4AVXA

Hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) bound to an ip2 compound at 1.68 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
GTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Tandem Vhs and Fyve Domains of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) Bound to an Ip2 Compound at 1.68 A Resolution
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE SUBSTRATE
total genus 72
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4avxA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4avxA02
5TDWA 2YQLA 3LQIA 5J3XA 3DQVR 3HTKC 2KFTA 3G2WA 2CSZA 2KGIA 2YU4A 2KYUA 4HFGA 3ZPV1 1DVPA 4AYCB 3D9OA 4XI1A 4S3OB 3O37A 4QF3A 3EB5A 4V3KC 1EYHA 1UJJA 4IC3A 2C2LA 2VPDA 5LP0A 3G2UA 2FSAA 1X4IA 4YBSA 4YATA 2M1RA 3G2TA 2CT2A 3LQHA 5B76A 2M6MA 3KV6A 1Z2QA 2FUIA 5B79A 1WIMA 2QJ0A 1WEQA 2F6NA 4UI9B 5G05B 4YBMA 4GZDA 1VFYA 2ECVA 2AN6A 2MOWA 2MNZA 5LCWB 4R7EA 3VK6A 4MSXA 2BAYA 1U6GB 4A4BA 5G0FA 1PY1A 1X5BA 4AUQB 5H1UA 2QICA 4JXTA 4FO9A 4WA6A 3PHDA 2LXPC 2IDAA 2JRJA 2L80A 2KWNA 3L1XA 2LGGA 2XEUA 4ZDTA 2YHNA 5LKUA 3D9PA 2LGVA 1WGMA 2K1JA 2VPBA 2Y43A 2XB1A 2LGKA 4LLBA 2ECGA 2K4DA 2ECNA 2YSMA 5FERA 2YREA 5DKAA 1JPLA 5B75A 4F52B 2YURA 1WEEA 1V87A 1WEPA 4MVTA 1Z60A 1JM7B 3NG2A 1JM7A 3M62A 2EGPA 1XGWA 2M3HA 2PUYA 3ZYLA 3O34A 4ZQLA 5B78A 2F42A 3N9MA 2L0BA 3DPLR 1SZAA 5C13A 3U5NA 3D9MA 1RMDA 2YW8A 4GB0A 2K17A 3N9PA 2KREA 5I3LA 1LDKC 3U5PA 2JMIA 5C11A 2KWJA 4R8PK 2YT5A 5TBNA 2MA6A 5DINA 5J08A 5H9MA 5LKXA 4B86C 2KR4A 2ECWA 1HG2A 1MHQA 3ZYQA 2HYED 2H0DB 2E6SA 3ZVYA 5LKTA 2VJFB 3SHBA 3ZPVE 3ZYMA 2MUMA 4L58A 1VD4A 2V8SE 3N9OA 2PNXA 5CMWA 3T6RA 3QZVA 1HYIA 2LQ6A 2VP7A 5H1TA 2CKLB 2L75A 1LDJB 3RPGC 2KWKA 4A49A 4GNEA 2BF0X 1WEVA 2CKLA 4FK5A 4YC9A 5G04B 2MD8C 4Q94A 1JWFA 3SOUA 2YSJA 3GL6A 1HX8A 3I2DA 2RI7A 1ZBDB 3D9IA 5TABA 4V3LC 4YAXA 1WEOA 1X4JA 2G45A 2L5UA 3IHPA 1FBVA 2CSYA 2KU3A 5D1MB 3D9LA 2YHOA 2DCPA 1Z6UA 2FUUA 4GNFA 3SOXA 2DIWA 3D9KA 2OXQC 1CHCA 4GNDA 2VNFA 3ONKA 4A0CD 5D1KB 1MM3A 2KE1A 2VPEA 2KM4A 3O35A 5KH3A 3LDZA 1WILA 2Y1NA 4BBQA 1WENA 1ELKA 5KH7A 2VJEA 2VPGA 1JWGA 4I7CA 2JMJA 2LO6A 2VJEB 4FJCA 4N4FA 1MM2A 4FU3A 2MNYA 1HG5A 1WEMA 3MHHA 3HCSA 2K16A 3RPGB 5B77A 1WESA 5B8DA 2L0TB 1WE9A 2H0DA 5CMYA 3ZNIA 2E6RA 2VJFA 2L43A 2DX8A 4BHWA 5LOZA 1K2FA 1N87A 1JUQA 4NACA 4ZUXU 5TDRA 1WEWA 4QF2A 4CCGX 2RSDA 2D8SA 2C2VS 3CLJA 1SZ9A 2I50A 3PURA 2L0IA 4CA1A 1VDYA 1JOCA 1INZA 2EODA 3O33A 2ECTA 3U5OA 1T1HA 1WEUA 3O36A 2LRIC 3ZYKA 5KH9A 4S3OC 3M99A 4PTBA 2KGGA 3FL2A 2MIQA 2QY7A 2MT5A 3M63A 2MA5A 4AP4A 3V43A 1UJKA 4UP5A 4I7BA 2LN0A 2HDPA 2LXHC 4UP0A 5FB0A 4I7DA 5TRBA 4C9ZA 1F62A 5AITA 2YQMA 4YABA 1X4UA 4A4CA 1EDUA 4FIPA 4N3WA 3KQIA 3KV5A 2JMDA 1FP0A 1E4UA 3G2VA 3RTRB 1IYMA 5FB1A 4LK9A 4WZ0A 3HCUA 4GNGA 1HF8A 1HFAA 4FLBA 4IC2A 4AYCA 3PUQA 3G2SA 4Q96A 3GV4A 1XWHA 5LKZA 3HCTA 2Y1MA 3D9JA 2YYRA 2KWOA 5EYAF 4TKPB 2NAAA 4GZCA 1LF8A 2G43A 4LKAA 2G6QA 3LRQA 4B7YC 2LV9A 4NN2A 4O64A 2M85A 3ONLA 3L11A 2LDRA 3D9NA 5JG6A 2ECIA 3N9QA 5D1LB 2MD7B 1VYXA 2EA6A 3O70A 4PPEA 4AVXA 2UZGA 2ZETC 4X3GA 3MHSA 1BORA 4LJNA 3SOWA 3LQJA 4Q6FA 3N9NA 3U5MA 5H1VA 2ECJA 1HYJA 2YUCA 3RRUA 4YBTA 2LGLA 4P5OB 3ZTGA 4L7XA 4WZ3B 3EB6A 2KIZA 3ZVZB 5AIUA 3N9LA 4LADB 3ASLA 3T7LA 1H0AA 4W4UA 2QIZA 3KNVA 3L1ZB 5FEYA 3C5KA 3C6WA 3O7AA 4WZ2A 4YADA 1G25A 4R2YA 1WFKA 2F6JA
chains in the Genus database with same CATH superfamily
5FINA 5KJKA 2YQLA 3LQIA 3UPVA 3AAAC 4CRWA 5AQBA 3U4TA 2KFTA 3QWPA 4OVVA 2DZOA 2CSZA 2KGIA 3GZ2A 4YNDA 3PZ4A 4GB9A 2V4LA 2IEJA 3O37A 5B1AE 3CVWA 4CCAA 2LAIA 2C2LA 3DSTA 1Q2ZA 3G2UA 5LP0A 4FHKA 1MBMA 3CVNA 1O5MA 4I6GA 5ENOD 1X4IA 4NURA 3TWSA 4YATA 2M1RA 2CT2A 3KV6A 2Y4TA 3JXJA 2Y3AA 3FHEA 1H6OA 3QKYA 1Z2QA 1U2VG 5B79A 3ZRHA 1N4PA 2L7PA 3EDTB 2GRRB 4GZDA 4DX5D 2MOWA 2J07A 5JHAA 5LCWB 1JCRA 3FEXA 3Q9NC 4LUNU 2WPVA 4BSXA 4AXHA 4AUQB 2QICA 4FO9A 4WA6A 2XEHA 2JRJA 2F8YA 4KZCA 1B89A 3NQPA 2WQHA 4HLLA 3PDNA 3EIQC 4M7CA 4PS7A 5EN5D 2YHNA 3LJUX 3DSXA 2LGVA 4G8LA 1KLXA 2F8XK 3AG3E 3BG1B 1WG0A 4XKCA 3L08A 2LGKA 4LLBA 2IU1A 2IQCA 1WY6A 2ECGA 3MV3B 5FERA 3W9FA 3QB2A 2YHCA 2GW1A 2YURA 4IN3B 4ANUA 1ELRA 4TRQA 4I2ZA 1V87A 1WEPA 4JA7A 4LNGA 1NI1A 1E7VA 4HS2A 2Y0BG 1BD8A 3SF4A 5CRVA 2WXGA 3MYVA 3PEUB 4JHJA 2CHXA 2WMOA 3C5RA 2F42A 4HI9A 4I6JA 3FU5A 1N95A 1H2TC 3D9MA 5AQ7A 2K17A 1AP7A 2KREA 1LDKC 3Q1DA 3U5PA 1O1TA 3U66A 2JMIA 3LPZA 3MKQB 4KVOA 1N0QA 2XCCA 2YT5A 5DINA 5J08A 2EINE 5H9MA 4B86C 2HYED 2FFWA 3CQCB 4DLOA 3OXFA 3ZFWA 3ZVYA 4J8EA 4R7LA 5CCLA 3SHBA 3UT7A 2V5FA 1UG3A 3ABME 4DJAA 4EBAA 2YNQA 4N3CA 2PNXA 2KXPC 4AM9A 4CGWA 2QYUA 2IY0C 3QZVA 4MRUA 3QWVA 5CBNA 1E7UA 2LAHA 3CHQA 2GRQB 3RPGC 4GNEA 3C98A 2BF0X 3FANA 2J08A 4WUYA 5EIBE 1BU9A 2L6JA 2KZTB 2Y69E 3E4BA 5J90A 2LUHA 3ZHEA 3EU9A 3UT4A 4V3LC 1Z3XA 3AG2E 5FZRA 3UM1A 4ANVA 4HOUA 4YDYA 3FY4A 4JVSA 3GZSA 5D1MB 1TN6A 5H7PA 1P5QA 4UWGA 1Z6UA 3KSLA 4CGVA 2H6GA 3E34A 4WWNA 2VGYA 2IOSA 2OXQC 4NRHB 3CEQA 4I6EA 3SI5A 3C3OA 4HXIA 4A0CD 3E33A 1MM3A 2JLBA 2VPEA 5KH3A 1HXIA 1TEZA 3LY8A 1WENA 2UY1A 3DSSA 3FTUA 5A7DB 5ANRA 4AJWA 3W9GA 3ZXSA 4BESA 2LXLA 3EHRA 3JQ1A 4F3VA 2LO6A 3HYMB 2X3MA 4XE0A 2JEKA 4FU3A 3FDHA 3HVEB 2MNYA 4U96D 3SBTB 5BXOA 3Q4AB 4OAVB 4YVQC 2F0YA 3HCSA 3QK0A 3PZ1A 1WE9A 5T3RA 1YYHA 2YINA 4W9RA 1JUQA 1WEWA 3V2XA 1MX6A 3TGOA 2EQXA 3FTSA 3TXMA 2D8SA 3DXMG 3UM0A 2C2VS 1SZ9A 4UWKA 2CG2A 2RG8A 2WXJA 3Q79A 4F1SA 4GTSA 5BW8C 2FO1E 1JOCA 3EHNA 1DCQA 3SBSA 5G04C 4Z0RA 4BT8A 3ZEFA 4UI9J 2WXMA 2QC9A 4EZJA 5CECB 4GCNA 3VLFA 2MIQA 4GTRA 1SA5A 3LVQE 2MRIA 3UUXA 3SO8A 5ITZF 4A3TA 4I7BA 2LN0A 1MX2A 3QC1A 2WXRA 3GW4A 2PZIA 3GZ1A 2CRRA 4UI9K 4G24A 3FUKA 2NC9A 3ZUVB 2FI7A 2JABA 4FIPA 4JL0A 4HBDA 4BFRA 4B8AA 1PAQA 5HS0A 3RO3A 3R7RA 4DX6D 3UINC 4LK9A 4DX7D 2LXMA 4H7YA 5BT1A 3NZUA 4KXKB 4H9DA 4IC2A 2RKKA 4AYCA 3LY9A 4QQIA 3DRAA 2MYOA 3L13A 1E8WA 4HOTA 4N5QA 3E30A 5EYLA 3DDTA 1NFIE 5LKZA 1N9AA 3ZKJA 4YDOA 3O47A 5ENSD 4Q69A 2X6FA 2NAAA 1HS6A 1H19A 2G6QA 2LV9A 2ETAA 3K9IA 1UN8A 3IHYA 2WQ6A 2CRWA 4KVMA 5C1DA 2ECIA 3Q5MA 1VYXA 4U8YD 2EA6A 2D8UA 4DPRA 3DSWA 3EJNA 3MHSA 4P29A 2YVRA 2PQRA 2IONA 1HE8A 4LJNA 3SOWA 4Q6FA 2A4ZA 3DSVA 5H1VA 2DZNA 2ECJA 2C0MA 3T8MA 1HYJA 4L7XA 1TNBA 2IQJA 3L16A 4Z68A 1BPOA 1OCZE 3N9LA 5AIUA 4PH4B 4Y6WA 5M72A 3Q9UC 3DWDA 4JA9A 1S0PA 3T7LA 2P9PG 5JMND 3L1ZB 5ENPD 3C6WA 3O7AA 4WZ2A 3AU4A 1WFKA 2F6JA 2XOZA 3PUKA 5TDWA 4U7EB 4ANXA 1S64A 4ABNA 2F37A 5CCMA 4HFGA 5AN8A 2CHWA 4L2LA 3AU5A 5KJNA 5KJMA 3D9OA 2XGMA 4S3OB 5ANLA 4QF3A 3EB5A 3UIPC 2VPDA 2VSNA 3E32A 4RG9A 2R2LA 4I1AA 2FSAA 3OXLA 3CSFA 5A6CA 1D9SA 2BKKB 1W3BA 3G2TA 3LQHA 4EECA 3S2AA 1V54E 4A3VA 1SVXA 3LYAA 2QFCA 2FUIA 2NXPA 3MA5A 1WEQA 4IRUA 1MYOA 5HI7A 4YVOA 1VFYA 2ECVA 2E0IA 4I1MA 4FP7A 4JHRA 2AXVA 2AN6A 3KEZA 1TNZA 4U63A 4U95D 2NSZA 4TV3A 3CK8A 4A4BA 5G0FA 1YCSB 1X5BA 3UT8A 1A5EA 3B13A 2IDAA 1OWOA 2KWNA 4U07A 4DX2A 4XZ4A 2MKEA 2FD4A 3Q75A 5LKUA 3IHVA 3SNXA 4J7WA 4XI9A 2VPBA 5AAOA 2XB1A 3FULA 4I9CA 2DJAA 2ECNA 2KCLA 5DKAA 4BX8A 5KCMA 1NZNA 4WWOA 4F52B 4MVTA 1Z60A 3MV2B 1JM7B 3M62A 3PLWA 2IF4A 3ZGQA 1MX4A 3KSQA 4U04A 2M3HA 4G26A 2PQNA 2AXZA 1JCSA 1TN8A 3FUIA 3PRZA 2X6HA 3N9MA 3DPLR 2J09A 3LJ3A 2WB2A 