4AVXA

Hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) bound to an ip2 compound at 1.68 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
GTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE SUBSTRATE
publication title Crystal Structure of the Tandem Vhs and Fyve Domains of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) Bound to an Ip2 Compound at 1.68 A Resolution
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 72
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4avxA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4avxA02
2H0DB 4FK5A 5D1KB 4WA6A 4UI9B 4YABA 2YYRA 3U5PA 4YATA 3L11A 1WEVA 1HX8A 2LDRA 5G05B 3D9MA 4YC9A 5B76A 3SOWA 3ZVYA 1WILA 1WEWA 2MA6A 5LP0A 4AYCB 4R8PK 4FIPA 2QIZA 2Y1NA 2LV9A 2KWOA 4ZUXU 2ECWA 5FB0A 3T6RA 5FERA 3D9NA 2DCPA 3G2SA 3N9QA 5LCWB 4HFGA 3O7AA 2H0DA 2I50A 4YBTA 3KQIA 5CMWA 4X3GA 3L1ZB 3SOXA 2LGGA 2KYUA 2G43A 4LADB 5C13A 1JM7A 4P5OB 2HYED 1HFAA 2ECJA 2KM4A 1EDUA 3D9KA 2EODA 1HG2A 2BF0X 1JUQA 4FU3A 2JMIA 4LLBA 1JPLA 2L80A 1LDKC 4MVTA 2KFTA 5B77A 2NAAA 1Z6UA 4V3LC 1WENA 5H1VA 2M6MA 4GZDA 2VJEA 5TBNA 2M3HA 5AITA 4O64A 1WEPA 4LJNA 1WEQA 4B86C 1SZ9A 1XGWA 2LRIC 3ZYMA 5J08A 4ZDTA 4F52B 4YBMA 4Q96A 2KE1A 2YUCA 3L1XA 4JXTA 5LKTA 2KGIA 2LXHC 2CT2A 1N87A 2PUYA 2JMDA 5G0FA 2UZGA 5H9MA 1FP0A 3LDZA 1UJKA 2KWJA 2KR4A 5AIUA 2JMJA 3LQHA 3U5NA 3DQVR 2FSAA 1IYMA 4CA1A 5I3LA 1V87A 4YADA 2Y43A 4GB0A 2CSYA 2K4DA 2IDAA 3DPLR 3LRQA 2OXQC 3G2VA 3QZVA 1JM7B 3EB5A 4FO9A 3N9MA 4GNDA 5FEYA 5B75A 2ECGA 3M63A 3KV5A 3LQIA 2MIQA 5EYAF 3ASLA 2QICA 4I7BA 4Q6FA 2KGGA 5DKAA 2LN0A 2DIWA 3MHHA 4AP4A 2LGLA 4N4FA 2XB1A 1WEOA 5TDRA 2C2VS 3VK6A 2FUIA 1WEUA 2YT5A 5D1LB 4LK9A 2VJEB 4QF3A 4S3OB 5B8DA 2M1RA 3ONLA 2L75A 5JG6A 3MHSA 2YQLA 1H0AA 2E6SA 4GNGA 2L5UA 2AN6A 2G45A 2ZETC 3N9OA 3V43A 4UP0A 3FL2A 2K17A 2MUMA 2YHOA 4A4CA 2CKLA 2LGVA 3HCUA 1VD4A 3C6WA 3D9JA 3LQJA 3I2DA 1WFKA 4YAXA 3HCTA 2YW8A 3N9LA 5B79A 3O36A 2KREA 4UP5A 5J3XA 4GNEA 1FBVA 4IC3A 3HTKC 1MM3A 2KIZA 2XEUA 3PURA 2VPGA 1SZAA 2MA5A 1JWGA 2QY7A 1HG5A 2MNZA 4L7XA 2V8SE 3RTRB 1VFYA 5CMYA 3M62A 5LKXA 5KH7A 4A4BA 2VPDA 3G2UA 1XWHA 1HYJA 2YSJA 2L0TB 4YBSA 1Z2QA 2KWNA 5FB1A 2G6QA 2CSZA 4S3OC 1UJJA 1JOCA 2K1JA 5TDWA 1T1HA 4TKPB 3D9IA 1INZA 3IHPA 1K2FA 2M85A 4AUQB 5LOZA 3GV4A 4W4UA 2VJFA 4QF2A 2VPEA 2Y1MA 3CLJA 3RPGB 1Z60A 3PUQA 2F42A 2KWKA 5TRBA 2CKLB 1CHCA 3D9LA 2MOWA 4R2YA 1WIMA 2F6JA 2FUUA 4GNFA 4I7DA 3C5KA 1HF8A 2L0IA 3NG2A 4WZ2A 4L58A 1ELKA 3O37A 1MM2A 2EA6A 3ZYLA 2YREA 4WZ0A 3ZTGA 1VYXA 2E6RA 4NACA 4GZCA 1ZBDB 4FLBA 2ECVA 1VDYA 2L0BA 1LDJB 1G25A 2YQMA 2EGPA 3G2TA 3T7LA 5TABA 2K16A 5H1UA 1F62A 1WEMA 3U5OA 1MHQA 2LO6A 3D9PA 4FJCA 5LKZA 4Q94A 4CCGX 1BORA 5G04B 4AVXA 2YHNA 5H1TA 1DVPA 3GL6A 3ZNIA 2RI7A 2VNFA 3SHBA 3EB6A 1X4JA 2D8SA 2DX8A 4MSXA 2ECIA 5C11A 2BAYA 2MT5A 3ZPVE 2C2LA 1U6GB 1JWFA 4ZQLA 2YURA 4N3WA 5D1MB 3G2WA 2KU3A 3KNVA 3KV6A 2ECNA 2VJFB 4WZ3B 4C9ZA 3PHDA 4V3KC 5DINA 3D9OA 3RRUA 4LKAA 1EYHA 5KH9A 4A0CD 2LGKA 3U5MA 4AYCA 4PPEA 3O33A 2MNYA 3RPGC 2L43A 1WGMA 4NN2A 4A49A 2LXPC 3ONKA 4B7YC 4I7CA 3O35A 2MD8C 4BBQA 3ZYQA 1WE9A 2MD7B 3ZPV1 2YSMA 4R7EA 3O70A 4BHWA 2YU4A 2QJ0A 2RSDA 3M99A 1RMDA 1PY1A 3ZYKA 3N9NA 2LQ6A 2JRJA 5KH3A 2F6NA 1E4UA 2VP7A 4XI1A 3O34A 4PTBA 3HCSA 2HDPA 5B78A 1X4IA 1WEEA 3SOUA 3ZVZB 1LF8A 1X4UA 2PNXA 2ECTA 2VPBA 4IC2A 1WESA 3N9PA 1HYIA 1X5BA 5LKUA
chains in the Genus database with same CATH superfamily
2VSNA 4FK5A 5D1KB 2WXJA 4YABA 2VYIA 5FQ7A 3ZKJA 3LS8A 3U5PA 2XPYA 4YATA 3I4GA 3HXEA 5EX0A 3FUMA 4APOA 3L11A 2WB2A 5G05B 2AVPA 4YC9A 3ASFA 5D0QD 3QB2A 3ZVYA 3UPVA 1WILA 4NIKA 2MA6A 5JMND 1AWCB 1DC2A 4R8PK 2GW1A 3FU6A 2JUNA 4H7XA 4A55A 3BEEA 1EF1C 2LV9A 2KWOA 2MYOA 3OXGA 1TN8A 1JCSA 2DSMA 5FB0A 3FUEA 5FERA 2MKEA 2XP0A 2DZOA 3Q73A 3G2SA 5LCWB 3O7AA 3FEYA 4GYOA 4X3GA 2YVRA 4LADB 2R03A 3PEVB 3SO8A 3MGBA 3UTMA 4DLOA 2XS8A 2E2EA 3DSXA 2KZTB 3LKUA 4HLLA 1N11A 1JUQA 4UI9J 4GYYA 4OGCA 4LLBA 2XEEA 1SA4A 2L80A 2R05A 1K3ZD 1LDKC 4MVTA 4J8DA 2NAAA 2IEJA 1SA5A 4C9BB 4CYMD 5EN5D 5B3SE 4UWHA 1K8KG 4TXQA 2M3HA 1OCOE 2R59A 3GW4A 4ATGA 1MX6A 4LJNA 4LNBA 2RKKA 1GW6A 3AU5A 4B86C 1SZ9A 4EHMA 2PL2A 4XIFA 3ZRHA 4I1OB 5KCMA 2KXPC 4F52B 3ASNE 4HVBA 2IOSA 4XKBA 2OOEA 3UT7A 4Q96A 4M3OA 4BERA 1A17A 1U3DA 4HXIA 3CVLA 3KSQA 3B7RL 5ENTD 2XPZA 5AIUA 2JMJA 3TJPA 1IYMA 2WXHA 4U8HA 3NBNB 2Y43A 1Q2ZA 4QQIA 3B7BA 2K4DA 5BPPA 4ACKA 1NA3A 2WXLA 4M7CA 3QZVA 1FCHA 3ULEG 1JM7B 3W9GA 3EHRA 4LRZA 5EYLA 5JHBA 2ECGA 2DVWA 3BQOA 4I6JA 4HOSA 4F7AA 4J8EA 3U64A 4Q6FA 2KGGA 4GTVA 3OXFA 4MBGA 4N4FA 3SZ7A 2WVIA 4YDYA 1JCQA 1N0QA 