;  3SHB A;  3FP3 A;  2AXU A;  3QK0 A;  1RMD A;  5KH7 A;  3FH7 A;  3RO2 A;  5EDS A;  1HE8 A;  4I9E A;  4UQZ A;  2XPI A;  5ARG A;  4Y6W A;  2VGY A;  1WEE A;  2I6H A;  4FK5 A;  3N71 A;  1UG3 A;  5J3X A;  5FZR A;  3HHM A;  4JW1 A;  4O64 A;  4MLP A;  3U5M A;  2XCB A;  4BSX A;  1JM7 B;  2YRE A;  4WZ0 A;  4MKT A;  4AYC B;  2VGX B;  2WXG A;  3SFZ A;  3KV5 A;  2KWK A;  2GRL A;  4R7E A;  2RSD A;  2EOD A;  3AU4 A;  3RTR B;  4N2S A;  4G11 A;  2LN0 A;  2XEU A;  4I7D A;  3S7F A;  4FJZ A;  3R9A B;  4B89 A;  4AV7 A;  2ECG A;  1UJJ A;  3TJP A;  2KU3 A;  2LQ6 A;  2PUY A;  1BPO A;  5G04 B;  1WES A;  2EA6 A;  4FAD A;  4ZUX U;  3LVR E;  4GYY A;  4PS7 A;  4YVO A;  1JUQ A;  4YBM A;  3ML9 A;  4L58 A;  1JWF A;  2E0I A;  4A1G A;  5JG6 A;  2VGX A;  2YHO A;  3CHS A;  3TG5 A;  4YAD A;  5FJY A;  4ILI A;  4X3G A;  4AP2 A;  4WUY A;  3U66 A;  5B76 A;  1SZ9 A;  1E4U A;  4MRU A;  3LKU A;  2XQ0 A;  2KE1 A;  2CT2 A;  4I1M A;  3CVQ A;  2RI7 A;  4XI1 A;  4F1S A;  3FUL A;  1TJF A;  2IJG X;  5G2N A;  2KAT A;  4TV3 A;  3HDX A;  4J8S A;  3ZYQ A;  2WXK A;  5G05 C;  3I4R B;  3VTY A;  4UQY A;  2L0B A;  3L1Z B;  1K2F A;  2OV8 A;  2KZT B;  1KT1 A;  1WM5 A;  3FTV A;  4Q94 A;  4HOR A;  2EQX A;  3KQI A;  3KD7 A;  3EB6 A;  4B8C B;  2C0M A;  5LKT A;  2K17 A;  4KVO A;  4FJY A;  1WEQ A;  1HF8 A;  4ILG A;  3UT4 A;  5HI7 A;  4ME2 A;  3B7R L;  4B86 C;  4GYW A;  1IYG A;  4QFV A;  3B13 A;  4IN3 B;  3SNX A;  4ANW A;  2VPG A;  4A49 A;  2KWJ A;  3FUH A;  5LOZ A;  3FUN A;  4G25 A;  3RK6 A;  1H2T C;  5JJ7 A;  2CG3 A;  4WA6 A;  2CHZ A;  3UX4 A;  4AIF A;  5TAB A;  4U04 A;  2XPZ A;  1WIM A;  1WFK A;  3APF A;  2L0I A;  2KC7 A;  4I6J A;  4JHR A;  2LRI C;  3ZVV A;  4UWF A;  4YAT A;  5H9M A;  4GB9 A;  4YBT A;  4JL0 A;  3CVW A;  4R7L A;  4KBQ A;  1H6K A;  2IOS A;  3CK7 A;  4RG9 A;  1UJK A;  1SQM A;  4UWG A;  1H2V C;  5G05 J;  1G25 A;  5T8I A;  2L6J A;  2NC9 A;  2WVI A;  4GCN A;  4GML A;  4PS3 A;  4W9R A;  4WNE A;  3CVL A;  2ECV A;  1NA3 A;  1S0P A;  3MV3 B;  1JOC A;  2MD7 B;  5EYA