3JCKC 4GZ6A 5C13A 3HHMA 4EZLA 1ELWA 1TR4A 3U5NA 2J4BA 3R9MA 5LCWJ 4FLHA 1SA4A 2J8SD 4WNFA 1N52A 5C11A 3R9AB 3MKRA 2WXNA 3T5VA 2KWJA 2EIJE 4R8PK 1KZPA 2KC7A 3MKQA 4G1TA 2ECWA 3ASNE 2ETBA 4O1OA 3B7UX 3DPYA 2H0DB 3PZDA 2WXPA 2VJFB 4C9BB 3RU0A 2WVIA 3ISMC 3SHFA 1HYIA 3U9WA 2LQ6A 4RVBA 4K0RA 4GTPA 3V31A 2KWKA 2XENA 4J0UA 4APOA 2R03A 4I17A 4FK5A 1N0RA 3O4ZA 2MD8C 1HH8A 3D3MA 1FT2A 5BV0A 3L17A 2KZTA 5CERB 2J9QA 1ZBDB 3D9IA 2WXOA 4A55A 4Y6CA 1WEOA 1X4JA 1FBVA 3Q78A 1YA0A 1HU3A 3D9LA 2WXQA 3HRAA 2XQ0A 1OCRE 2J49A 1OWNA 4DRXE 3HXFA 3KDEC 4J8SA 2L6BA 5LX8A 1YMPA 3ONKA 2M13A 5D1KB 3FTWA 2KM4A 2DWZA 5B3SE 3O35A 3BEEA 3LXUX 3LDZA 1TN7A 4BBQA 5ENQD 4ACKA 2GROB 4N2QA 2CFZA 5CEAA 1FT1A 1WAO1 2VJEA 2EXUA 4I7CA 4MBGA 2JMJA 3FTZA 4FC8A 3UQ3A 1IHGA 3ZVVA 4BETA 2ZU6B 3MJWA 1QYMA 2VYIA 3U3WA 2K16A 3HVEA 4UQXA 2ONDA 3ASGA 3CVPA 3IV0A 5CMYA 4UI9C 1LD8A 4TUUA 5EILA 2WM9A 2L43A 4KYOB 4NACA 1TNOA 2JM3A 3PUJA 3FTVA 2E2EA 4CCGX 3FM8C 4K5AB 2I50A 2XZDG 4OYSA 5E75A 5HKPA 4AP2A 4I2WA 1VDYA 4G11A 1INZA 3O33A 4TXRA 3TWTA 2ECTA 2ILRA 4GMRA 3UKRG 5G05C 3ZYKA 4S3OC 5SVIA 5DBKA 3FH7A 3M99A 4PTBA 4RG6A 2KGGA 2I1JA 2QY7A 2DYRE 3PZ3A 3M63A 4AP4A 3V43A 1UJKA 4UP5A 2HDPA 2LXHC 5FB0A 5LFAA 4I7DA 5TRBA 5AJLA 5AARA 3SY2A 4AIFA 2YQMA 3AS4A 4JEHA 3RJVA 1LTXA 1X4UA 1EDUA 1QNFA 4A1SA 4N3WA 2WXIA 3KQIA 3X2QE 3DEPA 1DC2A 2RD0A 4DK5A 4ACLA 3ZPJA 2GRPB 3Q7AA 3JUEA 4J8YA 4GNGA 5KNGA 1HF8A 2XCBA 1MZCA 4UQZA 4FLBA 2KKXA 4K5CA 2DBAA 3M7KA 3CHMA 3G2SA 3RK6A 4O1PA 3IEGA 5SVXA 3TG5A 2CFUA 4N39A 3DPDA 4B7YC 4GA1A 4O64A 4HRLA 3B7RL 2YQ8A 3L11A 2VGXA 3LKUA 2VSXE 3FJUB 4HI8A 3D9NA 3NOGD 3APDA 3UKUG 2WXKA 3N9QA 5D2MC 2MD7B 3L9TA 3BU8A 3CK9A 4ILHB 4PPEA 2UZGA 2ZETC 3FP3A 2P9UG 3D9HA 3FAOA 5BUZA 3CHRA 4O62A 3N9NA 3HG0D 2YUCA 4YBTA 2LGLA 2FBNA 3ULEG 2FULA 2KATA 4NQ0A 4WZ3B 3CR3A 3EB6A 2KIZA 5G55A 1OWPA 1K1AA 1OUVA 1OY3D 1H0AA 2QIZA 3KNVA 3VTYA 1E8XA 4YADA 2QZAA 4GMLA 3QJZA 5DIZA 4OAUC 2VSOE 4IYPA 2DYSE 4GTVA 1H2VC 1IXVA 3FU0A 3DQVR 4OVUA 3SQVA 2AW6A 2XOCA 3HTKC 3R7QA 4B93B 3CVVA 1TNYA 4QFVA 4L23A 3G2WA 4U8HA 2YU4A 1FPPA 2DSMA 3ZPV1 4FADA 1DVPA 3WG7E 3CVQA 2PM6A 4XI1A 4V3KC 3L22A 1EYHA 2VQ2A 2X6KA 3E37A 3CVYA 4HB5A 5B76A 4KBQA 3I3NA 4LSZE 5FJYA 5G2NA 1Z5SC 4QQ4A 5K3QA 1WIMA 2F6NA 4UI9B 4FULA 3TWRA 3BUAA 3LEWA 4DUIA 3UXGA 2CSVA 3ML8A 4MKTA 1ZBPA 2BAYA 5T4YA 2JUNA 4N5CA 3S7DA 5H1UA 2NYJA 4HVBA 5T8IA 3CGHA 3RRNB 1OWMA 5JJ7A 2XEUA 3D9PA 4GYWA 4C0EA 3HIZA 5D0OD 2K1JA 3TXNA 3ZHEB 2Y43A 4ATZD 4LCTA 4LNBA 2VSYA 2YREA 5LCWC 4B8CB 3CV0A 1JPLA 5B75A 4I9EA 1GW6A 4MS6A 4JC8A 2I6HA 4A1GA 5FZSA 4CDNA 1XNFA 4YDEA 3SUBA 3NG2A 1JM7A 2VTBA 5C2YA 1XGWA 1AWCB 2PUYA 3O34A 1UOHA 3SFZA 2GRLA 3EHMA 3PE4A 5AQ9A 4AY6A 2R17C 4WAFA 3ESKA 2E61A 2L0BA 2B0OE 3FUJA 4GTMA 1SZAA 1PC2A 5KJLA 2XGOA 4CDRA 2UY1B 1UW4B 3DBSA 2PNNA 3V2OA 3KEAA 2YW8A 3ASDA 3B7BA 4GB0A 2XPIA 2VGEA 4C48B 4LNUD 5D0QD 2DVWA 2FO7A 5TBNA 2MA6A 4U0SA 5LKXA 2KR4A 5ENNA 4BY6A 1HG2A 4RLYA 5CRUA 4U0UA 5BNWA 3OXGA 2E6SA 4GMJA 3AS8A 4UUCA 5LKTA 3I4GA 3BQOA 3TG4A 3ZYMA 3LVRE 2B6CA 3FUDA 3N9OA 1N54A 2WQ7A 5CMWA 3C3QA 4ILGA 5G04J 1FCHA 2HO1A 3JYSA 4GZ5A 4JPSA 4BTAA 4GYOA 4JW1A 5H1TA 2CKLB 2L75A 2R59A 4EZKA 1LDJB 3ESLA 4A49A 3TWUA 4YC9A 5G04B 1N4RA 1JWFA 4L7TA 4Q94A 2YSJA 3SOUA 3I2DA 1D8DA 4O6FA 1Z6TA 1IQRA 3TWVA 5TABA 1NA0A 4JB8P 2HYZA 4YAXA 4C0MA 3PH0C 2G45A 3PNLB 4LERA 4RSYA 2CSYA 2KU3A 1A17A 3N71A 4GZ3A 3EUVA 1EPUA 5AENA 5B1BE 2YHOA 2DCPA 4AV7A 3SOXA 4TUMA 4CYMD 1TYQG 2MHKA 3V30A 2XRZA 3D9KA 4YDWA 3CSTA 2RFAA 3QARA 1CHCA 3ZW3A 3FH8A 1U3CA 2KE1A 2WXFA 3MX3A 3TAXA 2BEDA 3VTXA 1WILA 1KT0A 3CVUA 3NOCD 2LSVA 3WXXA 5A23A 4B0ZA 4HRNA 4EQFA 4G25A 2Y1LE 4GA0A 1JWGA 4URKA 3QDNA 2BKGA 3ZIMA 2VJEB 4N4FA 1MM2A 2XEVA 1HG5A 3GYZA 3SD5A 2QYJA 1WEMA 4WNGA 3MHHA 2P2CP 4HOSA 5B77A 1WESA 5CEDB 2L0TB 4CT4A 4KMOA 2KCVA 4BHWA 1WM5A 2XHEA 4JZYA 5LOZA 2HM8A 1OXJA 3FFLA 1K2FA 1N87A 1K3ZD 3AS5A 5TDRA 3L82A 3NF1A 1OWLA 2RSDA 2P57A 4L9PA 2LAUA 4Z0OA 5ENTD 5FT9A 2H6IA 3ULYA 2EODA 4OGCA 1SW6A 3U5OA 3AG4E 1ZB1A 3O36A 2LRIC 5KH9A 3T9KA 2LSUA 3ASOE 2AWIA 4AY5A 3FL2A 3ENEA 5SVIB 4DI4A 5AIJA 4F53A 4J6IA 4F6RD 4C9ZA 3JUIA 4FJYA 3PZ2A 2OWAA 4A4CA 4GTQA 5AQAA 1E8YA 3VLEA 3KV5A 4NIKA 4BT9A 1FP0A 4HRMB 2WXHA 3LY7A 3G2VA 3Q7FA 5JA4D 4EBAG 4AEZC 3HXBA 4WZ0A 4CDMA 3HCUA 4B94A 1HFAA 1E8ZA 3CKBA 1IHBA 2XRYA 4GYYA 3PUQA 3ABKE 3SGHA 4Q96A 1XWHA 2VJ8A 3HCTA 3EIJA 3D9JA 2YYRA 5EYAF 2OCCE 4K5BA 2XPZA 4RQIA 1LF8A 4BEPA 4LKAA 1L5JA 3NB2A 4NN2A 3DXKG 4FHJA 1QZ2A 2M85A 4LRZA 3NAWA 5JG6A 3DWLG 3L6AA 2IJGX 2YHEA 2IOLA 3BG0B 4LEUA 1OCCE 4M3OA 3O70A 2ZGGA 2OVBA 4AVXA 2PM7A 2AVPA 2ZXWE 3ULQA 1RZ4A 1BORA 1H6KA 1BI7B 4GA2A 4UWLA 3U5MA 1Y6IA 1WDYA 3ZN3A 3RRUA 4P5OB 5ARFA 2R05A 2XS1A 3FEYA 4HLEA 2I9CA 4XX5A 3HXCA 2A5UA 5BXUA 3LS8A 4BSZB 3MCXA 4GTOA 3ZVZB 1Z3YA 3ABLE 3FU6A 4PUCA 2KBXA 1N94A 3MGBA 3ML9A 4ATGA 1K1BA 1O1SA 4CZ2D 3RIBA 3C5KA 4DX1A 3EU5A 1N11A 5J3XA 2H6HA 1G3NB 3C3RA 2C0LA 2KYUA 2WMNA 4I43A 4AYCB 3OAWA 3UMVA 1KZOA 2OV8A 3QNKA 2BUGA 1UJJA 3UIOC 4IC3A 1QBQA 2LNIA 3CHSA 2OVFA 4YBSA 1NP7A 1BLXB 5KWDA 2M6MA 1D8EA 3PS6A 3H7HA 2FEZA 3CHOA 2R02A 3KAEA 3J5QB 2J4DA 1TJCA 2QJ0A 2XZTG 5JHBA 5G05B 4YBMA 2WXLA 2V4HC 3P2BA 4GAAA 5BPPA 4APFA 2MNZA 2HR2A 4ANWA 4N3AA 3QOUA 4R7EA 3VK6A 4KZ0A 4MSXA 4ILIA 5HRYA 1U6GB 5FTPA 3NZSA 4TXQA 1PY1A 2GGFA 3Q49B 4JXTA 3PHDA 2LXPC 3ZXPA 2CG3A 3MDBC 2L80A 3L1XA 4N2SA 3EHQA 2LGGA 4ZDTA 3OTNA 5ARGA 3FU3A 3JQ0A 4U8VD 4O60A 3PEVB 1MJ0A 2X6IA 1WGMA 4ME2A 2GRNB 2FF4A 5FWQA 1H6PA 4J8DA 4PDXA 4GCOA 4JD2G 2K4DA 2YSMA 2ZIRA 3HXEA 4ZFHA 2RFMA 3T5XA 2EIME 4D10C 1NL4A 1WEEA 5G05J 3PNTB 3RAUA 3L54A 4E6HA 5SVYA 3URZA 4GTTA 2EGPA 1LD7A 3B95A 3ZYLA 4ZQLA 4F7AA 5CHEE 3RSEG 4E85A 5B78A 3APFA 3UX4A 3F6QA 5AJDA 2XS8A 1K8KG 2EILE 1E90A 4ZHBA 3MEKA 3J5PA 1NA3A 4XKBA 1RMDA 5EDSA 2OEVA 4XIFA 2BTDA 4I1OB 4PS3A 3N9PA 5HQ8A 5I3LA 3TL5A 1OT8A 3C72A 2XPYA 3CVLA 3ZNGA 4UWFA 4TXPA 4CEMA 3T8KA 4JHKA 3B7SA 4EHMA 4HORA 1DNPA 3HXDA 1MHQA 3ZYQA 4GPKA 5KNHD 2M63A 3FH5A 3RO2A 3QWWA 5EX0A 4FJZA 3B7TA 3ZPVE 4U0ZA 1FVFA 2MUMA 4L58A 1VD4A 2V8SE 2P9LG 5KBAA 2XP0A 4WNDA 3T6RA 5BV1A 2VP7A 5JJTA 1N4SA 1DCEA 3UM2A 1WEVA 2CKLA 1FVHA 3QAQA 5FIOA 3GL6A 1HX8A 3Q73A 1UN9A 2RI7A 1S70B 4BWRA 3AG1E 2A5EA 2HE0A 2L5UA 3IHPA 4MLPA 1X81A 3RKVA 4G8KA 4GU5A 5ENRD 2Y4UA 1H2UA 2FUUA 4GNFA 3Q47B 3LDYA 2DIWA 4L2YA 2KKYA 4B89A 4GNDA 2VNFA 3S7FA 3CHPA 2IO2C 1RW2A 2Q7FA 3IKOB 1V55E 2Y1NA 4LG6A 4H7XA 1ELKA 4JEUA 3S7BA 3KS2A 5KH7A 4FA6A 4HNAD 2VPGA 2H6FA 4IULA 2RR4A 4FJCA 5FZQA 4A63B 4UWHA 3V79K 2CONA 3RPGB 2V0PA 4EPZA 3CVXA 5B8DA 3DSUA 2H0DA 1OCOE 3ZNIA 2E6RA 2VJFA 4DI3A 2DX8A 4X8QA 2UWJG 3PVLA 2XEEA 4ZUXU 3P1UA 2VGXB 4QF2A 3CLJA 1E96B 2ZGDA 3PURA 2L0IA 3APCA 2X38A 3FUFA 4CA1A 3I5PA 3LJNA 1SQMA 2ETCA 3FUNA 5EYPF 4BX9A 1T1HA 2IO3C 1WEUA 4L1BA 4BTBA 5AYWD 5FQ6A 2KCKA 5FQ8A 2IFUA 3TJPA 3FUMA 2EIKE 3UTMA 2CHZA 2MT5A 2MA5A 1JCQA 2XGSA 1IQUA 2GRMA 5E76A 2P58C 4UP0A 2P9SG 3FEHA 4WNEA 3O48A 1F62A 3IBEA 5AITA 5EIDA 4HOQA 5FQ7A 3I4RB 4YABA 3LCAA 1Y8MA 2R5SA 1TNUA 2JMDA 3UI2A 4N3BA 4V3IA 1E4UA 1O1RA 4HQDA 5D66A 3RTRB 1IYMA 3RRMB 5FB1A 3KD7A 3ASFA 1HZ4A 4BERA 2V5QC 3NBNB 4G2VA 2EGMA 1BI8B 2PL2A 4GPMA 4AOFA 4PS8A 3JXIA 3AJIA 3Q15A 3GV4A 3SZ7A 4WWPA 2Y1MA 2KWOA 5JJ6A 3VLDA 4TKPB 2L9BA 1HO8A 4GZCA 3CKCA 2G43A 3ASHA 3SFYA 3LRQA 1U3DA 3ZU7B 5EX3A 4CT0A 2P9KG 4XEIG 2OEWA 3ONLA 3IXEA 3PE3A 4F1PA 2LDRA 3TWXA 4DLQA 5D1LB 3FTXA 1IYGA 4XI0A 3FUEA 4J8FA 4X3GA 3UM3A 3E2DA 2ZISA 3LQJA 1KT1A 1EF1C 2AJAA 2I1KA 2AXUA 3U64A 3TWWA 2OOEA 3FUHA 3ZTGA 3CK7A 3SFXA 2P9IG 3TWQA 4G23A 3FWVA 2XOYA 1IKND 5EKQD 3HDXA 4LADB 3MZLB 1ZU2A 2I2OA 1N4QA 5IY5E 4KT6B 3ASLA 4K03A 3CIAA 4W4UA 1S63A 2X6JA 5FEYA 5FQ4A 4UQYA 3CQGB 1TJFA 1QQEA 3DEOA 3S7JA 3FTYA 2P9NG 4OGEA 1KPSB 1G25A 3PREA 4R2YA 2VTBB 1MQSA 5CBOA