5AQ9A 4LK9A 4AJWA 3NOCD 4PDXA 2VJEB 1PAQA 4S3OB 3AG2E 4TUUA 1TJCA 4GMLA 2VTBA 4B8CB 1H0AA 2F8XK 3PZ3A 2KKXA 3QDNA 2E61A 4HBDA 3ZNGA 3CVVA 2AN6A 3DWLG 4GU5A 3IKOB 2WXPA 4UP0A 2I1KA 2YHOA 5FQ8A 2HM8A 2DYRE 3B95A 3DPYA 5ANLA 3ASHA 3Q7FA 2LGVA 3HCUA 5AJDA 3E30A 2EGMA 1UOHA 1L5JA 2I2OA 1WFKA 4YAXA 2XCCA 1EPUA 1TR4A 2WXMA 3N9LA 3OXLA 2J4DA 3LXUX 5B79A 4WAFA 1D8EA 2ZU6B 1FBVA 4IC3A 2A5EA 2DWZA 3LDYA 2MA5A 1OCZE 3TWTA 4K5BA 2MNZA 3PLWA 4HI8A 1VFYA 3M62A 4TUMA 4N2SA 5KH7A 2VGYA 4A3TA 3S7DA 5FTPA 1XWHA 3DEPA 1TN7A 3DBSA 2GRNB 2YSJA 3BG0B 4Z0OA 1TNYA 4YBSA 1FPPA 3R9AB 3QWWA 3PNTB 4UQYA 4U7EB 5A23A 5LOZA 5G04J 1E7VA 4W4UA 1BU9A 3RIBA 3FFLA 2FI7A 3FUHA 4GCOA 2VPEA 4ZFHA 2Y1MA 2MHKA 3CLJA 4ATZD 4I6EA 4FHKA 3O4ZA 1Z60A 3L16A 3RRMB 5TRBA 2CKLB 3DSWA 1CHCA 3D9LA 3FUIA 2BKGA 2MOWA 2KKYA 4JHKA 3ENEA 3CIAA 5CBNA 1TN6A 2P9NG 4A1GA 1IKND 4KBQA 4JEHA 5KWDA 3FEHA 1WAO1 1ZBDB 1MYOA 2CHXA 2P58C 5TABA 4MRUA 5H1UA 4GPKA 1MHQA 3V30A 3D9PA 4FJCA 2UY1B 4F6RD 2R17C 2X3MA 4CCGX 1BORA 3Q5MA 4AVXA 1HZ4A 4JZYA 5AIJA 1TJFA 1N54A 2A5UA 2EILE 4RG6A 4J8FA 3SHBA 4LERA 4IULA 1X4JA 4IRUA 2Q7FA 3AU4A 4L2YA 3BUAA 2ECIA 1E96B 5KJLA 3ZPVE 2YURA 4R7LA 4CT0A 2XOCA 2KU3A 5JHAA 4I2ZA 2ECNA 1OCCE 4BFRA 2VJFB 4WZ3B 3DDTA 2GROB 5DINA 2VQ2A 3AS4A 1EYHA 4A0CD 2LGKA 1E90A 4FJZA 2L43A 4I17A 3URZA 3O35A 3B7SA 3S7JA 5G05J 2AXUA 5CBOA 3C98A 5LFAA 4O62A 3ZPV1 2YSMA 3CK9A 5FZSA 3FTZA 3P1UA 3O70A 2WXQA 4LSZE 2YU4A 4KMOA 2QJ0A 3M99A 4GPMA 3ABLE 2WMOA 3CV0A 3ZYKA 2J49A 1K1BA 4HB5A 5KH3A 2F6NA 1RW2A 2VP7A 4GB9A 3HCSA 3Q1DA 5B78A 2V0PA 2L9BA 1X4IA 3UIOC 1V55E 4RLYA 2ZGGA 4U0UA 2IY0C 1X4UA 1ZBPA 2C0MA 2E0IA 5ENNA 3UM0A 2ECTA 3N9PA 2X6HA 5G04C 1HYIA 1YYHA 3HXFA 4URKA 2XEVA 3EIQC 4FA6A 4Y6CA 1E7UA 2CONA 2FO7A 2FULA 3O48A 1Y6IA 2XGSA 3TWWA 2LDRA 3FU0A 3MKQB 4BESA 3FAOA 3D9MA 2H6GA 5B76A 3K9IA 5AN8A 4WWNA 1BI8B 1WEWA 3CKBA 3E37A 5LP0A 4AYCB 2I6HA 2VGXB 4U0ZA 3Q7AA 4FIPA 5FINA 2GRQB 4ZUXU 3D3MA 4O1PA 2P9LG 3D9NA 4U04A 4C48B 4DPRA 3FTSA 4AEZC 5SVIB 2PM7A 1QZ2A 2IONA 2I50A 3RK6A 4DI3A 3KQIA 3L1ZB 3EHQA 3EIJA 2KYUA 2G43A 4GAAA 3LEWA 3T5XA 3DPDA 5HKPA 3UINC 4QFVA 4I2WA 2Y4TA 3TAXA 3SD5A 2XEHA 3D9KA 2EODA 2BF0X 5KJMA 4FU3A 3HIZA 2JMIA 1JPLA 4Q69A 3HRAA 1H2UA 4FULA 5HS0A 5B77A 5KBAA 5H1VA 3MJWA 4KXKB 4GZDA 4I1AA 1X81A 4C0MA 3ZVVA 4U63A 5ENQD 1N0RA 3UI2A 4O64A 5EDSA 3FJUB 4JA7A 4A3VA 2Y0BG 4BSZB 3LPZA 1XGWA 2VSOE 2LRIC 5J08A 3CK8A 4ZDTA 1JCRA 2OEWA 3ZU7B 2HE0A 4K5AB 5CEDB 4GA2A 4DX6D 4YBMA 2YUCA 1YA0A 2XRZA 1A5EA 3HXDA 1WG0A 2DJAA 4NQ0A 4DRXE 1Z3XA 4CDNA 2JMDA 1TNBA 4UWLA 2UZGA 3CHPA 3DXKG 2ZIRA 4ANVA 5D2MC 4TXPA 1TEZA 4HOTA 3TWUA 3CVYA 4JL0A 1B89A 3DQVR 3UMVA 2FSAA 4CA1A 1KT0A 1V87A 1SQMA 5I3LA 5LCWC 2IDAA 2FFWA 3LY8A 3RKVA 2JLBA 2XQ0A 3G2VA 4GTRA 3N9MA 3EU5A 5FEYA 3C3OA 5B75A 4LEUA 2MIQA 5EYAF 3ASLA 3PZ2A 4UI9K 4IN3B 3UT8A 2AJAA 2LN0A 2DIWA 4AP4A 4QQ4A 5DBKA 2C2VS 3VK6A 3ABME 3CVUA 2BEDA 4PS3A 2PNNA 2AW6A 3SFXA 4XE0A 3ZGQA 4G8LA 2L75A 1H6KA 3UM2A 3KEAA 3KDEC 1H6PA 3RAUA 4EPZA 1S63A 4DX1A 4GNGA 3QC1A 2RD0A 2G45A 3DSSA 1K1AA 3FH8A 2YQ8A 3IXEA 4FHJA 4A4CA 1G3NB 4HORA 5AARA 4AXHA 1IQUA 5FZQA 3R7RA 3C6WA 3D9JA 3LQJA 4YDWA 4EQFA 5IY5E 4JB8P 3HCTA 2YW8A 4L2LA 2P9PG 3FUNA 4BT8A 5G55A 1O5MA 5J3XA 3HTKC 3KAEA 2VPGA 1QYMA 1SZAA 1JWGA 3P2BA 2EINE 3NB2A 2VSYA 3CVNA 5JA4D 2Y4UA 5LKXA 4HI9A 3G2UA 1HE8A 3PZ4A 4J6IA 2EIME 2HR2A 3CVXA 3T8KA 1UN8A 3LJUX 2LXLA 1OWMA 1NP7A 4OAVB 4HOQA 4S3OC 2F8YA 1UJJA 2M63A 1T1HA 2VTBB 1INZA 2XHEA 3IHPA 2M85A 4AUQB 3PUJA 4GYWA 2CFZA 3VTXA 4QF2A 2L6JA 4N39A 4N2QA 4CZ2D 3RPGB 3TL5A 4C0EA 1QQEA 2J08A 2F42A 3LJ3A 3Q15A 4ZHBA 1KT1A 1MZCA 3LJNA 4RG9A 4R2YA 5SVXA 2FUUA 3L22A 3CKCA 2CHZA 2L0IA 3L6AA 3NG2A 2XGMA 4F1SA 1OCRE 1ELKA 3O37A 4PUCA 3ZTGA 3B7UX 1VYXA 2ETAA 4DX7D 2JM3A 3FU3A 4AIFA 3NOGD 4GZCA 4E6HA 3ESKA 4N5CA 4FLBA 2ECVA 3TWVA 3FUJA 3LCAA 1VDYA 1E8YA 5C1DA 3AAAC 3HVEA 3L54A 1G25A 2YQMA 3ZIMA 2J9QA 3ESLA 5JJ7A 2V4HC 3SBSA 3T7LA 5T4YA 2K16A 3KD7A 2M13A 1TNUA 3HXBA 2LO6A 5AAOA 4Q94A 2B0OE 2CG2A 4A63B 4LUNU 4GA1A 4KYOB 1UN9A 2CHWA 5SVYA 4Z68A 3VTYA 3APFA 1O1TA 4WNDA 3V2OA 2D8SA 4MSXA 2MT5A 3LYAA 4ZQLA 5D1MB 2F37A 4GZ6A 2IQCA 2EIKE 2WXGA 4CGVA 3FANA 3GYZA 4AP2A 3PHDA 4K0RA 1TNOA 3L82A 3SHFA 3QWVA 5H7PA 4NN2A 1WGMA 2MRIA 3U3WA 1RZ4A 5AJLA 4BBQA 3V2XA 3FH5A 5EYPF 1HH8A 3Q4AB 2QYJA 3CEQA 5M72A 3CQGB 3JCKC 4NURA 3UM1A 4FADA 2JRJA 1E4UA 1N4RA 4XI1A 4PTBA 4BTBA 3HG0D 2HDPA 1O1SA 4FJYA 3SOUA 3SNXA 3ZVZB 4Y6WA 2XZDG 5FT9A 2V4LA 3CVQA 2VPBA 2C0LA 3PRZA 1X5BA 4EZLA 3Q9NC 3IEGA 2IO3C 2ZGDA 4K5CA 1IHBA 4BWRA 1OXJA 4UI9B 2YYRA 3ABKE 5D0OD 2WXNA 3RSEG 