F;  2OOE A;  4GMJ A;  3ZHE A;  2GW1 A;  4EQF A;  5KH3 A;  1FCH A;  2UY1 A;  1X4I A;  3R7R A;  4BY6 A;  3NF1 A;  3ZW3 A;  1KLX A;  4A0C D;  5TDR A;  4JA9 A;  4L23 A;  5JHB A;  3VLF A;  4GNE A;  3ASH A;  4I7C A;  2VPE A;  4G24 A;  2XGO A;  4PTB A;  4I43 A;  3O70 A;  2VTB A;  2J4D A;  4E85 A;  3LDZ A;  5CCM A;  1ZBP A;  2RD0 A;  2KIZ A;  5G05 B;  3SHF A;  3G2U A;  4FU3 A;  4D10 C;  2LGV A;  3PNL B;  4K0R A;  1F62 A;  1Z3X A;  3HIZ A;  2YHE A;  2YQ8 A;  2DCP A;  2UY1 B;  3SBS A;  3FTS A;  2VQ2 A;  3L54 A;  4ANV A;  4FA6 A;  4P5O B;  2BF0 X;  3RKV A;  4AJW A;  4DLO A;  3MYV A;  3IBE A;  3CK9 A;  3U9W A;  5BNW A;  2MA6 A;  3CLJ A;  3LY7 A;  2XPY A;  3QNK A;  4I1O B;  2KFT A;  2YUC A;  4UWK A;  3ZYL A;  4GNF A;  5H1T A;  2WXR A;  4ILH B;  3VTX A;  1VD4 A;  1XWH A;  4GZ3 A;  4PH4 B;  5EKQ D;  3CHQ A;  4EBA G;  1IYM A;  4B94 A;  3MJW A;  2H0D B;  4DPR A;  5FTP A;  2KGG A;  3FUF A;  3ZYK A;  4JXT A;  2E6S A;  2LGL A;  1N54 A;  2MHK A;  2VJF B;  1UN8 A;  3SZ7 A;  3P1U A;  3FFL A;  5CMW A;  5H1V A;  4EZK A;  3CKC A;  4ACL A;  2LXP C;  2YYR A;  4C9Z A;  4C0E A;  5B78 A;  2XGM A;  2J09 A;  4N3B A;  2LNI A;  5FZS A;  3NZS A;  4L7T A;  4GZ6 A;  4LUN U;  3SBT B;  2JMI A;  3HCU A;  4CEM A;  4ZQL A;  3RU0 A;  2Y4T A;  3LJ3 A;  2OVF A;  3ULQ A;  2Y3A A;  4RG6 A;  4ANX A;  2VPD A;  2HYZ A;  1HYJ A;  1IQU A;  1FVH A;  3MHS A;  2WXH A;  2AWI A;  4O6F A;  4BT9 A;  3FTU A;  3G2V A;  2XRZ A;  1FBV A;  1IQR A;  2I9C A;  2ECJ A;  4WWN A;  3EB5 A;  4S3O B;  2IFU A;  3FEY A;  1MQS A;  2M1R A;  4FIP A;  2ECW A;  4R2Y A;  2F6J A;  4FUL A;  2VJE B;  1E8X A;  3FU6 A;  2FUU A;  4AEZ C;  3E4B A;  4B0Z A;  4GZC A;  3SGH A;  5KJM A;  3R7Q A;  3ZXS A;  2YQM A;  3ZNI A;  2KCV A;  3QB2 A;  3QWV A;  3I3N A;  4U63 A;  2YHC A;  1H19 A;  2X6K A;  4G1T A;  5LCW C;  4WNG A;  3CV0 A;  3D9M A;  5D0Q D;  1OWM A;  3KV6 A;  1P5Q A;  4CCG X;  3SD5 A;  4AM9 A;  1X4U A;  3FUD A;  3C98 A;  2YSM A;  3CHO A;  3EIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...