chains in the Genus database with same CATH topology
4IYPA 5KJKA 3PUKA 5TDWA 2YQLA 3LQIA 3UPVA 4ANXA 4CRWA 1H2VC 5J3XA 4ABNA 3FU0A 3DQVR 3U4TA 4OVUA 2AW6A 2KFTA 3HTKC 3R7QA 3QWPA 4QFVA 4OVVA 4L23A 5CCMA 3CVVA 3G2WA 2CSZA 2KGIA 4U8HA 2C0LA 2YU4A 2KYUA 3GZ2A 4ZDTA 4HFGA 2WMNA 4YNDA 4I43A 3ZPV1 2CHWA 4FADA 1DVPA 4AYCB 4L2LA 3AU5A 5KJNA 3OAWA 4GB9A 5KJMA 3CVQA 3D9OA 2PM6A 2XGMA 3UMVA 2OV8A 2V4LA 3QNKA 4S3OB 2BUGA 4XI1A 5ANLA 3O37A 4QF3A 3L22A 3CVWA 1EYHA 2LAIA 1UJJA 2VQ2A 2X6KA 4CCAA 3EB5A 4IC3A 2C2LA 2VPDA 2VSNA 4RG9A 3G2UA 5LP0A 4I1AA 4FHKA 3CVYA 2FSAA 3OXLA 3CVNA 3CSFA 2LNIA 4I6GA 3CHSA 2OVFA 4NURA 5A6CA 1X4IA 2M1RA 1W3BA 3G2TA 4KBQA 1NP7A 2CT2A 2M6MA 3KV6A 3LQHA 5B76A 2Y4TA 3S2AA 3I3NA 4EECA 3PS6A 2FEZA 2Y3AA 3CHOA 3FHEA 4A3VA 5FJYA 3KAEA 3QKYA 5G2NA 1Z2QA 3LYAA 2QFCA 2FUIA 5B79A 2NXPA 3MA5A 2J4DA 1WEPA 3ZRHA 1WIMA 1TJCA 2QJ0A 1WEQA 4IRUA 2F6NA 4FULA 4UI9B 5HI7A 5JHBA 3EDTB 5G05B 4YBMA 3LEWA 4GZDA 2WXLA 4YVOA 1VFYA 3P2BA 4GAAA 2ECVA 2E0IA 4I1MA 4FP7A 4JHRA 2AXVA 5BPPA 3ML8A 3KEZA 4APFA 2AN6A 2MOWA 2J07A 4U63A 4MKTA 5JHAA 2MNZA 5LCWB 2HR2A 4ANWA 4N3AA 1ZBPA 3FEXA 2NSZA 3QOUA 4R7EA 3VK6A 4KZ0A 4MSXA 4ILIA 2WPVA 4LUNU 5T4YA 4BSXA 5FTPA 4TV3A 3CK8A 4AXHA 1U6GB 3NZSA 4A4BA 5G0FA 1PY1A 3UT8A 1X5BA 2GGFA 4N5CA 3S7DA 3Q49B 4JXTA 2QICA 4FO9A 3PHDA 4WA6A 4AUQB 2LXPC 4HVBA 3B13A 3QZVA 2CG3A 2IDAA 1OWOA 2JRJA 5T8IA 4KZCA 3CGHA 1B89A 2KWNA 3RRNB 1OWMA 3NQPA 2WQHA 4U07A 5JJ7A 4N2SA 2LGGA 2XEUA 3L1XA 3OTNA 3EIQC 3PDNA 4PS7A 4XZ4A 5ARGA 2YHNA 5LKUA 3IHVA 3D9PA 3FU3A 3JQ0A 3SNXA 2LGVA 4GYWA 1KLXA 3PEVB 3BG1B 4XI9A 4C0EA 2X6IA 4XKCA 1WGMA 3HIZA 4ME2A 5D0OD 2K1JA 3TXNA 2VPBA 2FF4A 3ZHEB 3L08A 2XB1A 2LGKA 5FWQA 3FULA 4J8DA 2Y43A 4LLBA 2IU1A 4LCTA 4PDXA 4I9CA 2IQCA 4GCOA 1WY6A 2ECGA 2K4DA 3MV3B 2ECNA 2KCLA 2YSMA 5FERA 2VSYA 2YREA 3QB2A 5DKAA 5LCWC 2YHCA 4B8CB 4BX8A 3CV0A 3T5XA 1JPLA 2GW1A 1NZNA 1GW6A 4I9EA 4JC8A 4MS6A 4WWOA 2I6HA 5KCMA 4D10C 4A1GA 4IN3B 1WEEA 2YURA 5FZSA 1ELRA 4TRQA 4I2ZA 4ANUA 3MV2B 5G05J 1V87A 3PNTB 4JA7A 1Z60A 4MVTA 4F52B 1JM7B 3L54A 4CDNA 4E6HA 1XNFA 3NG2A 3URZA 1JM7A 3M62A 2EGPA 1E7VA 2IF4A 2VTBA 4HS2A 3ZGQA 5C2YA 4U04A 1XGWA 3SF4A 2M3HA 2PUYA 4G26A 3ZYLA 3O34A 4ZQLA 3SFZA 2GRLA 4F7AA 5CHEE 2PQNA 3EHMA 3PE4A 2WXGA 2AXZA 3MYVA 3PEUB 4JHJA 2CHXA 2WMOA 3APFA 4E85A 2R17C 3FUIA 3PRZA 4AY6A 2F42A 4WAFA 5B78A 3UX4A 2X6HA 3ESKA 5AJDA 3N9MA 2L0BA 3DPLR 3FUJA 2J09A 3FU5A 4I6JA 1SZAA 1E90A 3LJ3A 2WB2A 1PC2A 3JCKC 5KJLA 4GZ6A 2XGOA 4CDRA 3MEKA 2UY1B 3HHMA 5C13A 1UW4B 1H2TC 3DBSA 4EZLA 1ELWA 1NA3A 3D9MA 4XKBA 1RMDA 3U5NA 5EDSA 4XIFA 2YW8A 3ASDA 2K17A 2BTDA 4GB0A 4I1OB 2XPIA 4PS3A 2J4BA 3N9PA 5HQ8A 2KREA 5LCWJ 4FLHA 5I3LA 1LDKC 3TL5A 3U5PA 3U66A 2JMIA 2XPYA 4WNFA 1HYIA 1N52A 3CVLA 5C11A 3R9AB 3MKRA 2WXNA 5D0QD 3LPZA 3T5VA 2KWJA 3MKQB 4R8PK 4KVOA 2XCCA 2FO7A 4UWFA 2YT5A 2MA6A 5TBNA 4U0SA 5DINA 5J08A 4CEMA 5H9MA 5LKXA 4JHKA 3B7SA 4B86C 2KC7A 3MKQA 2KR4A 5ENNA 4BY6A 4G1TA 2ECWA 1HG2A 4HORA 1DNPA 1MHQA 3ZYQA 2HYED 4GPKA 3B7UX 3CQCB 4DLOA 3OXFA 4U0UA 2M63A 5BNWA 2H0DB 3OXGA 2E6SA 3PZDA 4GMJA 3FH5A 3RO2A 3ZFWA 2WXPA 3AS8A 3QWWA 5EX0A 3ZVYA 5LKTA 4J8EA 4FJZA 4R7LA 5CCLA 2VJFB 4C9BB 3SHBA 3B7TA 2V5FA 3UT7A 1UG3A 4DJAA 3ZPVE 3I4GA 3RU0A 4U0ZA 1FVFA 2WVIA 3TG4A 3ZYMA 2YNQA 3LVRE 2V8SE 3FUDA 4N3CA 4EBAA 1VD4A 1N54A 2MUMA 2PNXA 2WQ7A 5CMWA 3N9OA 4ILGA 4WNDA 5G04J 4AM9A 4CGWA 1FCHA 2HO1A 3T6RA 3JYSA 4GZ5A 4JPSA 3SHFA 3U9WA 4MRUA 5BV1A 4RVBA 2L80A 2LQ6A 4BTAA 2VP7A 4GYOA 4JW1A 5H1TA 3QWVA 2CKLB 5JJTA 4K0RA 2R59A 4EZKA 1E7UA 2LAHA 3CHQA 1LDJB 2KWKA 3RPGC 3ESLA 4A49A 4J0UA 4APOA 4GNEA 3C98A 4I17A 2BF0X 3O4ZA 1WEVA 2CKLA 4FK5A 4YC9A 5G04B 1FVHA 1HH8A 3D3MA 2MD8C 5H1UA 3QAQA 4L7TA 1JWFA 2J08A 4Q94A 4WUYA 1HX8A 2L6JA 2YSJA 3GL6A 2KZTB 3I2DA 5BV0A 1UN9A 3L17A 3E4BA 2RI7A 4O6FA 1Z6TA 5J90A 2KZTA 4BWRA 2J9QA 3ZHEA 1IQRA 3D9IA 1ZBDB 5TABA 2WXOA 1NA0A 1Z3XA 2HYZA 5FZRA 3UT4A 4A55A 4V3LC 4YAXA 4ANVA 4Y6CA 3PH0C 4C0MA 4HOUA 1WEOA 1X4JA 2G45A 3PNLB 4LERA 2L5UA 4RSYA 1FBVA 2CSYA 4MLPA 1A17A 3FY4A 2KU3A 3N71A 4GZ3A 4JVSA 3RKVA 1YA0A 1HU3A 3GZSA 5D1MB 1EPUA 3D9LA 5AENA 4GU5A 2WXQA 1P5QA 2YHOA 2Y4UA 1H2UA 2DCPA 4UWGA 4AV7A 1Z6UA 2XQ0A 2FUUA 3KNVA 4GNFA 3Q47B 4YATA 3SOXA 2XRZA 2MHKA 2J49A 1OWNA 4CGVA 2DIWA 3D9KA 4L2YA 4WWNA 3CSTA 2VGYA 4B89A 2IOSA 2OXQC 3QARA 4NRHB 1CHCA 2VNFA 4GNDA 4J8SA 3ZW3A 3CEQA 4I6EA 3ONKA 3SI5A 4HXIA 5LX8A 4A0CD 5D1KB 3FH8A 1U3CA 3CHPA 2WXFA 3S7FA 2JLBA 3FTWA 1MM3A 3MX3A 2KM4A 2KE1A 2VPEA 2Q7FA 3IKOB 3O35A 5KH3A 1HXIA 3TAXA 3BEEA 3VTXA 1TEZA 2L75A 3LXUX 3LDZA 1WILA 2Y1NA 1KT0A 3CVUA 4BBQA 3LY8A 1WENA 4ACKA 2UY1A 4H7XA 2LSVA 3FTUA 5A7DB 1ELKA 5ANRA 4JEUA 3WXXA 4AJWA 5A23A 3S7BA 3KS2A 4B0ZA 5KH7A 4FA6A 4N2QA 2CFZA 4EQFA 3ZXSA 4G25A 1WAO1 2VJEA 4GA0A 2VPGA 1JWGA 4I7CA 2JMJA 3JQ1A 4F3VA 4URKA 3FTZA 3QDNA 3ZIMA 4FC8A 2LO6A 3HYMB 4IULA 2VJEB 1MM2A 3UQ3A 4FJCA 2X3MA 4XE0A 2XEVA 2JEKA 4FU3A 3FDHA 1IHGA 3HVEB 5FZQA 4UWHA 2MNYA 3ZVVA 2ZU6B 3MJWA 3SBTB 3Q4AB 1HG5A 3GYZA 2VYIA 4YVQC 3SD5A 4WNGA 3U3WA 1WEMA 3HCSA 2K16A 3MHHA 3RPGB 2V0PA 3HVEA 3QK0A 4UQXA 4HOSA 2ONDA 5B77A 4EPZA 3ASGA 3CVXA 1WESA 3CVPA 5B8DA 2L0TB 4CT4A 1WE9A 3IV0A 5CMYA 2H0DA 4UI9C 5T3RA 3ZNIA 4KMOA 2E6RA 4TUUA 2VJFA 2KCVA 2WM9A 4DI3A 2L43A 2DX8A 4BHWA 1WM5A 2XHEA 4JZYA 2UWJG 2HM8A 5LOZA 2YINA 3FFLA 4KYOB 1K2FA 1N87A 3PVLA 4W9RA 1JUQA 4NACA 4ZUXU 3P1UA 5TDRA 3AS5A 2VGXB 5B75A 1WEWA 4QF2A 3PUJA 3NF1A 1OWLA 3TGOA 3FTVA 2E2EA 4CCGX 2EQXA 2RSDA 3FTSA 3TXMA 2D8SA 2C2VS 3CLJA 1E96B 1SZ9A 4UWKA 5FT9A 2I50A 2CG2A 2L0IA 3APCA 4OYSA 3PURA 2RG8A 2WXJA 2X38A 3FUFA 4F1SA 4CA1A 5E75A 3I5PA 1SQMA 5BW8C 4AP2A 4I2WA 1VDYA 4G11A 1JOCA 3EHNA 1INZA 2EODA 3FUNA 2ECTA 3O33A 3SBSA 2ILRA 3U5OA 5G04C 4BX9A 1T1HA 4BT8A 3ZEFA 1WEUA 4UI9J 2WXMA 3O36A 4L1BA 4EZJA 2LRIC 5G05C 3ZYKA 4BTBA 5AYWD 3L1ZB 5FQ6A 5KH9A 4S3OC 4GCNA 2KCKA 2LSUA 3FH7A 5DBKA 5FQ8A 3VLFA 4RG6A 3M99A 2AWIA 4AY5A 2KGGA 4PTBA 2IFUA 3TJPA 2I1JA 3FUMA 3ENEA 2MIQA 3FL2A 2CHZA 3LVQE 2MRIA 2QY7A 3UUXA 2MA5A 2MT5A 3M63A 4AP4A 2XGSA 1IQUA 2GRMA 5E76A 3V43A 2P58C 4DI4A 1UJKA 5AIJA 4A3TA 4I7BA 2LN0A 3QC1A 4F53A 2WXRA 2HDPA 2LXHC 5LFAA 4UP0A 5FB0A 3GW4A 2PZIA 4I7DA 5TRBA 3SOUA 4J6IA 4WNEA 5AJLA 4C9ZA 3GZ1A 3O48A 1F62A 3IBEA 5AITA 4HOQA 5FQ7A 4UI9K 3I4RB 4AIFA 3JUIA 2YQMA 3AS4A 4JEHA 4G24A 4FJYA 3FUKA 4YABA 3LCAA 3RJVA 2BAYA 2NC9A 1X4UA 4A4CA 1EDUA 2FI7A 1QNFA 4A1SA 4FIPA 4N3WA 2WXIA 1Y8MA 2R5SA 4JL0A 1E8YA 3VLEA 3KQIA 3KV5A 2JMDA 4N3BA 4BT9A 4BFRA 1FP0A 4V3IA 4B8AA 1E4UA 2RD0A 2WXHA 4DK5A 1PAQA 3LY7A 3G2VA 3RO3A 4ACLA 3R7RA 3ZPJA 