1WEVA 2J8SD 3FH7A 4JHRA 3QARA 4CCAA 3DSVA 5BV0A 4BT9A 3FY4A 2QIZA 4IYPA 1OWOA 3NQPA 4LNUD 2ECWA 4I9CA 5AQ7A 2L6BA 3T6RA 3MV3B 1ZU2A 2ONDA 1FVHA 2DCPA 3N9QA 4BSXA 4HFGA 1BPOA 4MLPA 3C5RA 5JJ6A 2FD4A 2B6CA 2XPIA 1E8WA 1OUVA 3SQVA 1HU3A 1YCSB 3LY7A 3DSTA 3PREA 3FTVA 5CMWA 3DWDA 5CRUA 5A6CA 3BG1B 5C13A 4YVOA 2XS1A 2HYED 4KVOA 5A7DB 2JEKA 2KM4A 4AM9A 1Y8MA 3PE4A 2IFUA 1DCQA 2IOLA 2KFTA 2DYSE 4V3LC 4GTTA 3QAQA 2M6MA 5TBNA 4U96D 2EIJE 2YHCA 5AITA 5AENA 2P9KG 4OGEA 1WEPA 1YMPA 2R2LA 3CHOA 3Q9UC 3ZYMA 4BEPA 3FP3A 1FVFA 1N95A 3SY2A 4UQZA 5G2NA 3L1XA 3NAWA 1TYQG 4FP7A 4JXTA 5LKTA 2J09A 3F6QA 5LCWJ 2DZNA 4N5QA 2KGIA 1U2VG 2LXHC 3CK7A 2XZTG 2PUYA 5G0FA 2BUGA 3LDZA 2HYZA 3LQHA 3U5NA 3FTUA 1H6OA 1SVXA 3J5PA 3FTXA 4YADA 2WPVA 1S64A 4L7TA 4GB0A 2I1JA 4DLQA 2OXQC 1BD8A 4GNDA 2KCVA 3M63A 3UKRG 1H2TC 3VLFA 3LQIA 1Z5SC 2XGOA 2IF4A 4DX2A 5DKAA 3H7HA 2LAUA 4EBAA 4DI4A 5ENPD 3I4RB 4WNEA 2XB1A 5TDRA 4UWGA 2WXKA 4I9EA 4O1OA 1WEUA 2H6HA 4W9RA 1Z6TA 2IQJA 2ETBA 3MX3A 2X6FA 2IJGX 1MX4A 2M1RA 3ONLA 4ANUA 5JG6A 3MHSA 2CRRA 4JVSA 3EUVA 3IHYA 3VLEA 2YINA 4OVUA 2WXRA 3FTWA 5LX8A 5ENOD 3FHEA 4DX5D 2LSVA 3LY9A 3ULYA 2ZETC 3V43A 2WQ6A 3PNLB 1Z3YA 2K17A 4X8QA 4UWFA 3X2QE 4OVVA 4G2VA 5AQBA 1VD4A 4U8YD 2X6JA 1MX2A 1D9SA 1P5QA 4G24A 4GTMA 3ZHEA 4GTPA 4EBAG 3L9TA 2KREA 1HS6A 2V5QC 3SFYA 4GNEA 5JJTA 3E2DA 3ZW3A 1MM3A 2IU1A 4N3CA 5BUZA 2XEUA 3PURA 3PVLA 4G26A 4PS8A 2LNIA 3V31A 2CG3A 2UWJG 3FDHA 2VGEA 1LTXA 2V8SE 3PS6A 2WQ7A 2WM9A 4GZ3A 5FIOA 3PZDA 3TWXA 2BTDA 1LD8A 3CGHA 2VPDA 5BV1A 4MKTA 4CGWA 4GTOA 3IV0A 1H2VC 1UG3A 4J8SA 1IQRA 2HO1A 3AG1E 4GMRA 5KNHD 4U8VD 1Z2QA 5FB1A 1S70B 4BTAA 1E8ZA 2RFAA 3D9IA 2JABA 3FEXA 4GZ5A 4L9PA 1K2FA 3ASDA 3TXMA 4GTQA 4F3VA 2BKKB 4P29A 3SFZA 3ZUVB 2WXOA 3JXIA 4JC8A 5EIBE 3PUQA 2YNQA 4G23A 3TWQA 5BW8C 3SI5A 3C3RA 4G11A 3UIPC 3CVWA 1WIMA 4O6FA 2ZXWE 3C5KA 1HF8A 2X38A 4WZ2A 3QKYA 4I1MA 1MM2A 4HRMB 3ZYLA 2PM6A 4PS7A 4WZ0A 1QNFA 1MBMA 2WQHA 2P9UG 4LCTA 1U3CA 2QFCA 5CHEE 3CSFA 2L0BA 1N94A 3APDA 1IHGA 4I43A 2EGPA 4B94A 2OEVA 2CRWA 1KZOA 3L17A 4HLEA 1WEMA 3U5OA 3E4BA 2YHNA 5H1TA 1MQSA 4B8AA 3Q75A 1DVPA 3GL6A 3ZNIA 3UM3A 4XKCA 2RI7A 2VNFA 3ASOE 5ARGA 1N52A 5CECB 3UT4A 1MJ0A 4ANXA 2DX8A 4ILIA 2BAYA 2NSZA 4UUCA 2C2LA 1KPSB 1U6GB 3EHMA 4N3WA 3G2WA 3KNVA 2KCKA 4KVMA 3BU8A 2RR4A 4NRHB 4V3KC 3D9OA 4GA0A 2FEZA 4WUYA 3RRUA 4LKAA 5KH9A 3U5MA 5KNGA 2X6KA 4UWKA 4PPEA 2MNYA 3RPGC 4HS2A 5ARFA 5C2YA 3S7BA 3ONKA 1IYGA 2LXPC 4A49A 4B7YC 4ME2A 4I7CA 3OAWA 2MD8C 2XOYA 3ZYQA 3E34A 3ZFWA 4YDEA 3M7KA 1W3BA 2XCBA 2Y69E 2LAIA 4YNDA 4TRQA 4G8KA 3MEKA 3UX4A 1NZNA 2AWIA 2RSDA 4EZKA 1RMDA 1HO8A 1N4SA 1PY1A 2GRPB 3W9FA 3TG5A 1E8XA 2LQ6A 4JD2G 3N9NA 4ANWA 3AG3E 4XZ4A 3O34A 4N3BA 3HVEB 3QNKA 3MKRA 4WWOA 2CSVA 4GMJA 4HQDA 2KZTA 1KLXA 3LVRE 2PNXA 3NZUA 3S7FA 4B0ZA 3JUEA 1IXVA 1TNZA 5LKUA 2H0DB 3NF1A 3ZPJA 3WXXA 4WNGA 1DNPA 3KEZA 4WA6A 3RO2A 3QWPA 2GRLA 3FU5A 1HX8A 1KZPA 4HOUA 2F0YA 2DBAA 1HXIA 4B89A 3VLDA 2WXFA 4AOFA 3SOWA 1XNFA 3S2AA 3DSUA 2A4ZA 3UKUG 2YHEA 3SUBA 2OWAA 3MV2B 2EQXA 1BLXB 2Y1NA 2H6FA 2LUHA 5BXOA 4GTSA 3SGHA 3TWRA 1DCEA 3FUDA 4J7WA 5CEAA 5DIZA 4CT4A 1UW4B 2EXUA 2ZISA 3MA5A 4XI9A 3MDBC 4B93B 2H0DA 2GRMA 2R5SA 4YBTA 2QZAA 3L08A 3SOXA 2LGGA 3HHMA 1JM7A 5FZRA 4KZ0A 4P5OB 5ITZF 3TGOA 3U66A 3U9WA 2Y3AA 1HFAA 3ASGA 5BNWA 2ECJA 3PEUB 1EDUA 3DRAA 3R9MA 1HG2A 2OV8A 3JQ0A 2Y1LE 5KJKA 3CHSA 2FBNA 3PDNA 1V54E 5EKQD 5T8IA 1N4PA 1Z6UA 1WENA 4L1BA 2LXMA 5T3RA 3TG4A 4DUIA 2VJEA 2XOZA 4UI9C 1OT8A 2I9CA 4JW1A 1LD7A 1WEQA 4AV7A 3CHQA 3CQCB 4CDRA 4HNAD 3OTNA 4AY6A 4YDOA 4KZCA 1O1RA 2R02A 4CDMA 2KE1A 2VJ8A 4OYSA 5CCMA 4JA9A 3UUXA 3FM8C 1SW6A 2CT2A 1N87A 3AJIA 3R7QA 5H9MA 5D66A 1FP0A 1PC2A 2KWJA 1UJKA 3ISMC 3RO3A 3EHNA 2KR4A 4EECA 3AS5A 3QJZA 4BX8A 3IHVA 2OCCE 4K03A 3GZ2A 1H19A 2XENA 2CSYA 4DK5A 3DPLR 3LRQA 3B7TA 3EB5A 1ELRA 3EJNA 4FO9A 4XEIG 5FQ6A 4BETA 4G25A 5BT1A 3KV5A 3ZXSA 4RVBA 3JQ1A 2QICA 4I7BA 1ZB1A 1OWNA 3MHHA 2LGLA 1OWPA 1WEOA 4H7YA 4L23A 3AG4E 2FUIA 3DEOA 2YT5A 5D1LB 2NYJA 4U95D 1FT1A 1BI7B 3D9HA 3RJVA 4QF3A 5B8DA 1D8DA 3T5VA 5EIDA 3ML8A 3PH0C 2YQLA 4HRNA 2ETCA 4LG6A 2E6SA 2XRYA 2AXZA 2PZIA 3HDXA 5B1AE 3JXJA 3ML9A 2L5UA 3N9OA 3V79K 4CRWA 1NFIE 2AXVA 2KATA 3CHMA 2D8UA 3FL2A 3CHRA 4JEUA 1N9AA 2MUMA 4YVQC 2CKLA 4EZJA 3J5QB 4CEMA 3L13A 5FQ4A 1NL4A 3I2DA 5E75A 5CERB 1OY3D 2NXPA 3Q78A 3HXCA 3O47A 3TWSA 4XI0A 1NI1A 3JUIA 4E85A 3O36A 3T9KA 3N71A 4UP5A 4N3AA 4ACLA 4FC8A 3IBEA 2KIZA 5AYWD 1WM5A 4JHJA 5B1BE 2IO2C 3I5PA 3KS2A 3TXNA 3ZXPA 2QY7A 3I3NA 1HG5A 4V3IA 4L7XA 3MZLB 1AP7A 3RTRB 5CMYA 4RSYA 5ANRA 5HQ8A 4PH4B 3Q49B 3FUKA 4DJAA 4A4BA 