4EBAG 3RTRB 4AEZC 3RRMB 5FB1A 1IYMA 3KD7A 3ASFA 4LK9A 4WZ0A 4CDMA 1HZ4A 3HCUA 4H7YA 4GNGA 4B94A 1HF8A 3NZUA 4G2VA 2XCBA 1HFAA 4KXKB 5BT1A 4UQZA 3IHPA 4FLBA 1E8ZA 3CKBA 4IC2A 2PL2A 4AYCA 2XRYA 2DBAA 4GYYA 3LY9A 3PUQA 4N4FA 3CHMA 3L13A 3SGHA 1E8WA 4PS8A 4AOFA 3G2SA 4Q96A 4HOTA 3Q15A 3RK6A 3SZ7A 3GV4A 4WWPA 1XWHA 5LKZA 2VJ8A 3HCTA 2Y1MA 3EIJA 3D9JA 2YYRA 2KWOA 5JJ6A 3VLDA 5EYAF 3IEGA 4TKPB 3TG5A 4Q69A 2L9BA 2XPZA 1HO8A 2X6FA 2CFUA 1HS6A 1LF8A 3CKCA 4GZCA 2G43A 2NAAA 1H19A 4N39A 3ASHA 3DPDA 2G6QA 3LRQA 4GA1A 2LV9A 4LKAA 4B7YC 1L5JA 3K9IA 4NN2A 4O64A 4FHJA 1U3DA 5EX3A 1QZ2A 1UN8A 4CT0A 3B7RL 2M85A 2YQ8A 3ONLA 3L11A 2VGXA 3PE3A 3LKUA 4LRZA 2VSXE 3IHYA 2LDRA 2WQ6A 3D9NA 4UP5A 5JG6A 3APDA 3L6AA 4KVMA 2IJGX 2YHEA 4DLQA 2WXKA 5C1DA 2ECIA 3N9QA 2IOLA 3Q5MA 2MD7B 5D1LB 3BG0B 4LEUA 1VYXA 2EA6A 3CK9A 4M3OA 3O70A 3FTXA 4ILHB 1IYGA 4PPEA 2OVBA 4XI0A 4AVXA 2UZGA 2ZETC 4DPRA 3FUEA 3FP3A 3EJNA 2PM7A 4J8FA 2AVPA 3ULQA 4X3GA 3MHSA 4P29A 1BORA 2PQRA 2IONA 1HE8A 1H6KA 4LJNA 3LQJA 5FEYA 3SOWA 4Q6FA 1KT1A 3CHRA 5BUZA 1EF1C 2I1KA 2AXUA 4GA2A 2A4ZA 3U64A 3N9NA 4UWLA 3U5MA 1Y6IA 5H1VA 2ECJA 2C0MA 3T8MA 4L58A 2OOEA 3ZN3A 2YUCA 3FUHA 4V3KC 4YBSA 3RRUA 4YBTA 1HYJA 2LGLA 4P5OB 2FBNA 2FULA 2KATA 3CK7A 4NQ0A 5ARFA 4L7XA 4WZ3B 3ZTGA 3CR3A 3EB6A 3FEYA 4HLEA 4G23A 2I9CA 4XX5A 2KIZA 5G55A 2A5UA 3FWVA 1OWPA 3LS8A 3L16A 3MCXA 3ZVZB 5EKQD 1Z3YA 1BPOA 3N9LA 5AIUA 3FU6A 4PH4B 3HDXA 4PUCA 3MGBA 3ML9A 4Y6WA 4ATGA 5M72A 3MZLB 4LADB 1ZU2A 2I2OA 4JA9A 1OUVA 4KT6B 3ASLA 1S0PA 1H0AA 4K03A 3T7LA 3CIAA 4W4UA 2X6JA 2QIZA 3RIBA 5FQ4A 3VTYA 1E8XA 3CQGB 4UQYA 3C5KA 1TJFA 3C6WA 3O7AA 4WZ2A 1QQEA 4YADA 3S7JA 3AU4A 3FTYA 1G25A 3PREA 4R2YA 4GMLA 3QJZA 5DIZA 2VTBB 1WFKA 1MQSA 2VSOE 2F6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TDW A;  2YQL A;  3LQI A;  5J3X A;  3DQV R;  3HTK C;  2KFT A;  3G2W A;  2CSZ A;  2KGI A;  2YU4 A;  2KYU A;  4HFG A;  3ZPV 1;  1DVP A;  4AYC B;  3D9O A;  4XI1 A;  4S3O B;  3O37 A;  4QF3 A;  3EB5 A;  4V3K C;  1EYH A;  1UJJ A;  4IC3 A;  2C2L A;  2VPD A;  5LP0 A;  3G2U A;  2FSA A;  1X4I A;  4YBS A;  4YAT A;  2M1R A;  3G2T A;  2CT2 A;  3LQH A;  5B76 A;  2M6M A;  3KV6 A;  1Z2Q A;  2FUI A;  5B79 A;  1WIM A;  2QJ0 A;  1WEQ A;  2F6N A;  4UI9 B;  5G05 B;  4YBM A;  4GZD A;  1VFY A;  2ECV A;  2AN6 A;  2MOW A;  2MNZ A;  5LCW B;  4R7E A;  3VK6 A;  4MSX A;  2BAY A;  1U6G B;  4A4B A;  5G0F A;  1PY1 A;  1X5B A;  4AUQ B;  5H1U A;  2QIC A;  4JXT A;  4FO9 A;  4WA6 A;  3PHD A;  2LXP C;  2IDA A;  2JRJ A;  2L80 A;  2KWN A;  3L1X A;  2LGG A;  2XEU A;  4ZDT A;  2YHN A;  5LKU A;  3D9P A;  2LGV A;  1WGM A;  2K1J A;  2VPB A;  2Y43 A;  2XB1 A;  2LGK A;  4LLB A;  2ECG A;  2K4D A;  2ECN A;  2YSM A;  5FER A;  2YRE A;  5DKA A;  1JPL A;  5B75 A;  4F52 B;  2YUR A;  1WEE A;  1V87 A;  1WEP A;  4MVT A;  1Z60 A;  1JM7 B;  3NG2 A;  1JM7 A;  3M62 A;  2EGP A;  1XGW A;  2M3H A;  2PUY A;  3ZYL A;  3O34 A;  4ZQL A;  5B78 A;  2F42 A;  3N9M A;  2L0B A;  3DPL R;  1SZA A;  5C13 A;  3U5N A;  3D9M A;  1RMD A;  2YW8 A;  4GB0 A;  2K17 A;  3N9P A;  2KRE A;  5I3L A;  1LDK C;  3U5P A;  2JMI A;  5C11 A;  2KWJ A;  4R8P K;  2YT5 A;  5TBN A;  2MA6 A;  5DIN A;  5J08 A;  5H9M A;  5LKX A;  4B86 C;  2KR4 A;  2ECW A;  1HG2 A;  1MHQ A;  3ZYQ A;  2HYE D;  2H0D B;  2E6S A;  3ZVY A;  5LKT A;  2VJF B;  3SHB A;  3ZPV E;  3ZYM A;  2MUM A;  4L58 A;  1VD4 A;  2V8S E;  3N9O A;  2PNX A;  5CMW A;  3T6R A;  3QZV A;  1HYI A;  2LQ6 A;  2VP7 A;  5H1T A;  2CKL B;  2L75 A;  1LDJ B;  3RPG C;  2KWK A;  4A49 A;  4GNE A;  2BF0 X;  1WEV A;  2CKL A;  4FK5 A;  4YC9 A;  5G04 B;  2MD8 C;  4Q94 A;  1JWF A;  3SOU A;  2YSJ A;  3GL6 A;  1HX8 A;  3I2D A;  2RI7 A;  1ZBD B;  3D9I A;  5TAB A;  4V3L C;  4YAX A;  1WEO A;  1X4J A;  2G45 A;  2L5U A;  3IHP A;  1FBV A;  2CSY A;  2KU3 A;  5D1M B;  3D9L A;  2YHO A;  2DCP A;  1Z6U A;  2FUU A;  4GNF A;  3SOX A;  2DIW A;  3D9K A;  2OXQ C;  1CHC A;  4GND A;  2VNF A;  3ONK A;  4A0C D;  5D1K B;  1MM3 A;  2KE1 A;  2VPE A;  2KM4 A;  3O35 A;  5KH3 A;  3LDZ A;  1WIL A;  2Y1N A;  4BBQ A;  1WEN A;  1ELK A;  5KH7 A;  2VJE A;  2VPG A;  1JWG A;  4I7C A;  2JMJ A;  2LO6 A;  2VJE B;  4FJC A;  4N4F A;  1MM2 A;  4FU3 A;  2MNY A;  1HG5 A;  1WEM A;  3MHH A;  3HCS A;  2K16 A;  3RPG B;  5B77 A;  1WES A;  5B8D A;  2L0T B;  1WE9 A;  2H0D A;  5CMY A;  3ZNI A;  2E6R A;  2VJF A;  2L43 A;  2DX8 A;  4BHW A;  5LOZ A;  1K2F A;  1N87 A;  1JUQ A;  4NAC A;  4ZUX U;  5TDR A;  1WEW A;  4QF2 A;  4CCG X;  2RSD A;  2D8S A;  2C2V S;  3CLJ A;  1SZ9 A;  2I50 A;  3PUR A;  2L0I A;  4CA1 A;  1VDY A;  1JOC A;  1INZ A;  2EOD A;  3O33 A;  2ECT A;  3U5O A;  1T1H A;  1WEU A;  3O36 A;  2LRI C;  3ZYK A;  5KH9 A;  4S3O C;  3M99 A;  4PTB A;  2KGG A;  3FL2 A;  2MIQ A;  2QY7 A;  2MT5 A;  3M63 A;  2MA5 A;  4AP4 A;  3V43 A;  1UJK A;  4UP5 A;  4I7B A;  2LN0 A;  2HDP A;  2LXH C;  4UP0 A;  5FB0 A;  4I7D A;  5TRB A;  4C9Z A;  1F62 A;  5AIT A;  2YQM A;  4YAB A;  1X4U A;  4A4C A;  1EDU A;  4FIP A;  4N3W A;  3KQI A;  3KV5 A;  2JMD A;  1FP0 A;  1E4U A;  3G2V A;  3RTR B;  1IYM A;  5FB1 A;  4LK9 A;  4WZ0 A;  3HCU A;  4GNG A;  1HF8 A;  1HFA A;  4FLB A;  4IC2 A;  4AYC A;  3PUQ A;  3G2S A;  4Q96 A;  3GV4 A;  1XWH A;  5LKZ A;  3HCT A;  2Y1M A;  3D9J A;  2YYR A;  2KWO A;  5EYA F;  4TKP B;  2NAA A;  4GZC A;  1LF8 A;  2G43 A;  4LKA A;  2G6Q A;  3LRQ A;  4B7Y C;  2LV9 A;  4NN2 A;  4O64 A;  2M85 A;  3ONL A;  3L11 A;  2LDR A;  3D9N A;  5JG6 A;  2ECI A;  3N9Q A;  5D1L B;  2MD7 B;  1VYX A;  2EA6 A;  3O70 A;  4PPE A;  4AVX A;  2UZG A;  2ZET C;  4X3G A;  3MHS A;  1BOR A;  4LJN A;  3SOW A;  3LQJ A;  4Q6F A;  3N9N A;  3U5M A;  5H1V A;  2ECJ A;  1HYJ A;  2YUC A;  3RRU A;  4YBT A;  2LGL A;  4P5O B;  3ZTG A;  4L7X A;  4WZ3 B;  3EB6 A;  2KIZ A;  3ZVZ B;  5AIU A;  3N9L A;  4LAD B;  3ASL A;  3T7L A;  1H0A A;  4W4U A;  2QIZ A;  3KNV A;  3L1Z B;  5FEY A;  3C5K A;  3C6W A;  3O7A A;  4WZ2 A;  4YAD A;  1G25 A;  4R2Y A;  1WFK A;  2F6J A; 
#chains in the Genus database with same CATH topology
 5FIN A;  5KJK A;  2YQL A;  3LQI A;  3UPV A;  3AAA C;  4CRW A;  5AQB A;  3U4T A;  2KFT A;  3QWP A;  4OVV A;  2DZO A;  2CSZ A;  2KGI A;  3GZ2 A;  4YND A;  3PZ4 A;  4GB9 A;  2V4L A;  2IEJ A;  3O37 A;  5B1A E;  3CVW A;  4CCA A;  2LAI A;  2C2L A;  3DST A;  1Q2Z A;  3G2U A;  5LP0 A;  4FHK A;  1MBM A;  3CVN A;  1O5M A;  4I6G A;  5ENO D;  1X4I A;  4NUR A;  3TWS A;  4YAT A;  2M1R A;  2CT2 A;  3KV6 A;  2Y4T A;  3JXJ A;  2Y3A A;  3FHE A;  1H6O A;  3QKY A;  1Z2Q A;  1U2V G;  5B79 A;  3ZRH A;  1N4P A;  2L7P A;  3EDT B;  2GRR B;  4GZD A;  4DX5 D;  2MOW A;  2J07 A;  5JHA A;  5LCW B;  1JCR A;  3FEX A;  3Q9N C;  4LUN U;  2WPV A;  4BSX A;  4AXH A;  4AUQ B;  2QIC A;  4FO9 A;  4WA6 A;  2XEH A;  2JRJ A;  2F8Y A;  4KZC A;  1B89 A;  3NQP A;  2WQH A;  4HLL A;  3PDN A;  3EIQ C;  4M7C A;  4PS7 A;  5EN5 D;  2YHN A;  3LJU X;  3DSX A;  2LGV A;  4G8L A;  1KLX A;  2F8X K;  3AG3 E;  3BG1 B;  1WG0 A;  4XKC A;  3L08 A;  2LGK A;  4LLB A;  2IU1 A;  2IQC A;  1WY6 A;  2ECG A;  3MV3 B;  5FER A;  3W9F A;  3QB2 A;  2YHC A;  2GW1 A;  2YUR A;  4IN3 B;  4ANU A;  1ELR A;  4TRQ A;  4I2Z