2J07A 2UY1A 3HYMB 3FUFA 2X6IA 1HYJA 3GZ1A 3EU9A 2RFMA 3CSTA 3ULQA 2L7PA 2L0TB 5KJNA 4WWPA 4FLHA 2KWNA 2GGFA 2G6QA 2CSZA 3ZEFA 4F53A 5AQAA 1FT2A 1JOCA 2K1JA 5TDWA 4TKPB 4GCNA 1N4QA 4BY6A 5EILA 3UXGA 1WDYA 2H6IA 5K3QA 4F1PA 3GV4A 2VJFA 2P9SG 4ILHB 5FJYA 4ABNA 3SF4A 2KWKA 2KBXA 5E76A 3QK0A 3NZSA 4APFA 4A1SA 3CVPA 2LAHA 2GRRB 1ELWA 5J90A 2PQRA 3GZSA 2F6JA 3RU0A 4GNFA 4I7DA 3QOUA 3PUKA 4JPSA 3ZHEB 4LNGA 3EDTB 4L58A 4MS6A 4WNFA 2KC7A 3T8MA 2EA6A 2YREA 3ZN3A 2WXIA 5ENRD 2J4BA 2E6RA 4NACA 5FWQA 3FULA 4ILGA 3PE3A 2ILRA 4HRLA 4U0SA 1LDJB 1NA0A 3G2TA 4AY5A 3CR3A 4H9DA 1F62A 3LVQE 3DXMG 4Z0RA 3Q47B 4J8YA 5LKZA 5HI7A 5G04B 4TV3A 5HRYA 4OAUC 4G1TA 3EB6A 2P9IG 3E32A 5ENSD 5C11A 3FWVA 2P2CP 3APCA 5CRVA 1JWFA 4TXRA 4KT6B 3FTYA 3C3QA 3KV6A 3MKQA 2OVBA 4C9ZA 3JYSA 3RRNB 1WY6A 3C72A 5BXUA 1OWLA 5CCLA 4AYCA 1S0PA 3E33A 2VGXA 4I6GA 3O33A 3MYVA 4UQXA 3PZ1A 2QYUA 1QBQA 2OVFA 1WE9A 2P57A 4D10C 4J0UA 3Q79A 2MD7B 4R7EA 2VSXE 4BHWA 2NC9A 3U4TA 3B13A 4RQIA 2CFUA 2FF4A 5SVIA 4U07A 2KCLA 3MCXA 5G05C 2PQNA 2V5FA 4BX9A 4XX5A 2FO1E 4O60A 3AS8A 1WEEA 5EX3A 2RG8A 1LF8A 2WMNA 3WG7E 3SBTB 2LSUA 4IC2A 3KSLA 3UQ3A 1WESA 2QC9A
chains in the Genus database with same CATH topology
2VSNA 4FK5A 5D1KB 2WXJA 4YABA 2VYIA 5FQ7A 3LS8A 3U5PA 2XPYA 4YATA 3I4GA 5EX0A 3FUMA 4APOA 3L11A 2WB2A 5G05B 2AVPA 4YC9A 3ASFA 5D0QD 3QB2A 3ZVYA 3UPVA 1WILA 2MA6A 4R8PK 2GW1A 3FU6A 4H7XA 4A55A 3BEEA 1EF1C 2LV9A 2KWOA 3OXGA 5FB0A 3FUEA 5FERA 3G2SA 5LCWB 3O7AA 3FEYA 4GYOA 4X3GA 4LADB 3PEVB 3MGBA 4DLOA 2E2EA 2KZTB 3LKUA 1JUQA 4UI9J 4GYYA 4LLBA 2L80A 1LDKC 4MVTA 4J8DA 2NAAA 4C9BB 4UWHA 2M3HA 2R59A 3GW4A 4ATGA 4LJNA 1GW6A 3AU5A 4B86C 1SZ9A 2PL2A 4XIFA 3ZRHA 4I1OB 5KCMA 4F52B 4HVBA 2IOSA 4XKBA 2OOEA 3UT7A 4Q96A 4M3OA 1A17A 1U3DA 4HXIA 3CVLA 3B7RL 2XPZA 5AIUA 2JMJA 3TJPA 1IYMA 2WXHA 4U8HA 2Y43A 2K4DA 5BPPA 4ACKA 1NA3A 2WXLA 3QZVA 1FCHA 1JM7B 4LRZA 5JHBA 2ECGA 4HOSA 4I6JA 4F7AA 4J8EA 3U64A 4Q6FA 2KGGA 3OXFA 4N4FA 3SZ7A 2WVIA 4LK9A 4AJWA 4PDXA 2VJEB 1PAQA 4S3OB 4TUUA 1TJCA 4GMLA 2VTBA 4B8CB 1H0AA 3QDNA 3CVVA 2AN6A 4GU5A 3IKOB 2WXPA 4UP0A 2I1KA 2YHOA 5FQ8A 2HM8A 5ANLA 3ASHA 2LGVA 3HCUA 5AJDA 1L5JA 2I2OA 1WFKA 4YAXA 2XCCA 1EPUA 2WXMA 3N9LA 3OXLA 2J4DA 3LXUX 5B79A 4WAFA 2ZU6B 1FBVA 4IC3A 2MA5A 2MNZA 1VFYA 3M62A 4N2SA 5KH7A 2VGYA 4A3TA 3S7DA 5FTPA 1XWHA 3DBSA 2YSJA 3BG0B 4YBSA 3R9AB 3QWWA 3PNTB 4UQYA 5A23A 5LOZA 5G04J 1E7VA 4W4UA 3RIBA 3FFLA 2VPEA 2FI7A 3FUHA 4GCOA 2Y1MA 2MHKA 3CLJA 4I6EA 4FHKA 3O4ZA 1Z60A 3L16A 3RRMB 5TRBA 2CKLB 1CHCA 3D9LA 3FUIA 2MOWA 4JHKA 3ENEA 3CIAA 4A1GA 4KBQA 4JEHA 1WAO1 1ZBDB 2CHXA 2P58C 5TABA 4MRUA 5H1UA 4GPKA 1MHQA 3D9PA 4FJCA 2UY1B 2R17C 2X3MA 4CCGX 1BORA 3Q5MA 5AIJA 4AVXA 1HZ4A 4JZYA 1TJFA 1N54A 2A5UA 4RG6A 4J8FA 3SHBA 4LERA 4IULA 1X4JA 4IRUA 2Q7FA 3AU4A 4L2YA 2ECIA 1E96B 5KJLA 3ZPVE 2YURA 4R7LA 4CT0A 2KU3A 5JHAA 4I2ZA 2ECNA 4BFRA 2VJFB 4WZ3B 5DINA 2VQ2A 3AS4A 1EYHA 4A0CD 2LGKA 1E90A 4FJZA 2L43A 4I17A 3URZA 3O35A 3B7SA 3S7JA 5G05J 2AXUA 3C98A 5LFAA 3ZPV1 2YSMA 3CK9A 5FZSA 3FTZA 3P1UA 3O70A 2WXQA 2YU4A 4KMOA 2QJ0A 3M99A 2WMOA 3CV0A 3ZYKA 2J49A 5KH3A 2F6NA 2VP7A 4GB9A 3HCSA 5B78A 2V0PA 2L9BA 1X4IA 4U0UA 1X4UA 1ZBPA 2C0MA 2E0IA 5ENNA 2ECTA 3N9PA 2X6HA 5G04C 1HYIA 4URKA 2XEVA 3EIQC 4FA6A 4Y6CA 1E7UA 2FO7A 2FULA 3O48A 1Y6IA 2XGSA 2LDRA 3FU0A 3MKQB 3D9MA 5B76A 3K9IA 4WWNA 1WEWA 3CKBA 5LP0A 4AYCB 2I6HA 2VGXB 4U0ZA 4FIPA 4ZUXU 3D3MA 3D9NA 4U04A 4DPRA 3FTSA 4AEZC 2PM7A 1QZ2A 2IONA 2I50A 3RK6A 4DI3A 3KQIA 3L1ZB 3EIJA 2KYUA 2G43A 4GAAA 3LEWA 3T5XA 3DPDA 4QFVA 4I2WA 2Y4TA 3TAXA 3SD5A 3D9KA 2EODA 2BF0X 5KJMA 4FU3A 3HIZA 2JMIA 1JPLA 4Q69A 1H2UA 4FULA 5B77A 5H1VA 3MJWA 4KXKB 4GZDA 4I1AA 4C0MA 3ZVVA 4U63A 4O64A 5EDSA 4JA7A 4A3VA 3LPZA 1XGWA 2VSOE 2LRIC 5J08A 3CK8A 4ZDTA 4GA2A 4YBMA 2YUCA 1YA0A 2XRZA 4NQ0A 1Z3XA 4CDNA 2JMDA 4UWLA 2UZGA 3CHPA 4ANVA 1TEZA 4HOTA 3CVYA 3DQVR 4JL0A 1B89A 3UMVA 2FSAA 4CA1A 1KT0A 1V87A 1SQMA 5I3LA 5LCWC 2IDAA 3LY8A 3RKVA 2JLBA 2XQ0A 3G2VA 3N9MA 5FEYA 5B75A 4LEUA 2MIQA 5EYAF 3ASLA 4UI9K 4IN3B 3UT8A 2LN0A 2DIWA 4AP4A 5DBKA 2C2VS 3VK6A 3CVUA 4PS3A 2AW6A 4XE0A 3ZGQA 2L75A 1H6KA 4EPZA 4GNGA 3QC1A 2RD0A 2G45A 3FH8A 2YQ8A 4FHJA 4A4CA 4HORA 4AXHA 1IQUA 5FZQA 3R7RA 3C6WA 3D9JA 3LQJA 4EQFA 3HCTA 2YW8A 4L2LA 3FUNA 4BT8A 5G55A 5J3XA 3HTKC 3KAEA 2VPGA 1SZAA 1JWGA 3P2BA 2VSYA 3CVNA 2Y4UA 5LKXA 3G2UA 1HE8A 4J6IA 2HR2A 3CVXA 1UN8A 1OWMA 1NP7A 4HOQA 4S3OC 1UJJA 2M63A 1T1HA 2VTBB 1INZA 2XHEA 3IHPA 2M85A 4AUQB 3PUJA 4GYWA 2CFZA 3VTXA 4QF2A 2L6JA 4N39A 4N2QA 3RPGB 3TL5A 4C0EA 1QQEA 2J08A 2F42A 3LJ3A 3Q15A 1KT1A 4RG9A 4R2YA 2FUUA 3L22A 3CKCA 2CHZA 2L0IA 3L6AA 3NG2A 2XGMA 4F1SA 1ELKA 3O37A 4PUCA 3ZTGA 3B7UX 1VYXA 3FU3A 4AIFA 4GZCA 4E6HA 3ESKA 4N5CA 4FLBA 2ECVA 3FUJA 3LCAA 1VDYA 1E8YA 5C1DA 3HVEA 3L54A 1G25A 2YQMA 3ZIMA 2J9QA 3ESLA 5JJ7A 3SBSA 3T7LA 5T4YA 2K16A 3KD7A 2LO6A 4Q94A 2CG2A 4LUNU 4GA1A 4KYOB 1UN9A 2CHWA 3VTYA 3APFA 4WNDA 2D8SA 4MSXA 2MT5A 3LYAA 4ZQLA 5D1MB 4GZ6A 2IQCA 2WXGA 4CGVA 3GYZA 4AP2A 3PHDA 4K0RA 3SHFA 3QWVA 4NN2A 1WGMA 2MRIA 3U3WA 5AJLA 4BBQA 3FH5A 1HH8A 3Q4AB 3CEQA 5M72A 3CQGB 3JCKC 4NURA 4FADA 2JRJA 1E4UA 4XI1A 4PTBA 4BTBA 2HDPA 4FJYA 3SOUA 3SNXA 3ZVZB 4Y6WA 5FT9A 2V4LA 3CVQA 2VPBA 2C0LA 3PRZA 1X5BA 4EZLA 3IEGA 4BWRA 4UI9B 2YYRA 5D0OD 2WXNA 1WEVA 3FH7A 4JHRA 3QARA 4CCAA 5BV0A 4BT9A 3FY4A 2QIZA 4IYPA 1OWOA 3NQPA 2ECWA 4I9CA 3T6RA 3MV3B 1ZU2A 2ONDA 1FVHA 2DCPA 3N9QA 4BSXA 4HFGA 1BPOA 4MLPA 5JJ6A 2XPIA 1OUVA 1E8WA 1HU3A 3LY7A 3PREA 3FTVA 5CMWA 5A6CA 3BG1B 5C13A 4YVOA 2HYED 4KVOA 5A7DB 2JEKA 2KM4A 4AM9A 1Y8MA 3PE4A 2IFUA 2IOLA 2KFTA 4V3LC 3QAQA 2M6MA 5TBNA 2YHCA 5AITA 5AENA 1WEPA 3CHOA 3ZYMA 3FP3A 1FVFA 4UQZA 5G2NA 3L1XA 4FP7A 4JXTA 5LKTA 2J09A 5LCWJ 2KGIA 2LXHC 3CK7A 2PUYA 5G0FA 2BUGA 3LDZA 2HYZA 3LQHA 3U5NA 3FTUA 3FTXA 4YADA 2WPVA 4L7TA 4GB0A 2I1JA 4DLQA 2OXQC 4GNDA 2KCVA 3M63A 1H2TC 3VLFA 3LQIA 2XGOA 2IF4A 5DKAA 4EBAA 4DI4A 3I4RB 4WNEA 2XB1A 5TDRA 4UWGA 2WXKA 4I9EA 1WEUA 4W9RA 1Z6TA 3MX3A 2X6FA 2IJGX 2M1RA 3ONLA 4ANUA 5JG6A 3MHSA 4JVSA 3IHYA 3VLEA 2YINA 4OVUA 2WXRA 3FTWA 5LX8A 3FHEA 2LSVA 3LY9A 2ZETC 3V43A 2WQ6A 3PNLB 1Z3YA 2K17A 4UWFA 4OVVA 4G2VA 1VD4A 2X6JA 1P5QA 4G24A 3ZHEA 4EBAG 2KREA 1HS6A 4GNEA 5JJTA 3ZW3A 1MM3A 2IU1A 4N3CA 5BUZA 2XEUA 3PURA 3PVLA 4G26A 4PS8A 2LNIA 2CG3A 2UWJG 3FDHA 2V8SE 3PS6A 2WQ7A 2WM9A 4GZ3A 3PZDA 2BTDA 3CGHA 2VPDA 5BV1A 4MKTA 4CGWA 3IV0A 1H2VC 1UG3A 4J8SA 1IQRA 2HO1A 1Z2QA 5FB1A 4BTAA 1E8ZA 3D9IA 3FEXA 4GZ5A 1K2FA 3ASDA 3TXMA 4F3VA 4P29A 3SFZA 2WXOA 4JC8A 3PUQA 2YNQA 4G23A 5BW8C 3SI5A 4G11A 1WIMA 3CVWA 4O6FA 3C5KA 1HF8A 2X38A 4WZ2A 3QKYA 4I1MA 1MM2A 3ZYLA 2PM6A 4PS7A 4WZ0A 1QNFA 2WQHA 4LCTA 1U3CA 2QFCA 5CHEE 3CSFA 2L0BA 3APDA 4I43A 1IHGA 2EGPA 4B94A 3L17A 4HLEA 1WEMA 3U5OA 3E4BA 2YHNA 5H1TA 1MQSA 4B8AA 1DVPA 3GL6A 3ZNIA 4XKCA 2RI7A 2VNFA 5ARGA 1N52A 3UT4A 4ANXA 2DX8A 4ILIA 2BAYA 2NSZA 2C2LA 1U6GB 3EHMA 4N3WA 3G2WA 3KNVA 2KCKA 4KVMA 4NRHB 4V3KC 3D9OA 4GA0A 2FEZA 4WUYA 3RRUA 4LKAA 5KH9A 3U5MA 2X6KA 4UWKA 4PPEA 2MNYA 3RPGC 4HS2A 5ARFA 5C2YA 3S7BA 3ONKA 1IYGA 2LXPC 4A49A 4B7YC 4ME2A 4I7CA 3OAWA 2MD8C 3ZYQA 3ZFWA 1W3BA 2XCBA 2LAIA 4YNDA 4TRQA 3MEKA 3UX4A 1NZNA 2AWIA 2RSDA 4EZKA 1RMDA 1HO8A 1PY1A 3TG5A 1E8XA 2LQ6A 3N9NA 4ANWA 4XZ4A 3O34A 4N3BA 3HVEB 3QNKA 3MKRA 4WWOA 4GMJA 2KZTA 1KLXA 3LVRE 2PNXA 3NZUA 3S7FA 4B0ZA 5LKUA 2H0DB 3NF1A 3ZPJA 3WXXA 4WNGA 1DNPA 3KEZA 4WA6A 3RO2A 3QWPA 2GRLA 3FU5A 1HX8A 4HOUA 2DBAA 1HXIA 4B89A 3VLDA 2WXFA 4AOFA 3SOWA 1XNFA 3S2AA 2A4ZA 2YHEA 3MV2B 2EQXA 2Y1NA 3SGHA 3FUDA 5DIZA 4CT4A 1UW4B 3MA5A 4XI9A 2H0DA 2GRMA 2R5SA 4YBTA 3L08A 3SOXA 2LGGA 3HHMA 1JM7A 5FZRA 4KZ0A 4P5OB 3TGOA 3U66A 3U9WA 2Y3AA 1HFAA 3ASGA 5BNWA 2ECJA 3PEUB 1EDUA 1HG2A 2OV8A 3JQ0A 5KJKA 3CHSA 2FBNA 3PDNA 5EKQD 5T8IA 1Z6UA 1WENA 4L1BA 5T3RA 3TG4A 2VJEA 4UI9C 2I9CA 4JW1A 1WEQA 4AV7A 3CHQA 3CQCB 4CDRA 4AY6A 3OTNA 4KZCA 4CDMA 2KE1A 2VJ8A 4OYSA 5CCMA 4JA9A 3UUXA 2CT2A 1N87A 3R7QA 5H9MA 1FP0A 1PC2A 2KWJA 1UJKA 3RO3A 3EHNA 2KR4A 4EECA 3AS5A 3QJZA 4BX8A 3IHVA 4K03A 3GZ2A 1H19A 2CSYA 4DK5A 3DPLR 3LRQA 3B7TA 3EB5A 1ELRA 3EJNA 4FO9A 5FQ6A 4G25A 5BT1A 3KV5A 3ZXSA 4RVBA 3JQ1A 2QICA 4I7BA 1OWNA 3MHHA 2LGLA 1OWPA 1WEOA 4H7YA 4L23A 2FUIA 2YT5A 5D1LB 3RJVA 4QF3A 5B8DA 3T5VA 3ML8A 3PH0C 2YQLA 2E6SA 2XRYA 2AXZA 2PZIA 3HDXA 3ML9A 2L5UA 3N9OA 4CRWA 2AXVA 2KATA 3CHMA 3FL2A 3CHRA 4JEUA 2MUMA 4YVQC 2CKLA 4EZJA 4CEMA 3L13A 5FQ4A 3I2DA 5E75A 2NXPA 4XI0A 3JUIA 4E85A 3O36A 3N71A 4UP5A 4N3AA 4ACLA 4FC8A 3IBEA 2KIZA 5AYWD 1WM5A 4JHJA 3I5PA 3KS2A 3TXNA 2QY7A 3I3NA 1HG5A 4V3IA 4L7XA 3MZLB 3RTRB 5CMYA 4RSYA 5ANRA 5HQ8A 4PH4B 3Q49B 3FUKA 4DJAA 4A4BA 2J07A 2UY1A 3HYMB 3FUFA 2X6IA 1HYJA 3GZ1A 3CSTA 3ULQA 2L0TB 5KJNA 4WWPA 4FLHA 2KWNA 2GGFA 2G6QA 2CSZA 3ZEFA 4F53A 1JOCA 2K1JA 5TDWA 4TKPB 4GCNA 4BY6A 3GV4A 2VJFA 4ILHB 5FJYA 4ABNA 3SF4A 2KWKA 5E76A 3QK0A 3NZSA 4APFA 4A1SA 3CVPA 2LAHA 1ELWA 5J90A 2PQRA 3GZSA 2F6JA 3RU0A 4GNFA 4I7DA 3QOUA 3PUKA 4JPSA 3ZHEB 3EDTB 4L58A 4MS6A 4WNFA 2KC7A 3T8MA 2EA6A 2YREA 3ZN3A 2WXIA 2J4BA 2E6RA 4NACA 5FWQA 3FULA 4ILGA 3PE3A 2ILRA 4U0SA 1LDJB 1NA0A 3G2TA 4AY5A 3CR3A 1F62A 3LVQE 3Q47B 5LKZA 5HI7A 5G04B 4TV3A 4G1TA 3EB6A 5C11A 3FWVA 3APCA 1JWFA 4KT6B 3FTYA 3KV6A 3MKQA 2OVBA 4C9ZA 3JYSA 