A;  1V87 A;  1WEP A;  4JA7 A;  4LNG A;  1NI1 A;  1E7V A;  4HS2 A;  2Y0B G;  1BD8 A;  3SF4 A;  5CRV A;  2WXG A;  3MYV A;  3PEU B;  4JHJ A;  2CHX A;  2WMO A;  3C5R A;  2F42 A;  4HI9 A;  4I6J A;  3FU5 A;  1N95 A;  1H2T C;  3D9M A;  5AQ7 A;  2K17 A;  1AP7 A;  2KRE A;  1LDK C;  3Q1D A;  3U5P A;  1O1T A;  3U66 A;  2JMI A;  3LPZ A;  3MKQ B;  4KVO A;  1N0Q A;  2XCC A;  2YT5 A;  5DIN A;  5J08 A;  2EIN E;  5H9M A;  4B86 C;  2HYE D;  2FFW A;  3CQC B;  4DLO A;  3OXF A;  3ZFW A;  3ZVY A;  4J8E A;  4R7L A;  5CCL A;  3SHB A;  3UT7 A;  2V5F A;  1UG3 A;  3ABM E;  4DJA A;  4EBA A;  2YNQ A;  4N3C A;  2PNX A;  2KXP C;  4AM9 A;  4CGW A;  2QYU A;  2IY0 C;  3QZV A;  4MRU A;  3QWV A;  5CBN A;  1E7U A;  2LAH A;  3CHQ A;  2GRQ B;  3RPG C;  4GNE A;  3C98 A;  2BF0 X;  3FAN A;  2J08 A;  4WUY A;  5EIB E;  1BU9 A;  2L6J A;  2KZT B;  2Y69 E;  3E4B A;  5J90 A;  2LUH A;  3ZHE A;  3EU9 A;  3UT4 A;  4V3L C;  1Z3X A;  3AG2 E;  5FZR A;  3UM1 A;  4ANV A;  4HOU A;  4YDY A;  3FY4 A;  4JVS A;  3GZS A;  5D1M B;  1TN6 A;  5H7P A;  1P5Q A;  4UWG A;  1Z6U A;  3KSL A;  4CGV A;  2H6G A;  3E34 A;  4WWN A;  2VGY A;  2IOS A;  2OXQ C;  4NRH B;  3CEQ A;  4I6E A;  3SI5 A;  3C3O A;  4HXI A;  4A0C D;  3E33 A;  1MM3 A;  2JLB A;  2VPE A;  5KH3 A;  1HXI A;  1TEZ A;  3LY8 A;  1WEN A;  2UY1 A;  3DSS A;  3FTU A;  5A7D B;  5ANR A;  4AJW A;  3W9G A;  3ZXS A;  4BES A;  2LXL A;  3EHR A;  3JQ1 A;  4F3V A;  2LO6 A;  3HYM B;  2X3M A;  4XE0 A;  2JEK A;  4FU3 A;  3FDH A;  3HVE B;  2MNY A;  4U96 D;  3SBT B;  5BXO A;  3Q4A B;  4OAV B;  4YVQ C;  2F0Y A;  3HCS A;  3QK0 A;  3PZ1 A;  1WE9 A;  5T3R A;  1YYH A;  2YIN A;  4W9R A;  1JUQ A;  1WEW A;  3V2X A;  1MX6 A;  3TGO A;  2EQX A;  3FTS A;  3TXM A;  2D8S A;  3DXM G;  3UM0 A;  2C2V S;  1SZ9 A;  4UWK A;  2CG2 A;  2RG8 A;  2WXJ A;  3Q79 A;  4F1S A;  4GTS A;  5BW8 C;  2FO1 E;  1JOC A;  3EHN A;  1DCQ A;  3SBS A;  5G04 C;  4Z0R A;  4BT8 A;  3ZEF A;  4UI9 J;  2WXM A;  2QC9 A;  4EZJ A;  5CEC B;  4GCN A;  3VLF A;  2MIQ A;  4GTR A;  1SA5 A;  3LVQ E;  2MRI A;  3UUX A;  3SO8 A;  5ITZ F;  4A3T A;  4I7B A;  2LN0 A;  1MX2 A;  3QC1 A;  2WXR A;  3GW4 A;  2PZI A;  3GZ1 A;  2CRR A;  4UI9 K;  4G24 A;  3FUK A;  2NC9 A;  3ZUV B;  2FI7 A;  2JAB A;  4FIP A;  4JL0 A;  4HBD A;  4BFR A;  4B8A A;  1PAQ A;  5HS0 A;  3RO3 A;  3R7R A;  4DX6 D;  3UIN C;  4LK9 A;  4DX7 D;  2LXM A;  4H7Y A;  5BT1 A;  3NZU A;  4KXK B;  4H9D A;  4IC2 A;  2RKK A;  4AYC A;  3LY9 A;  4QQI A;  3DRA A;  2MYO A;  3L13 A;  1E8W A;  4HOT A;  4N5Q A;  3E30 A;  5EYL A;  3DDT A;  1NFI E;  5LKZ A;  1N9A A;  3ZKJ A;  4YDO A;  3O47 A;  5ENS D;  4Q69 A;  2X6F A;  2NAA A;  1HS6 A;  1H19 A;  2G6Q A;  2LV9 A;  2ETA A;  3K9I A;  1UN8 A;  3IHY A;  2WQ6 A;  2CRW A;  4KVM A;  5C1D A;  2ECI A;  3Q5M A;  1VYX A;  4U8Y D;  2EA6 A;  2D8U A;  4DPR A;  3DSW A;  3EJN A;  3MHS A;  4P29 A;  2YVR A;  2PQR A;  2ION A;  1HE8 A;  4LJN A;  3SOW A;  4Q6F A;  2A4Z A;  3DSV A;  5H1V A;  2DZN A;  2ECJ A;  2C0M A;  3T8M A;  1HYJ A;  4L7X A;  1TNB A;  2IQJ A;  3L16 A;  4Z68 A;  1BPO A;  1OCZ E;  3N9L A;  5AIU A;  4PH4 B;  4Y6W A;  5M72 A;  3Q9U C;  3DWD A;  4JA9 A;  1S0P A;  3T7L A;  2P9P G;  5JMN D;  3L1Z B;  5ENP D;  3C6W A;  3O7A A;  4WZ2 A;  3AU4 A;  1WFK A;  2F6J A;  2XOZ A;  3PUK A;  5TDW A;  4U7E B;  4ANX A;  1S64 A;  4ABN A;  2F37 A;  5CCM A;  4HFG A;  5AN8 A;  2CHW A;  4L2L A;  3AU5 A;  5KJN A;  5KJM A;  3D9O A;  2XGM A;  4S3O B;  5ANL A;  4QF3 A;  3EB5 A;  3UIP C;  2VPD A;  2VSN A;  3E32 A;  4RG9 A;  2R2L A;  4I1A A;  2FSA A;  3OXL A;  3CSF A;  5A6C A;  1D9S A;  2BKK B;  1W3B A;  3G2T A;  3LQH A;  4EEC A;  3S2A A;  1V54 E;  4A3V A;  1SVX A;  3LYA A;  2QFC A;  2FUI A;  2NXP A;  3MA5 A;  1WEQ A;  4IRU A;  1MYO A;  5HI7 A;  4YVO A;  1VFY A;  2ECV A;  2E0I A;  4I1M A;  4FP7 A;  4JHR A;  2AXV A;  2AN6 A;  3KEZ A;  1TNZ A;  4U63 A;  4U95 D;  2NSZ A;  4TV3 A;  3CK8 A;  4A4B A;  5G0F A;  1YCS B;  1X5B A;  3UT8 A;  1A5E A;  3B13 A;  2IDA A;  1OWO A;  2KWN A;  4U07 A;  4DX2 A;  4XZ4 A;  2MKE A;  2FD4 A;  3Q75 A;  5LKU A;  3IHV A;  3SNX A;  4J7W A;  4XI9 A;  2VPB A;  5AAO A;  2XB1 A;  3FUL A;  4I9C A;  2DJA A;  2ECN A;  2KCL A;  5DKA A;  4BX8 A;  5KCM A;  1NZN A;  4WWO A;  4F52 B;  4MVT A;  1Z60 A;  3MV2 B;  1JM7 B;  3M62 A;  3PLW A;  2IF4 A;  3ZGQ A;  1MX4 A;  3KSQ A;  4U04 A;  2M3H A;  4G26 A;  2PQN A;  2AXZ A;  1JCS A;  1TN8 A;  3FUI A;  3PRZ A;  2X6H A;  3N9M A;  3DPL R;  2J09 A;  3LJ3 A;  2WB2 A;  3JCK C;  4GZ6 A;  5C13 A;  3HHM A;  4EZL A;  1ELW A;  1TR4 A;  3U5N A;  2J4B A;  3R9M A;  5LCW J;  4FLH A;  1SA4 A;  2J8S D;  4WNF A;  1N52 A;  5C11 A;  3R9A B;  3MKR A;  2WXN A;  3T5V A;  2KWJ A;  2EIJ E;  4R8P K;  1KZP A;  2KC7 A;  3MKQ A;  4G1T A;  2ECW A;  3ASN E;  2ETB A;  4O1O A;  3B7U X;  3DPY A;  2H0D B;  3PZD A;  2WXP A;  2VJF B;  4C9B B;  3RU0 A;  2WVI A;  3ISM C;  3SHF A;  1HYI A;  3U9W A;  2LQ6 A;  4RVB A;  4K0R A;  4GTP A;  3V31 A;  2KWK A;  2XEN A;  4J0U A;  4APO A;  2R03 A;  4I17 A;  4FK5 A;  1N0R A;  3O4Z A;  2MD8 C;  1HH8 A;  3D3M A;  1FT2 A;  5BV0 A;  3L17 A;  2KZT A;  5CER B;  2J9Q A;  1ZBD B;  3D9I A;  2WXO A;  4A55 A;  4Y6C A;  1WEO A;  1X4J A;  1FBV A;  3Q78 A;  1YA0 A;  1HU3 A;  3D9L A;  2WXQ A;  3HRA A;  2XQ0 A;  1OCR E;  2J49 A;  1OWN A;  4DRX E;  3HXF A;  3KDE C;  4J8S A;  2L6B A;  5LX8 A;  1YMP A;  3ONK A;  2M13 A;  5D1K B;  3FTW A;  2KM4 A;  2DWZ A;  5B3S E;  3O35 A;  3BEE A;  3LXU X;  3LDZ A;  1TN7 A;  4BBQ A;  5ENQ D;  4ACK A;  2GRO B;  4N2Q A;  2CFZ A;  5CEA A;  1FT1 A;  1WAO 1;  2VJE A;  2EXU A;  4I7C A;  4MBG A;  2JMJ A;  3FTZ A;  4FC8 A;  3UQ3 A;  1IHG A;  3ZVV A;  4BET A;  2ZU6 B;  3MJW A;  1QYM A;  2VYI A;  3U3W A;  2K16 A;  3HVE A;  4UQX A;  2OND A;  3ASG A;  3CVP A;  3IV0 A;  5CMY A;  4UI9 C;  1LD8 A;  4TUU A;  5EIL A;  2WM9 A;  2L43 A;  4KYO B;  4NAC A;  1TNO A;  2JM3 A;  3PUJ A;  3FTV A;  2E2E A;  4CCG X;  3FM8 C;  4K5A B;  2I50 A;  2XZD G;  4OYS A;  5E75 A;  5HKP A;  4AP2 A;  4I2W A;  1VDY A;  4G11 A;  1INZ A;  3O33 A;  4TXR A;  3TWT A;  2ECT A;  2ILR A;  4GMR A;  3UKR G;  5G05 C;  3ZYK A;  4S3O C;  5SVI A;  5DBK A;  3FH7 A;  3M99 A;  4PTB A;  4RG6 A;  2KGG A;  2I1J A;  2QY7 A;  2DYR E;  3PZ3 A;  3M63 A;  4AP4 A;  3V43 A;  1UJK A;  4UP5 A;  2HDP A;  2LXH C;  5FB0 A;  5LFA A;  4I7D A;  5TRB A;  5AJL A;  5AAR A;  3SY2 A;  4AIF A;  2YQM A;  3AS4 A;  4JEH A;  3RJV A;  1LTX A;  1X4U A;  1EDU A;  1QNF A;  4A1S A;  4N3W A;  2WXI A;  3KQI A;  3X2Q E;  3DEP A;  1DC2 A;  2RD0 A;  4DK5 A;  4ACL A;  3ZPJ A;  2GRP B;  3Q7A A;  3JUE A;  4J8Y A;  4GNG A;  5KNG A;  1HF8 A;  2XCB A;  1MZC A;  4UQZ A;  4FLB A;  2KKX A;  4K5C A;  2DBA A;  3M7K A;  3CHM A;  3G2S A;  3RK6 A;  4O1P A;  3IEG A;  5SVX A;  3TG5 A;  2CFU A;  4N39 A;  3DPD A;  4B7Y C;  4GA1 A;  4O64 A;  4HRL A;  3B7R L;  2YQ8 A;  3L11 A;  2VGX A;  3LKU A;  2VSX E;  3FJU B;  4HI8 A;  3D9N A;  3NOG D;  3APD A;  3UKU G;  2WXK A;  3N9Q A;  5D2M C;  2MD7 B;  3L9T A;  3BU8 A;  3CK9 A;  4ILH B;  4PPE A;  2UZG A;  2ZET C;  3FP3 A;  2P9U G;  3D9H A;  3FAO A;  5BUZ A;  3CHR A;  4O62 A;  3N9N A;  3HG0 