3RRNB 1WY6A 1OWLA 5CCLA 4AYCA 1S0PA 2VGXA 4I6GA 3O33A 3MYVA 4UQXA 2OVFA 1WE9A 4D10C 4J0UA 2MD7B 4R7EA 2VSXE 4BHWA 2NC9A 3U4TA 3B13A 2CFUA 2FF4A 4U07A 2KCLA 3MCXA 5G05C 2PQNA 2V5FA 4BX9A 4XX5A 3AS8A 1WEEA 5EX3A 2RG8A 1LF8A 2WMNA 3SBTB 2LSUA 4IC2A 3UQ3A 1WESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0D B;  4FK5 A;  5D1K B;  4WA6 A;  4UI9 B;  4YAB A;  2YYR A;  3U5P A;  4YAT A;  3L11 A;  1WEV A;  1HX8 A;  2LDR A;  5G05 B;  3D9M A;  4YC9 A;  5B76 A;  3SOW A;  3ZVY A;  1WIL A;  1WEW A;  2MA6 A;  5LP0 A;  4AYC B;  4R8P K;  4FIP A;  2QIZ A;  2Y1N A;  2LV9 A;  2KWO A;  4ZUX U;  2ECW A;  5FB0 A;  3T6R A;  5FER A;  3D9N A;  2DCP A;  3G2S A;  3N9Q A;  5LCW B;  4HFG A;  3O7A A;  2H0D A;  2I50 A;  4YBT A;  3KQI A;  5CMW A;  4X3G A;  3L1Z B;  3SOX A;  2LGG A;  2KYU A;  2G43 A;  4LAD B;  5C13 A;  1JM7 A;  4P5O B;  2HYE D;  1HFA A;  2ECJ A;  2KM4 A;  1EDU A;  3D9K A;  2EOD A;  1HG2 A;  2BF0 X;  1JUQ A;  4FU3 A;  2JMI A;  4LLB A;  1JPL A;  2L80 A;  1LDK C;  4MVT A;  2KFT A;  5B77 A;  2NAA A;  1Z6U A;  4V3L C;  1WEN A;  5H1V A;  2M6M A;  4GZD A;  2VJE A;  5TBN A;  2M3H A;  5AIT A;  4O64 A;  1WEP A;  4LJN A;  1WEQ A;  4B86 C;  1SZ9 A;  1XGW A;  2LRI C;  3ZYM A;  5J08 A;  4ZDT A;  4F52 B;  4YBM A;  4Q96 A;  2KE1 A;  2YUC A;  3L1X A;  4JXT A;  5LKT A;  2KGI A;  2LXH C;  2CT2 A;  1N87 A;  2PUY A;  2JMD A;  5G0F A;  2UZG A;  5H9M A;  1FP0 A;  3LDZ A;  1UJK A;  2KWJ A;  2KR4 A;  5AIU A;  2JMJ A;  3LQH A;  3U5N A;  3DQV R;  2FSA A;  1IYM A;  4CA1 A;  5I3L A;  1V87 A;  4YAD A;  2Y43 A;  4GB0 A;  2CSY A;  2K4D A;  2IDA A;  3DPL R;  3LRQ A;  2OXQ C;  3G2V A;  3QZV A;  1JM7 B;  3EB5 A;  4FO9 A;  3N9M A;  4GND A;  5FEY A;  5B75 A;  2ECG A;  3M63 A;  3KV5 A;  3LQI A;  2MIQ A;  5EYA F;  3ASL A;  2QIC A;  4I7B A;  4Q6F A;  2KGG A;  5DKA A;  2LN0 A;  2DIW A;  3MHH A;  4AP4 A;  2LGL A;  4N4F A;  2XB1 A;  1WEO A;  5TDR A;  2C2V S;  3VK6 A;  2FUI A;  1WEU A;  2YT5 A;  5D1L B;  4LK9 A;  2VJE B;  4QF3 A;  4S3O B;  5B8D A;  2M1R A;  3ONL A;  2L75 A;  5JG6 A;  3MHS A;  2YQL A;  1H0A A;  2E6S A;  4GNG A;  2L5U A;  2AN6 A;  2G45 A;  2ZET C;  3N9O A;  3V43 A;  4UP0 A;  3FL2 A;  2K17 A;  2MUM A;  2YHO A;  4A4C A;  2CKL A;  2LGV A;  3HCU A;  1VD4 A;  3C6W A;  3D9J A;  3LQJ A;  3I2D A;  1WFK A;  4YAX A;  3HCT A;  2YW8 A;  3N9L A;  5B79 A;  3O36 A;  2KRE A;  4UP5 A;  5J3X A;  4GNE A;  1FBV A;  4IC3 A;  3HTK C;  1MM3 A;  2KIZ A;  2XEU A;  3PUR A;  2VPG A;  1SZA A;  2MA5 A;  1JWG A;  2QY7 A;  1HG5 A;  2MNZ A;  4L7X A;  2V8S E;  3RTR B;  1VFY A;  5CMY A;  3M62 A;  5LKX A;  5KH7 A;  4A4B A;  2VPD A;  3G2U A;  1XWH A;  1HYJ A;  2YSJ A;  2L0T B;  4YBS A;  1Z2Q A;  2KWN A;  5FB1 A;  2G6Q A;  2CSZ A;  4S3O C;  1UJJ A;  1JOC A;  2K1J A;  5TDW A;  1T1H A;  4TKP B;  3D9I A;  1INZ A;  3IHP A;  1K2F A;  2M85 A;  4AUQ B;  5LOZ A;  3GV4 A;  4W4U A;  2VJF A;  4QF2 A;  2VPE A;  2Y1M A;  3CLJ A;  3RPG B;  1Z60 A;  3PUQ A;  2F42 A;  2KWK A;  5TRB A;  2CKL B;  1CHC A;  3D9L A;  2MOW A;  4R2Y A;  1WIM A;  2F6J A;  2FUU A;  4GNF A;  4I7D A;  3C5K A;  1HF8 A;  2L0I A;  3NG2 A;  4WZ2 A;  4L58 A;  1ELK A;  3O37 A;  1MM2 A;  2EA6 A;  3ZYL A;  2YRE A;  4WZ0 A;  3ZTG A;  1VYX A;  2E6R A;  4NAC A;  4GZC A;  1ZBD B;  4FLB A;  2ECV A;  1VDY A;  2L0B A;  1LDJ B;  1G25 A;  2YQM A;  2EGP A;  3G2T A;  3T7L A;  5TAB A;  2K16 A;  5H1U A;  1F62 A;  1WEM A;  3U5O A;  1MHQ A;  2LO6 A;  3D9P A;  4FJC A;  5LKZ A;  4Q94 A;  4CCG X;  1BOR A;  5G04 B;  4AVX A;  2YHN A;  5H1T A;  1DVP A;  3GL6 A;  3ZNI A;  2RI7 A;  2VNF A;  3SHB A;  3EB6 A;  1X4J A;  2D8S A;  2DX8 A;  4MSX A;  2ECI A;  5C11 A;  2BAY A;  2MT5 A;  3ZPV E;  2C2L A;  1U6G B;  1JWF A;  4ZQL A;  2YUR A;  4N3W A;  5D1M B;  3G2W A;  2KU3 A;  3KNV A;  3KV6 A;  2ECN A;  2VJF B;  4WZ3 B;  4C9Z A;  3PHD A;  4V3K C;  5DIN A;  3D9O A;  3RRU A;  4LKA A;  1EYH A;  5KH9 A;  4A0C D;  2LGK A;  3U5M A;  4AYC A;  4PPE A;  3O33 A;  2MNY A;  3RPG C;  2L43 A;  1WGM A;  4NN2 A;  4A49 A;  2LXP C;  3ONK A;  4B7Y C;  4I7C A;  3O35 A;  2MD8 C;  4BBQ A;  3ZYQ A;  1WE9 A;  2MD7 B;  3ZPV 1;  2YSM A;  4R7E A;  3O70 A;  4BHW A;  2YU4 A;  2QJ0 A;  2RSD A;  3M99 A;  1RMD A;  1PY1 A;  3ZYK A;  3N9N A;  2LQ6 A;  2JRJ A;  5KH3 A;  2F6N A;  1E4U A;  2VP7 A;  4XI1 A;  3O34 A;  4PTB A;  3HCS A;  2HDP A;  5B78 A;  1X4I A;  1WEE A;  3SOU A;  3ZVZ B;  1LF8 A;  1X4U A;  2PNX A;  2ECT A;  2VPB A;  4IC2 A;  1WES A;  3N9P A;  1HYI A;  1X5B A;  5LKU A; 
#chains in the Genus database with same CATH topology
 2VSN A;  4FK5 A;  5D1K B;  2WXJ A;  4YAB A;  2VYI A;  5FQ7 A;  3ZKJ A;  3LS8 A;  3U5P A;  2XPY A;  4YAT A;  3I4G A;  3HXE A;  5EX0 A;  3FUM A;  4APO A;  3L11 A;  2WB2 A;  5G05 B;  2AVP A;  4YC9 A;  3ASF A;  5D0Q D;  3QB2 A;  3ZVY A;  3UPV A;  1WIL A;  4NIK A;  2MA6 A;  5JMN D;  1AWC B;  1DC2 A;  4R8P K;  2GW1 A;  3FU6 A;  2JUN A;  4H7X A;  4A55 A;  3BEE A;  1EF1 C;  2LV9 A;  2KWO A;  2MYO A;  3OXG A;  1TN8 A;  1JCS A;  2DSM A;  5FB0 A;  3FUE A;  5FER A;  2MKE A;  2XP0 A;  2DZO A;  3Q73 A;  3G2S A;  5LCW B;  3O7A A;  3FEY A;  4GYO A;  4X3G A;  2YVR A;  4LAD B;  2R03 A;  3PEV B;  3SO8 A;  3MGB A;  3UTM A;  4DLO A;  2XS8 A;  2E2E A;  3DSX A;  2KZT B;  3LKU A;  4HLL A;  1N11 A;  1JUQ A;  4UI9 J;  4GYY A;  4OGC A;  4LLB A;  2XEE A;  1SA4 A;  2L80 A;  2R05 A;  1K3Z D;  1LDK C;  4MVT A;  4J8D A;  2NAA A;  2IEJ A;  1SA5 A;  4C9B B;  4CYM D;  5EN5 D;  5B3S E;  4UWH A;  1K8K G;  4TXQ A;  2M3H A;  1OCO E;  2R59 A;  3GW4 A;  4ATG A;  1MX6 A;  4LJN A;  4LNB A;  2RKK A;  1GW6 A;  3AU5 A;  4B86 C;  1SZ9 A;  4EHM A;  2PL2 A;  4XIF A;  3ZRH A;  4I1O B;  5KCM A;  2KXP C;  4F52 B;  3ASN E;  4HVB A;  2IOS A;  4XKB A;  2OOE A;  3UT7 A;  4Q96 A;  4M3O A;  4BER A;  1A17 A;  1U3D A;  4HXI A;  3CVL A;  3KSQ A;  3B7R L;  5ENT D;  2XPZ A;  5AIU A;  2JMJ A;  3TJP A;  1IYM A;  2WXH A;  4U8H A;  3NBN B;  2Y43 A;  1Q2Z A;  4QQI A;  3B7B A;  2K4D A;  5BPP A;  4ACK A;  1NA3 A;  2WXL A;  4M7C A;  3QZV A;  1FCH A;  3ULE G;  1JM7 B;  3W9G A;  3EHR A;  4LRZ A;  5EYL A;  5JHB A;  2ECG A;  2DVW A;  3BQO A;  4I6J A;  4HOS A;  4F7A A;  4J8E A;  3U64 A;  4Q6F A;  2KGG A;  4GTV A;  3OXF A;  4MBG A;  4N4F A;  3SZ7 A;  2WVI A;  4YDY A;  1JCQ A;  1N0Q A;  5AQ9 A;  4LK9 A;  4AJW A;  3NOC D;  4PDX A;  2VJE B;  1PAQ A;  4S3O B;  3AG2 E;  4TUU A;  1TJC A;  4GML A;  2VTB A;  4B8C B;  1H0A A;  2F8X K;  3PZ3 A;  2KKX A;  3QDN A;  2E61 A;  4HBD A;  3ZNG A;  3CVV A;  2AN6 A;  3DWL G;  4GU5 A;  3IKO B;  2WXP A;  4UP0 A;  2I1K A;  2YHO A;  5FQ8 A;  2HM8 A;  2DYR E;  3B95 A;  3DPY A;  5ANL A;  3ASH A;  3Q7F A;  2LGV A;  3HCU A;  5AJD A;  3E30 A;  2EGM A;  1UOH A;  1L5J A;  2I2O A;  1WFK A;  4YAX A;  2XCC A;  1EPU A;  1TR4 A;  2WXM A;  3N9L A;  3OXL A;  2J4D A;  3LXU X;  5B79 A;  4WAF A;  1D8E A;  2ZU6 B;  1FBV A;  4IC3 A;  2A5E A;  2DWZ A;  3LDY A;  2MA5 A;  1OCZ E;  3TWT A;  4K5B A;  2MNZ A;  3PLW A;  4HI8 A;  1VFY A;  3M62 A;  4TUM A;  4N2S A;  5KH7 A;  2VGY A;  4A3T A;  3S7D A;  5FTP A;  1XWH A;  3DEP A;  1TN7 A;  3DBS A;  2GRN B;  2YSJ A;  3BG0 B;  4Z0O A;  1TNY A;  4YBS A;  1FPP A;  3R9A B;  3QWW A;  3PNT B;  4UQY A;  4U7E B;  5A23 A;  5LOZ A;  5G04 J;  1E7V A;  4W4U A;  1BU9 A;  3RIB A;  3FFL A;  2FI7 A;  3FUH A;  4GCO A;  2VPE A;  4ZFH A;  2Y1M A;  2MHK A;  3CLJ A;  4ATZ D;  4I6E A;  4FHK A;  3O4Z A;  1Z60 A;  3L16 A;  3RRM B;  5TRB A;  2CKL B;  3DSW A;  1CHC A;  3D9L A;  3FUI A;  2BKG A;  2MOW A;  2KKY A;  4JHK A;  3ENE A;  3CIA A;  5CBN A;  1TN6 A;  2P9N G;  4A1G A;  1IKN D;  4KBQ A;  4JEH A;  5KWD A;  3FEH A;  1WAO 1;  1ZBD B;  1MYO A;  2CHX A;  2P58 C;  5TAB A;  4MRU A;  5H1U A;  4GPK A;  1MHQ A;  3V30 A;  3D9P A;  4FJC A;  2UY1 B;  4F6R D;  2R17 C;  2X3M A;  4CCG X;  1BOR A;  3Q5M A;  4AVX A;  1HZ4 A;  4JZY A;  5AIJ A;  1TJF A;  1N54 A;  2A5U A;  2EIL E;  4RG6 A;  4J8F A;  3SHB A;  4LER A;  4IUL A;  1X4J A;  4IRU A;  2Q7F A;  3AU4 A;  4L2Y A;  3BUA A;  2ECI A;  1E96 B;  5KJL A;  3ZPV E;  2YUR A;  4R7L A;  4CT0 A;  2XOC A;  2KU3 A;  5JHA A;  4I2Z A;  2ECN A;  1OCC E;  4BFR A;  2VJF B;  4WZ3 B;  3DDT A;  2GRO B;  5DIN A;  2VQ2 A;  3AS4 A;  1EYH A;  4A0C D;  2LGK A;  1E90 A;  4FJZ A;  2L43 A;  4I17 A;  3URZ A;  3O35 A;  3B7S A;  3S7J A;  5G05 J;  2AXU A;  5CBO A;  3C98 A;  5LFA A;  4O62 A;  3ZPV 1;  2YSM A;  3CK9 A;  5FZS A;  3FTZ A;  3P1U A;  3O70 A;  2WXQ A;  4LSZ E;  2YU4 A;  4KMO A;  2QJ0 A;  3M99 A;  4GPM A;  3ABL E;  2WMO A;  3CV0 A;  3ZYK A;  2J49 A;  1K1B A;  4HB5 A;  5KH3 A;  2F6N A;  1RW2 A;  2VP7 A;  4GB9 A;  3HCS A;  3Q1D A;  5B78 A;  2V0P A;  2L9B A;  1X4I A;  3UIO C;  1V55 E;  4RLY A;  2ZGG A;  4U0U A;  2IY0 C;  1X4U A;  1ZBP A;  2C0M A;  2E0I A;  5ENN A;  3UM0 A;  2ECT A;  3N9P A;  2X6H A;  5G04 C;  1HYI A;  1YYH A;  3HXF A;  4URK A;  2XEV A;  3EIQ C;  4FA6 A;  4Y6C A;  1E7U A;  2CON A;  2FO7 A;  2FUL A;  3O48 A;  1Y6I A;  2XGS A;  3TWW A;  2LDR A;  3FU0 A;  3MKQ B;  4BES A;  3FAO A;  3D9M A;  2H6G A;  5B76 A;  3K9I A;  5AN8 A;  4WWN A;  1BI8 B;  1WEW A;  3CKB A;  3E37 A;  5LP0 A;  4AYC B;  2I6H A;  2VGX B;  4U0Z A;  3Q7A A;  4FIP A;  