D;  2YUC A;  4YBT A;  2LGL A;  2FBN A;  3ULE G;  2FUL A;  2KAT A;  4NQ0 A;  4WZ3 B;  3CR3 A;  3EB6 A;  2KIZ A;  5G55 A;  1OWP A;  1K1A A;  1OUV A;  1OY3 D;  1H0A A;  2QIZ A;  3KNV A;  3VTY A;  1E8X A;  4YAD A;  2QZA A;  4GML A;  3QJZ A;  5DIZ A;  4OAU C;  2VSO E;  4IYP A;  2DYS E;  4GTV A;  1H2V C;  1IXV A;  3FU0 A;  3DQV R;  4OVU A;  3SQV A;  2AW6 A;  2XOC A;  3HTK C;  3R7Q A;  4B93 B;  3CVV A;  1TNY A;  4QFV A;  4L23 A;  3G2W A;  4U8H A;  2YU4 A;  1FPP A;  2DSM A;  3ZPV 1;  4FAD A;  1DVP A;  3WG7 E;  3CVQ A;  2PM6 A;  4XI1 A;  4V3K C;  3L22 A;  1EYH A;  2VQ2 A;  2X6K A;  3E37 A;  3CVY A;  4HB5 A;  5B76 A;  4KBQ A;  3I3N A;  4LSZ E;  5FJY A;  5G2N A;  1Z5S C;  4QQ4 A;  5K3Q A;  1WIM A;  2F6N A;  4UI9 B;  4FUL A;  3TWR A;  3BUA A;  3LEW A;  4DUI A;  3UXG A;  2CSV A;  3ML8 A;  4MKT A;  1ZBP A;  2BAY A;  5T4Y A;  2JUN A;  4N5C A;  3S7D A;  5H1U A;  2NYJ A;  4HVB A;  5T8I A;  3CGH A;  3RRN B;  1OWM A;  5JJ7 A;  2XEU A;  3D9P A;  4GYW A;  4C0E A;  3HIZ A;  5D0O D;  2K1J A;  3TXN A;  3ZHE B;  2Y43 A;  4ATZ D;  4LCT A;  4LNB A;  2VSY A;  2YRE A;  5LCW C;  4B8C B;  3CV0 A;  1JPL A;  5B75 A;  4I9E A;  1GW6 A;  4MS6 A;  4JC8 A;  2I6H A;  4A1G A;  5FZS A;  4CDN A;  1XNF A;  4YDE A;  3SUB A;  3NG2 A;  1JM7 A;  2VTB A;  5C2Y A;  1XGW A;  1AWC B;  2PUY A;  3O34 A;  1UOH A;  3SFZ A;  2GRL A;  3EHM A;  3PE4 A;  5AQ9 A;  4AY6 A;  2R17 C;  4WAF A;  3ESK A;  2E61 A;  2L0B A;  2B0O E;  3FUJ A;  4GTM A;  1SZA A;  1PC2 A;  5KJL A;  2XGO A;  4CDR A;  2UY1 B;  1UW4 B;  3DBS A;  2PNN A;  3V2O A;  3KEA A;  2YW8 A;  3ASD A;  3B7B A;  4GB0 A;  2XPI A;  2VGE A;  4C48 B;  4LNU D;  5D0Q D;  2DVW A;  2FO7 A;  5TBN A;  2MA6 A;  4U0S A;  5LKX A;  2KR4 A;  5ENN A;  4BY6 A;  1HG2 A;  4RLY A;  5CRU A;  4U0U A;  5BNW A;  3OXG A;  2E6S A;  4GMJ A;  3AS8 A;  4UUC A;  5LKT A;  3I4G A;  3BQO A;  3TG4 A;  3ZYM A;  3LVR E;  2B6C A;  3FUD A;  3N9O A;  1N54 A;  2WQ7 A;  5CMW A;  3C3Q A;  4ILG A;  5G04 J;  1FCH A;  2HO1 A;  3JYS A;  4GZ5 A;  4JPS A;  4BTA A;  4GYO A;  4JW1 A;  5H1T A;  2CKL B;  2L75 A;  2R59 A;  4EZK A;  1LDJ B;  3ESL A;  4A49 A;  3TWU A;  4YC9 A;  5G04 B;  1N4R A;  1JWF A;  4L7T A;  4Q94 A;  2YSJ A;  3SOU A;  3I2D A;  1D8D A;  4O6F A;  1Z6T A;  1IQR A;  3TWV A;  5TAB A;  1NA0 A;  4JB8 P;  2HYZ A;  4YAX A;  4C0M A;  3PH0 C;  2G45 A;  3PNL B;  4LER A;  4RSY A;  2CSY A;  2KU3 A;  1A17 A;  3N71 A;  4GZ3 A;  3EUV A;  1EPU A;  5AEN A;  5B1B E;  2YHO A;  2DCP A;  4AV7 A;  3SOX A;  4TUM A;  4CYM D;  1TYQ G;  2MHK A;  3V30 A;  2XRZ A;  3D9K A;  4YDW A;  3CST A;  2RFA A;  3QAR A;  1CHC A;  3ZW3 A;  3FH8 A;  1U3C A;  2KE1 A;  2WXF A;  3MX3 A;  3TAX A;  2BED A;  3VTX A;  1WIL A;  1KT0 A;  3CVU A;  3NOC D;  2LSV A;  3WXX A;  5A23 A;  4B0Z A;  4HRN A;  4EQF A;  4G25 A;  2Y1L E;  4GA0 A;  1JWG A;  4URK A;  3QDN A;  2BKG A;  3ZIM A;  2VJE B;  4N4F A;  1MM2 A;  2XEV A;  1HG5 A;  3GYZ A;  3SD5 A;  2QYJ A;  1WEM A;  4WNG A;  3MHH A;  2P2C P;  4HOS A;  5B77 A;  1WES A;  5CED B;  2L0T B;  4CT4 A;  4KMO A;  2KCV A;  4BHW A;  1WM5 A;  2XHE A;  4JZY A;  5LOZ A;  2HM8 A;  1OXJ A;  3FFL A;  1K2F A;  1N87 A;  1K3Z D;  3AS5 A;  5TDR A;  3L82 A;  3NF1 A;  1OWL A;  2RSD A;  2P57 A;  4L9P A;  2LAU A;  4Z0O A;  5ENT D;  5FT9 A;  2H6I A;  3ULY A;  2EOD A;  4OGC A;  1SW6 A;  3U5O A;  3AG4 E;  1ZB1 A;  3O36 A;  2LRI C;  5KH9 A;  3T9K A;  2LSU A;  3ASO E;  2AWI A;  4AY5 A;  3FL2 A;  3ENE A;  5SVI B;  4DI4 A;  5AIJ A;  4F53 A;  4J6I A;  4F6R D;  4C9Z A;  3JUI A;  4FJY A;  3PZ2 A;  2OWA A;  4A4C A;  4GTQ A;  5AQA A;  1E8Y A;  3VLE A;  3KV5 A;  4NIK A;  4BT9 A;  1FP0 A;  4HRM B;  2WXH A;  3LY7 A;  3G2V A;  3Q7F A;  5JA4 D;  4EBA G;  4AEZ C;  3HXB A;  4WZ0 A;  4CDM A;  3HCU A;  4B94 A;  1HFA A;  1E8Z A;  3CKB A;  1IHB A;  2XRY A;  4GYY A;  3PUQ A;  3ABK E;  3SGH A;  4Q96 A;  1XWH A;  2VJ8 A;  3HCT A;  3EIJ A;  3D9J A;  2YYR A;  5EYA F;  2OCC E;  4K5B A;  2XPZ A;  4RQI A;  1LF8 A;  4BEP A;  4LKA A;  1L5J A;  3NB2 A;  4NN2 A;  3DXK G;  4FHJ A;  1QZ2 A;  2M85 A;  4LRZ A;  3NAW A;  5JG6 A;  3DWL G;  3L6A A;  2IJG X;  2YHE A;  2IOL A;  3BG0 B;  4LEU A;  1OCC E;  4M3O A;  3O70 A;  2ZGG A;  2OVB A;  4AVX A;  2PM7 A;  2AVP A;  2ZXW E;  3ULQ A;  1RZ4 A;  1BOR A;  1H6K A;  1BI7 B;  4GA2 A;  4UWL A;  3U5M A;  1Y6I A;  1WDY A;  3ZN3 A;  3RRU A;  4P5O B;  5ARF A;  2R05 A;  2XS1 A;  3FEY A;  4HLE A;  2I9C A;  4XX5 A;  3HXC A;  2A5U A;  5BXU A;  3LS8 A;  4BSZ B;  3MCX A;  4GTO A;  3ZVZ B;  1Z3Y A;  3ABL E;  3FU6 A;  4PUC A;  2KBX A;  1N94 A;  3MGB A;  3ML9 A;  4ATG A;  1K1B A;  1O1S A;  4CZ2 D;  3RIB A;  3C5K A;  4DX1 A;  3EU5 A;  1N11 A;  5J3X A;  2H6H A;  1G3N B;  3C3R A;  2C0L A;  2KYU A;  2WMN A;  4I43 A;  4AYC B;  3OAW A;  3UMV A;  1KZO A;  2OV8 A;  3QNK A;  2BUG A;  1UJJ A;  3UIO C;  4IC3 A;  1QBQ A;  2LNI A;  3CHS A;  2OVF A;  4YBS A;  1NP7 A;  1BLX B;  5KWD A;  2M6M A;  1D8E A;  3PS6 A;  3H7H A;  2FEZ A;  3CHO A;  2R02 A;  3KAE A;  3J5Q B;  2J4D A;  1TJC A;  2QJ0 A;  2XZT G;  5JHB A;  5G05 B;  4YBM A;  2WXL A;  2V4H C;  3P2B A;  4GAA A;  5BPP A;  4APF A;  2MNZ A;  2HR2 A;  4ANW A;  4N3A A;  3QOU A;  4R7E A;  3VK6 A;  4KZ0 A;  4MSX A;  4ILI A;  5HRY A;  1U6G B;  5FTP A;  3NZS A;  4TXQ A;  1PY1 A;  2GGF A;  3Q49 B;  4JXT A;  3PHD A;  2LXP C;  3ZXP A;  2CG3 A;  3MDB C;  2L80 A;  3L1X A;  4N2S A;  3EHQ A;  2LGG A;  4ZDT A;  3OTN A;  5ARG A;  3FU3 A;  3JQ0 A;  4U8V D;  4O60 A;  3PEV B;  1MJ0 A;  2X6I A;  1WGM A;  4ME2 A;  2GRN B;  2FF4 A;  5FWQ A;  1H6P A;  4J8D A;  4PDX A;  4GCO A;  4JD2 G;  2K4D A;  2YSM A;  2ZIR A;  3HXE A;  4ZFH A;  2RFM A;  3T5X A;  2EIM E;  4D10 C;  1NL4 A;  1WEE A;  5G05 J;  3PNT B;  3RAU A;  3L54 A;  4E6H A;  5SVY A;  3URZ A;  4GTT A;  2EGP A;  1LD7 A;  3B95 A;  3ZYL A;  4ZQL A;  4F7A A;  5CHE E;  3RSE G;  4E85 A;  5B78 A;  3APF A;  3UX4 A;  3F6Q A;  5AJD A;  2XS8 A;  1K8K G;  2EIL E;  1E90 A;  4ZHB A;  3MEK A;  3J5P A;  1NA3 A;  4XKB A;  1RMD A;  5EDS A;  2OEV A;  4XIF A;  2BTD A;  4I1O B;  4PS3 A;  3N9P A;  5HQ8 A;  5I3L A;  3TL5 A;  1OT8 A;  3C72 A;  2XPY A;  3CVL A;  3ZNG A;  4UWF A;  4TXP A;  4CEM A;  3T8K A;  4JHK A;  3B7S A;  4EHM A;  4HOR A;  1DNP A;  3HXD A;  1MHQ A;  3ZYQ A;  4GPK A;  5KNH D;  2M63 A;  3FH5 A;  3RO2 A;  3QWW A;  5EX0 A;  4FJZ A;  3B7T A;  3ZPV E;  4U0Z A;  1FVF A;  2MUM A;  4L58 A;  1VD4 A;  2V8S E;  2P9L G;  5KBA A;  2XP0 A;  4WND A;  3T6R A;  5BV1 A;  2VP7 A;  5JJT A;  1N4S A;  1DCE A;  3UM2 A;  1WEV A;  2CKL A;  1FVH A;  3QAQ A;  5FIO A;  3GL6 A;  1HX8 A;  3Q73 A;  1UN9 A;  2RI7 A;  1S70 B;  4BWR A;  3AG1 E;  2A5E A;  2HE0 A;  2L5U A;  3IHP A;  4MLP A;  1X81 A;  3RKV A;  4G8K A;  4GU5 A;  5ENR D;  2Y4U A;  1H2U A;  2FUU A;  4GNF A;  3Q47 B;  3LDY A;  2DIW A;  4L2Y A;  2KKY A;  4B89 A;  4GND A;  2VNF A;  3S7F A;  3CHP A;  2IO2 C;  1RW2 A;  2Q7F A;  3IKO B;  1V55 E;  2Y1N A;  4LG6 A;  4H7X A;  1ELK A;  4JEU A;  3S7B A;  3KS2 A;  5KH7 A;  4FA6 A;  4HNA D;  2VPG A;  2H6F A;  4IUL A;  2RR4 A;  4FJC A;  5FZQ A;  4A63 B;  4UWH A;  3V79 K;  2CON A;  3RPG B;  2V0P A;  4EPZ A;  3CVX A;  5B8D A;  3DSU A;  2H0D A;  1OCO E;  3ZNI A;  2E6R A;  2VJF A;  4DI3 A;  2DX8 A;  4X8Q A;  2UWJ G;  3PVL A;  2XEE A;  4ZUX U;  3P1U A;  2VGX B;  4QF2 A;  3CLJ A;  1E96 B;  2ZGD A;  3PUR A;  2L0I A;  3APC A;  2X38 A;  3FUF A;  4CA1 A;  3I5P A;  3LJN A;  1SQM A;  2ETC A;  3FUN A;  5EYP F;  4BX9 A;  1T1H A;  2IO3 C;  1WEU A;  4L1B A;  4BTB A;  5AYW D;  5FQ6 A;  2KCK A;  5FQ8 A;  2IFU A;  3TJP A;  3FUM A;  2EIK E;  3UTM A;  2CHZ A;  2MT5 A;  2MA5 A;  1JCQ A;  2XGS A;  1IQU A;  2GRM A;  5E76 A;  2P58 C;  4UP0 A;  2P9S G;  3FEH A;  4WNE A;  3O48 A;  1F62 A;  3IBE A;  5AIT A;  5EID A;  4HOQ A;  5FQ7 A;  3I4R B;  4YAB A;  3LCA A;  1Y8M A;  2R5S A;  1TNU A;  2JMD A;  3UI2 A;  4N3B A;  4V3I A;  1E4U A;  1O1R A;  4HQD A;  5D66 A;  3RTR B;  1IYM A;  3RRM B;  5FB1 A;  3KD7 A;  3ASF A;  1HZ4 A;  4BER A;  2V5Q C;  3NBN B;  4G2V A;  2EGM A;  1BI8 B;  2PL2 A;  4GPM A;  4AOF A;  4PS8 A;  3JXI A;  3AJI A;  3Q15 A;  3GV4 A;  3SZ7 A;  4WWP A;  2Y1M A;  2KWO A;  5JJ6 A;  3VLD A;  4TKP B;  2L9B A;  1HO8 A;  4GZC A;  3CKC A;  2G43 A;  3ASH A;  3SFY A;  3LRQ A;  1U3D A;  3ZU7 B;  5EX3 A;  4CT0 A;  2P9K G;  4XEI G;  2OEW A;  3ONL A;  3IXE A;  3PE3 A;  4F1P A;  2LDR A;  3TWX A;  4DLQ A;  5D1L B;  3FTX A;  1IYG A;  4XI0 A;  3FUE A;  4J8F A;  4X3G A;  3UM3 A;  3E2D A;  2ZIS A;  3LQJ A;  1KT1 A;  1EF1 C;  2AJA A;  2I1K A;  2AXU A;  3U64 A;  3TWW A;  2OOE A;  3FUH A;  3ZTG A;  3CK7 A;  3SFX A;  2P9I G;  3TWQ A;  4G23 A;  3FWV A;  2XOY A;  1IKN D;  5EKQ D;  3HDX A;  4LAD B;  3MZL B;  1ZU2 A;  2I2O A;  1N4Q A;  5IY5 E;  4KT6 B;  3ASL A;  4K03 A;  3CIA A;  4W4U A;  1S63 A;  2X6J A;  5FEY A;  5FQ4 A;  4UQY A;  3CQG B;  1TJF A;  1QQE A;  3DEO A;  3S7J A;  3FTY A;  2P9N G;  4OGE A;  1KPS B;  1G25 A;  3PRE A;  4R2Y A;  2VTB B;  1MQS A;  5CBO A; 
#chains in the Genus database with same CATH homology
 4IYP A;  5KJK A;  3PUK A;  5TDW A;  2YQL A;  3LQI A;  3UPV A;  4ANX A;  4CRW A;  1H2V C;  5J3X A;  4ABN A;  3FU0 A;  3DQV R;  3U4T A;  4OVU A;  2AW6 A;  2KFT A;  3HTK C;  3R7Q A;  3QWP A;  4QFV A;  4OVV A;  4L23 A;  5CCM A;  3CVV A;  3G2W A;  2CSZ A;  2KGI A;  4U8H A;  2C0L A;  2YU4 A;  2KYU A;  3GZ2 A;  4ZDT A;  4HFG A;  2WMN A;  4YND A;  4I43 A;  3ZPV 1;  2CHW A;  4FAD A;  1DVP A;  4AYC B;  4L2L A;  3AU5 A;  5KJN A;  3OAW A;  4GB9 A;  5KJM A;  3CVQ A;  3D9O A;  2PM6 A;  2XGM A;  3UMV A;  2OV8 A;  2V4L A;  3QNK A;  4S3O B;  2BUG A;  4XI1 A;  5ANL A;  3O37 A;  4QF3 A;  3L22 A;  3CVW A;  1EYH A;  2LAI A;  1UJJ A;  2VQ2 A;  2X6K A;  4CCA A;  3EB5 A;  4IC3 A;  2C2L A;  2VPD A;  2VSN A;  4RG9 A;  3G2U A;  5LP0 A;  4I1A A;  4FHK A;  3CVY A;  2FSA A;  3OXL A;  3CVN A;  3CSF A;  2LNI A;  4I6G A;  3CHS A;  2OVF A;  4NUR A;  5A6C A;  1X4I A;  2M1R A;  1W3B A;  3G2T A;  4KBQ A;  1NP7 A;  2CT2 A;  2M6M A;  3KV6 A;  3LQH A;  5B76 A;  2Y4T A;  3S2A A;  3I3N A;  4EEC A;  3PS6 A;  2FEZ A;  2Y3A A;  3CHO A;  3FHE A;  4A3V A;  5FJY A;  3KAE A;  3QKY A;  5G2N A;  1Z2Q A;  3LYA A;  2QFC A;  2FUI A;  5B79 A;  2NXP A;  3MA5 A;  2J4D A;  1WEP A;  3ZRH A;  1WIM A;  1TJC A;  2QJ0 A;  1WEQ A;  4IRU A;  2F6N A;  4FUL A;  4UI9 B;  5HI7 A;  5JHB A;  3EDT B;  5G05 B;  4YBM A;  3LEW A;  4GZD A;  2WXL A;  4YVO A;  1VFY A;  3P2B A;  4GAA A;  2ECV A;  2E0I A;  4I1M A;  4FP7 A;  4JHR A;  2AXV A;  5BPP A;  3ML8 A;  3KEZ A;  4APF A;  2AN6 A;  2MOW A;  2J07 A;  4U63 A;  4MKT A;  5JHA A;  2MNZ A;  5LCW B;  2HR2 A;  4ANW A;  4N3A A;  1ZBP A;  3FEX A;  2NSZ A;  3QOU A;  4R7E A;  3VK6 A;  4KZ0 A;  4MSX A;  4ILI A;  2WPV A;  4LUN U;  5T4Y A;  4BSX A;  5FTP A;  4TV3 A;  3CK8 A;  4AXH A;  1U6G B;  3NZS A;  4A4B A;  5G0F A;  1PY1 A;  3UT8 A;  1X5B A;  2GGF A;  4N5C A;  3S7D A;  3Q49 B;  4JXT A;  2QIC A;  4FO9 A;  3PHD A;  4WA6 A;  4AUQ B;  2LXP C;  4HVB A;  3B13 A;  3QZV A;  2CG3 A;  2IDA A;  1OWO A;  2JRJ A;  5T8I A;  4KZC A;  3CGH A;  1B89 A;  2KWN A;  3RRN B;  1OWM A;  3NQP A;  2WQH A;  4U07 A;  5JJ7 A;  4N2S A;  2LGG A;  2XEU A;  3L1X A;  3OTN A;  3EIQ C;  3PDN A;  4PS7 A;  4XZ4 A;  5ARG A;  2YHN A;  5LKU A;  3IHV A;  3D9P A;  3FU3 A;  3JQ0 A;  3SNX A;  2LGV A;  4GYW A;  1KLX A;  3PEV B;  3BG1 B;  4XI9 A;  4C0E A;  2X6I A;  4XKC A;  1WGM A;  3HIZ A;  4ME2 A;  5D0O D;  2K1J A;  3TXN A;  2VPB A;  2FF4 A;  3ZHE B;  3L08 A;  2XB1 A;  2LGK A;  5FWQ A;  3FUL A;  4J8D A;  2Y43 A;  4LLB A;  2IU1 A;  4LCT A;  4PDX A;  4I9C A;  2IQC A;  4GCO A;  1WY6 A;  2ECG A;  2K4D A;  3MV3 B;  2ECN A;  2KCL A;  2YSM A;  5FER A;  2VSY A;  2YRE A;  3QB2 A;  5DKA A;  5LCW C;  2YHC A;  4B8C B;  4BX8 A;  3CV0 A;  3T5X A;  1JPL A;  2GW1 A;  1NZN A;  1GW6 A;  4I9E A;  4JC8 A;  4MS6 A;  4WWO A;  2I6H A;  5KCM A;  4D10 C;  4A1G A;  4IN3 B;  1WEE A;  2YUR A;  5FZS A;  1ELR A;  4TRQ A;  4I2Z A;  4ANU A;  3MV2 B;  5G05 J;  1V87 A;  3PNT B;  4JA7 A;  1Z60 A;  4MVT A;  4F52 B;  1JM7 B;  3L54 A;  4CDN A;  4E6H A;  1XNF A;  3NG2 A;  3URZ A;  1JM7 A;  3M62 A;  2EGP A;  1E7V A;  2IF4 A;  2VTB A;  4HS2 A;  3ZGQ A;  5C2Y A;  4U04 A;  1XGW A;  3SF4 A;  2M3H A;  2PUY A;  4G26 A;  3ZYL A;  3O34 A;  4ZQL A;  3SFZ A;  2GRL A;  4F7A A;  5CHE E;  2PQN A;  3EHM A;  3PE4 A;  2WXG A;  2AXZ A;  3MYV A;  3PEU B;  4JHJ A;  2CHX A;  2WMO A;  3APF A;  4E85 A;  2R17 C;  3FUI A;  3PRZ A;  4AY6 A;  2F42 A;  4WAF A;  5B78 A;  3UX4 A;  2X6H A;  3ESK A;  5AJD A;  3N9M A;  2L0B A;  3DPL R;  3FUJ A;  2J09 A;  3FU5 A;  4I6J A;  1SZA A;  1E90 A;  3LJ3 A;  2WB2 A;  1PC2 A;  3JCK C;  5KJL A;  4GZ6 A;  2XGO A;  4CDR A;  3MEK A;  2UY1 B;  3HHM A;  5C13 A;  1UW4 B;  1H2T C;  3DBS A;  4EZL A;  1ELW A;  1NA3 A;  3D9M A;  4XKB A;  1RMD A;  3U5N A;  5EDS A;  4XIF A;  2YW8 A;  3ASD A;  2K17 A;  2BTD A;  4GB0 A;  4I1O B;  2XPI A;  4PS3 A;  2J4B A;  3N9P A;  5HQ8 A;  2KRE A;  5LCW J;  4FLH A;  5I3L A;  1LDK C;  3TL5 A;  3U5P A;  3U66 A;  2JMI A;  2XPY A;  4WNF A;  1HYI A;  1N52 A;  3CVL A;  5C11 A;  3R9A B;  3MKR A;  2WXN A;  5D0Q D;  3LPZ A;  3T5V A;  2KWJ A;  3MKQ B;  4R8P K;  4KVO A;  2XCC A;  2FO7 A;  4UWF A;  2YT5 A;  2MA6 A;  5TBN A;  4U0S A;  5DIN A;  5J08 A;  4CEM A;  5H9M A;  5LKX A;  4JHK A;  3B7S A;  4B86 C;  2KC7 A;  3MKQ A;  2KR4 A;  5ENN A;  4BY6 A;  4G1T A;  2ECW A;  1HG2 A;  4HOR A;  1DNP A;  1MHQ A;  3ZYQ A;  2HYE D;  4GPK A;  3B7U X;  3CQC B;  4DLO A;  3OXF A;  4U0U A;  2M63 A;  5BNW A;  2H0D B;  3OXG A;  2E6S A;  3PZD A;  4GMJ A;  3FH5 A;  3RO2 A;  3ZFW A;  2WXP A;  3AS8 A;  3QWW A;  5EX0 A;  3ZVY A;  5LKT A;  4J8E A;  4FJZ A;  4R7L A;  5CCL A;  2VJF B;  4C9B B;  3SHB A;  3B7T A;  2V5F A;  3UT7 A;  1UG3 A;  4DJA A;  3ZPV E;  3I4G A;  3RU0 A;  4U0Z A;  1FVF A;  2WVI A;  3TG4 A;  3ZYM A;  2YNQ A;  3LVR E;  2V8S E;  3FUD A;  4N3C A;  4EBA A;  1VD4 A;  1N54 A;  2MUM A;  2PNX A;  2WQ7 A;  5CMW A;  3N9O A;  4ILG A;  4WND A;  5G04 J;  4AM9 A;  4CGW A;  1FCH A;  2HO1 A;  3T6R A;  3JYS A;  4GZ5 A;  4JPS A;  3SHF A;  3U9W A;  4MRU A;  5BV1 A;  4RVB A;  2L80 A;  2LQ6 A;  4BTA A;  2VP7 A;  4GYO A;  4JW1 A;  5H1T A;  3QWV A;  2CKL B;  5JJT A;  4K0R A;  2R59 A;  4EZK A;  1E7U A;  2LAH A;  3CHQ A;  1LDJ B;  2KWK A;  3RPG C;  3ESL A;  4A49 A;  4J0U A;  4APO A;  4GNE A;  3C98 A;  4I17 A;  2BF0 X;  3O4Z A;  1WEV A;  2CKL A;  4FK5 A;  4YC9 A;  5G04 B;  1FVH A;  1HH8 A;  3D3M A;  2MD8 C;  5H1U A;  3QAQ A;  4L7T A;  1JWF A;  2J08 A;  4Q94 A;  4WUY A;  1HX8 A;  2L6J A;  2YSJ A;  3GL6 A;  2KZT B;  3I2D A;  5BV0 A;  1UN9 A;  3L17 A;  3E4B A;  2RI7 A;  4O6F A;  1Z6T A;  5J90 A;  2KZT A;  4BWR A;  2J9Q A;  3ZHE A;  1IQR A;  3D9I A;  1ZBD B;  5TAB A;  2WXO A;  1NA0 A;  1Z3X A;  2HYZ A;  5FZR A;  3UT4 A;  4A55 A;  4V3L C;  4YAX A;  4ANV A;  4Y6C A;  3PH0 C;  4C0M A;  4HOU A;  1WEO A;  1X4J A;  2G45 A;  3PNL B;  4LER A;  2L5U A;  4RSY A;  1FBV A;  2CSY A;  4MLP A;  1A17 A;  3FY4 A;  2KU3 A;  3N71 A;  4GZ3 A;  4JVS A;  3RKV A;  1YA0 A;  1HU3 A;  3GZS A;  5D1M B;  1EPU A;  3D9L A;  5AEN A;  4GU5 A;  2WXQ A;  1P5Q A;  2YHO A;  2Y4U A;  1H2U A;  2DCP A;  4UWG A;  4AV7 A;  1Z6U A;  2XQ0 A;  2FUU A;  3KNV A;  4GNF A;  3Q47 B;  4YAT A;  3SOX A;  2XRZ A;  2MHK A;  2J49 A;  1OWN A;  4CGV A;  2DIW A;  3D9K A;  4L2Y A;  4WWN A;  3CST A;  2VGY A;  4B89 A;  2IOS A;  2OXQ C;  3QAR A;  4NRH B;  1CHC A;  2VNF A;  4GND A;  4J8S A;  3ZW3 A;  3CEQ A;  4I6E A;  3ONK A;  3SI5 A;  4HXI A;  5LX8 A;  4A0C D;  5D1K B;  3FH8 A;  1U3C A;  3CHP A;  2WXF A;  3S7F A;  2JLB A;  3FTW A;  1MM3 A;  3MX3 A;  2KM4 A;  2KE1 A;  2VPE A;  2Q7F A;  3IKO B;  3O35 A;  5KH3 A;  1HXI A;  3TAX A;  3BEE A;  3VTX A;  1TEZ A;  2L75 A;  3LXU X;  3LDZ A;  1WIL A;  2Y1N A;  1KT0 A;  3CVU A;  4BBQ A;  3LY8 A;  1WEN A;  4ACK A;  2UY1 A;  4H7X A;  2LSV A;  3FTU A;  5A7D B;  1ELK A;  5ANR A;  4JEU A;  3WXX A;  4AJW A;  5A23 A;  3S7B A;  3KS2 A;  4B0Z A;  5KH7 A;  4FA6 A;  4N2Q A;  2CFZ A;  4EQF A;  3ZXS A;  4G25 A;  1WAO 1;  2VJE A;  4GA0 A;  2VPG A;  1JWG A;  4I7C A;  2JMJ A;  3JQ1 A;  4F3V A;  4URK A;  3FTZ A;  3QDN A;  3ZIM A;  4FC8 A;  2LO6 A;  3HYM B;  4IUL A;  2VJE B;  1MM2 A;  3UQ3 A;  4FJC A;  2X3M A;  4XE0 A;  2XEV A;  2JEK A;  4FU3 A;  3FDH A;  1IHG A;  3HVE B;  5FZQ A;  4UWH A;  2MNY A;  3ZVV A;  2ZU6 B;  3MJW A;  3SBT B;  3Q4A B;  1HG5 A;  3GYZ A;  2VYI A;  4YVQ C;  3SD5 A;  4WNG A;  3U3W A;  1WEM A;  3HCS A;  2K16 A;  3MHH A;  3RPG B;  2V0P A;  3HVE A;  3QK0 A;  4UQX A;  4HOS A;  2OND A;  5B77 A;  4EPZ A;  3ASG A;  3CVX A;  1WES A;  3CVP A;  5B8D A;  2L0T B;  4CT4 A;  1WE9 A;  3IV0 A;  5CMY A;  2H0D A;  4UI9 C;  5T3R A;  3ZNI A;  4KMO A;  2E6R A;  4TUU A;  2VJF A;  2KCV A;  2WM9 A;  4DI3 A;  2L43 A;  2DX8 A;  4BHW A;  1WM5 A;  2XHE A;  4JZY A;  2UWJ G;  2HM8 A;  5LOZ A;  2YIN A;  3FFL A;  4KYO B;  1K2F A;  1N87 A;  3PVL A;  4W9R A;  1JUQ A;  4NAC A;  4ZUX U;  3P1U A;  5TDR A;  3AS5 A;  2VGX B;  5B75 A;  1WEW A;  4QF2 A;  3PUJ A;  3NF1 A;  1OWL A;  3TGO A;  3FTV A;  2E2E A;  4CCG X;  2EQX A;  2RSD A;  3FTS A;  3TXM A;  2D8S A;  2C2V S;  3CLJ A;  1E96 B;  1SZ9 A;  4UWK A;  5FT9 A;  2I50 A;  2CG2 A;  2L0I A;  3APC A;  4OYS A;  3PUR A;  2RG8 A;  2WXJ A;  2X38 A;  3FUF A;  4F1S A;  4CA1 A;  5E75 A;  3I5P A;  1SQM A;  5BW8 C;  4AP2 A;  4I2W A;  1VDY A;  4G11 A;  1JOC A;  3EHN A;  1INZ A;  2EOD A;  3FUN A;  2ECT A;  3O33 A;  3SBS A;  2ILR A;  3U5O A;  5G04 C;  4BX9 A;  1T1H A;  4BT8 A;  3ZEF A;  1WEU A;  4UI9 J;  2WXM A;  3O36 A;  4L1B A;  4EZJ A;  2LRI C;  5G05 C;  3ZYK A;  4BTB A;  5AYW D;  3L1Z B;  5FQ6 A;  5KH9 A;  4S3O C;  4GCN A;  2KCK A;  2LSU A;  3FH7 A;  5DBK A;  5FQ8 A;  3VLF A;  4RG6 A;  3M99 A;  2AWI A;  4AY5 A;  2KGG A;  4PTB A;  2IFU A;  3TJP A;  2I1J A;  3FUM A;  3ENE A;  2MIQ A;  3FL2 A;  2CHZ A;  3LVQ E;  2MRI A;  2QY7 A;  3UUX A;  2MA5 A;  2MT5 A;  3M63 A;  4AP4 A;  2XGS A;  1IQU A;  2GRM A;  5E76 A;  3V43 A;  2P58 C;  4DI4 A;  1UJK A;  5AIJ A;  4A3T A;  4I7B A;  2LN0 A;  3QC1 A;  4F53 A;  2WXR A;  2HDP A;  2LXH C;  5LFA A;  4UP0 A;  5FB0 A;  3GW4 A;  2PZI A;  4I7D A;  5TRB A;  3SOU A;  4J6I A;  4WNE A;  5AJL A;  4C9Z A;  3GZ1 A;  3O48 A;  1F62 A;  3IBE A;  5AIT A;  4HOQ A;  5FQ7 A;  4UI9 K;  3I4R B;  4AIF A;  3JUI A;  2YQM A;  3AS4 A;  4JEH A;  4G24 A;  4FJY A;  3FUK A;  4YAB A;  3LCA A;  3RJV A;  2BAY A;  2NC9 A;  1X4U A;  4A4C A;  1EDU A;  2FI7 A;  1QNF A;  4A1S A;  4FIP A;  4N3W A;  2WXI A;  1Y8M A;  2R5S A;  4JL0 A;  1E8Y A;  3VLE A;  3KQI A;  3KV5 A;  2JMD A;  4N3B A;  4BT9 A;  4BFR A;  1FP0 A;  4V3I A;  4B8A A;  1E4U A;  2RD0 A;  2WXH A;  4DK5 A;  1PAQ A;  3LY7 A;  3G2V A;  3RO3 A;  4ACL A;  3R7R A;  3ZPJ A;  4EBA G;  3RTR B;  4AEZ C;  3RRM B;  5FB1 A;  1IYM A;  3KD7 A;  3ASF A;  4LK9 A;  4WZ0 A;  4CDM A;  1HZ4 A;  3HCU A;  4H7Y A;  4GNG A;  4B94 A;  1HF8 A;  3NZU A;  4G2V A;  2XCB A;  1HFA A;  4KXK B;  5BT1 A;  4UQZ A;  3IHP A;  4FLB A;  1E8Z A;  3CKB A;  4IC2 A;  2PL2 A;  4AYC A;  2XRY A;  2DBA A;  4GYY A;  3LY9 A;  3PUQ A;  4N4F A;  3CHM A;  3L13 A;  3SGH A;  1E8W A;  4PS8 A;  4AOF A;  3G2S A;  4Q96 A;  4HOT A;  3Q15 A;  3RK6 A;  3SZ7 A;  3GV4 A;  4WWP A;  1XWH A;  5LKZ A;  2VJ8 A;  3HCT A;  2Y1M A;  3EIJ A;  3D9J A;  2YYR A;  2KWO A;  5JJ6 A;  3VLD A;  5EYA F;  3IEG A;  4TKP B;  3TG5 A;  4Q69 A;  2L9B A;  2XPZ A;  1HO8 A;  2X6F A;  2CFU A;  1HS6 A;  1LF8 A;  3CKC A;  4GZC A;  2G43 A;  2NAA A;  1H19 A;  4N39 A;  3ASH A;  3DPD A;  2G6Q A;  3LRQ A;  4GA1 A;  2LV9 A;  4LKA A;  4B7Y C;  1L5J A;  3K9I A;  4NN2 A;  4O64 A;  4FHJ A;  1U3D A;  5EX3 A;  1QZ2 A;  1UN8 A;  4CT0 A;  3B7R L;  2M85 A;  2YQ8 A;  3ONL A;  3L11 A;  2VGX A;  3PE3 A;  3LKU A;  4LRZ A;  2VSX E;  3IHY A;  2LDR A;  2WQ6 A;  3D9N A;  4UP5 A;  5JG6 A;  3APD A;  3L6A A;  4KVM A;  2IJG X;  2YHE A;  4DLQ A;  2WXK A;  5C1D A;  2ECI A;  3N9Q A;  2IOL A;  3Q5M A;  2MD7 B;  5D1L B;  3BG0 B;  4LEU A;  1VYX A;  2EA6 A;  3CK9 A;  4M3O A;  3O70 A;  3FTX A;  4ILH B;  1IYG A;  4PPE A;  2OVB A;  4XI0 A;  4AVX A;  2UZG A;  2ZET C;  4DPR A;  3FUE A;  3FP3 A;  3EJN A;  2PM7 A;  4J8F A;  2AVP A;  3ULQ A;  4X3G A;  3MHS A;  4P29 A;  1BOR A;  2PQR A;  2ION A;  1HE8 A;  1H6K A;  4LJN A;  3LQJ A;  5FEY A;  3SOW A;  4Q6F A;  1KT1 A;  3CHR A;  5BUZ A;  1EF1 C;  2I1K A;  2AXU A;  4GA2 A;  2A4Z A;  3U64 A;  3N9N A;  4UWL A;  3U5M A;  1Y6I A;  5H1V A;  2ECJ A;  2C0M A;  3T8M A;  4L58 A;  2OOE A;  3ZN3 A;  2YUC A;  3FUH A;  4V3K C;  4YBS A;  3RRU A;  4YBT A;  1HYJ A;  2LGL A;  4P5O B;  2FBN A;  2FUL A;  2KAT A;  3CK7 A;  4NQ0 A;  5ARF A;  4L7X A;  4WZ3 B;  3ZTG A;  3CR3 A;  3EB6 A;  3FEY A;  4HLE A;  4G23 A;  2I9C A;  4XX5 A;  2KIZ A;  5G55 A;  2A5U A;  3FWV A;  1OWP A;  3LS8 A;  3L16 A;  3MCX A;  3ZVZ B;  5EKQ D;  1Z3Y A;  1BPO A;  3N9L A;  5AIU A;  3FU6 A;  4PH4 B;  3HDX A;  4PUC A;  3MGB A;  3ML9 A;  4Y6W A;  4ATG A;  5M72 A;  3MZL B;  4LAD B;  1ZU2 A;  2I2O A;  4JA9 A;  1OUV A;  4KT6 B;  3ASL A;  1S0P A;  1H0A A;  4K03 A;  3T7L A;  3CIA A;  4W4U A;  2X6J A;  2QIZ A;  3RIB A;  5FQ4 A;  3VTY A;  1E8X A;  3CQG B;  4UQY A;  3C5K A;  1TJF A;  3C6W A;  3O7A A;  4WZ2 A;  1QQE A;  4YAD A;  3S7J A;  3AU4 A;  3FTY A;  1G25 A;  3PRE A;  4R2Y A;  4GML A;  3QJZ A;  5DIZ A;  2VTB B;  1WFK A;  1MQS A;  2VSO E;  2F6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...