5FIN A;  2GRQ B;  4ZUX U;  3D3M A;  4O1P A;  2P9L G;  3D9N A;  4U04 A;  4C48 B;  4DPR A;  3FTS A;  4AEZ C;  5SVI B;  2PM7 A;  1QZ2 A;  2ION A;  2I50 A;  3RK6 A;  4DI3 A;  3KQI A;  3L1Z B;  3EHQ A;  3EIJ A;  2KYU A;  2G43 A;  4GAA A;  3LEW A;  3T5X A;  3DPD A;  5HKP A;  3UIN C;  4QFV A;  4I2W A;  2Y4T A;  3TAX A;  3SD5 A;  2XEH A;  3D9K A;  2EOD A;  2BF0 X;  5KJM A;  4FU3 A;  3HIZ A;  2JMI A;  1JPL A;  4Q69 A;  3HRA A;  1H2U A;  4FUL A;  5HS0 A;  5B77 A;  5KBA A;  5H1V A;  3MJW A;  4KXK B;  4GZD A;  4I1A A;  1X81 A;  4C0M A;  3ZVV A;  4U63 A;  5ENQ D;  1N0R A;  3UI2 A;  4O64 A;  5EDS A;  3FJU B;  4JA7 A;  4A3V A;  2Y0B G;  4BSZ B;  3LPZ A;  1XGW A;  2VSO E;  2LRI C;  5J08 A;  3CK8 A;  4ZDT A;  1JCR A;  2OEW A;  3ZU7 B;  2HE0 A;  4K5A B;  5CED B;  4GA2 A;  4DX6 D;  4YBM A;  2YUC A;  1YA0 A;  2XRZ A;  1A5E A;  3HXD A;  1WG0 A;  2DJA A;  4NQ0 A;  4DRX E;  1Z3X A;  4CDN A;  2JMD A;  1TNB A;  4UWL A;  2UZG A;  3CHP A;  3DXK G;  2ZIR A;  4ANV A;  5D2M C;  4TXP A;  1TEZ A;  4HOT A;  3TWU A;  3CVY A;  4JL0 A;  1B89 A;  3DQV R;  3UMV A;  2FSA A;  4CA1 A;  1KT0 A;  1V87 A;  1SQM A;  5I3L A;  5LCW C;  2IDA A;  2FFW A;  3LY8 A;  3RKV A;  2JLB A;  2XQ0 A;  3G2V A;  4GTR A;  3N9M A;  3EU5 A;  5FEY A;  3C3O A;  5B75 A;  4LEU A;  2MIQ A;  5EYA F;  3ASL A;  3PZ2 A;  4UI9 K;  4IN3 B;  3UT8 A;  2AJA A;  2LN0 A;  2DIW A;  4AP4 A;  4QQ4 A;  5DBK A;  2C2V S;  3VK6 A;  3ABM E;  3CVU A;  2BED A;  4PS3 A;  2PNN A;  2AW6 A;  3SFX A;  4XE0 A;  3ZGQ A;  4G8L A;  2L75 A;  1H6K A;  3UM2 A;  3KEA A;  3KDE C;  1H6P A;  3RAU A;  4EPZ A;  1S63 A;  4DX1 A;  4GNG A;  3QC1 A;  2RD0 A;  2G45 A;  3DSS A;  1K1A A;  3FH8 A;  2YQ8 A;  3IXE A;  4FHJ A;  4A4C A;  1G3N B;  4HOR A;  5AAR A;  4AXH A;  1IQU A;  5FZQ A;  3R7R A;  3C6W A;  3D9J A;  3LQJ A;  4YDW A;  4EQF A;  5IY5 E;  4JB8 P;  3HCT A;  2YW8 A;  4L2L A;  2P9P G;  3FUN A;  4BT8 A;  5G55 A;  1O5M A;  5J3X A;  3HTK C;  3KAE A;  2VPG A;  1QYM A;  1SZA A;  1JWG A;  3P2B A;  2EIN E;  3NB2 A;  2VSY A;  3CVN A;  5JA4 D;  2Y4U A;  5LKX A;  4HI9 A;  3G2U A;  1HE8 A;  3PZ4 A;  4J6I A;  2EIM E;  2HR2 A;  3CVX A;  3T8K A;  1UN8 A;  3LJU X;  2LXL A;  1OWM A;  1NP7 A;  4OAV B;  4HOQ A;  4S3O C;  2F8Y A;  1UJJ A;  2M63 A;  1T1H A;  2VTB B;  1INZ A;  2XHE A;  3IHP A;  2M85 A;  4AUQ B;  3PUJ A;  4GYW A;  2CFZ A;  3VTX A;  4QF2 A;  2L6J A;  4N39 A;  4N2Q A;  4CZ2 D;  3RPG B;  3TL5 A;  4C0E A;  1QQE A;  2J08 A;  2F42 A;  3LJ3 A;  3Q15 A;  4ZHB A;  1KT1 A;  1MZC A;  3LJN A;  4RG9 A;  4R2Y A;  5SVX A;  2FUU A;  3L22 A;  3CKC A;  2CHZ A;  2L0I A;  3L6A A;  3NG2 A;  2XGM A;  4F1S A;  1OCR E;  1ELK A;  3O37 A;  4PUC A;  3ZTG A;  3B7U X;  1VYX A;  2ETA A;  4DX7 D;  2JM3 A;  3FU3 A;  4AIF A;  3NOG D;  4GZC A;  4E6H A;  3ESK A;  4N5C A;  4FLB A;  2ECV A;  3TWV A;  3FUJ A;  3LCA A;  1VDY A;  1E8Y A;  5C1D A;  3AAA C;  3HVE A;  3L54 A;  1G25 A;  2YQM A;  3ZIM A;  2J9Q A;  3ESL A;  5JJ7 A;  2V4H C;  3SBS A;  3T7L A;  5T4Y A;  2K16 A;  3KD7 A;  2M13 A;  1TNU A;  3HXB A;  2LO6 A;  5AAO A;  4Q94 A;  2B0O E;  2CG2 A;  4A63 B;  4LUN U;  4GA1 A;  4KYO B;  1UN9 A;  2CHW A;  5SVY A;  4Z68 A;  3VTY A;  3APF A;  1O1T A;  4WND A;  3V2O A;  2D8S A;  4MSX A;  2MT5 A;  3LYA A;  4ZQL A;  5D1M B;  2F37 A;  4GZ6 A;  2IQC A;  2EIK E;  2WXG A;  4CGV A;  3FAN A;  3GYZ A;  4AP2 A;  3PHD A;  4K0R A;  1TNO A;  3L82 A;  3SHF A;  3QWV A;  5H7P A;  4NN2 A;  1WGM A;  2MRI A;  3U3W A;  1RZ4 A;  5AJL A;  4BBQ A;  3V2X A;  3FH5 A;  5EYP F;  1HH8 A;  3Q4A B;  2QYJ A;  3CEQ A;  5M72 A;  3CQG B;  3JCK C;  4NUR A;  3UM1 A;  4FAD A;  2JRJ A;  1E4U A;  1N4R A;  4XI1 A;  4PTB A;  4BTB A;  3HG0 D;  2HDP A;  1O1S A;  4FJY A;  3SOU A;  3SNX A;  3ZVZ B;  4Y6W A;  2XZD G;  5FT9 A;  2V4L A;  3CVQ A;  2VPB A;  2C0L A;  3PRZ A;  1X5B A;  4EZL A;  3Q9N C;  3IEG A;  2IO3 C;  2ZGD A;  4K5C A;  1IHB A;  4BWR A;  1OXJ A;  4UI9 B;  2YYR A;  3ABK E;  5D0O D;  2WXN A;  3RSE G;  1WEV A;  2J8S D;  3FH7 A;  4JHR A;  3QAR A;  4CCA A;  3DSV A;  5BV0 A;  4BT9 A;  3FY4 A;  2QIZ A;  4IYP A;  1OWO A;  3NQP A;  4LNU D;  2ECW A;  4I9C A;  5AQ7 A;  2L6B A;  3T6R A;  3MV3 B;  1ZU2 A;  2OND A;  1FVH A;  2DCP A;  3N9Q A;  4BSX A;  4HFG A;  1BPO A;  4MLP A;  3C5R A;  5JJ6 A;  2FD4 A;  2B6C A;  2XPI A;  1E8W A;  1OUV A;  3SQV A;  1HU3 A;  1YCS B;  3LY7 A;  3DST A;  3PRE A;  3FTV A;  5CMW A;  3DWD A;  5CRU A;  5A6C A;  3BG1 B;  5C13 A;  4YVO A;  2XS1 A;  2HYE D;  4KVO A;  5A7D B;  2JEK A;  2KM4 A;  4AM9 A;  1Y8M A;  3PE4 A;  2IFU A;  1DCQ A;  2IOL A;  2KFT A;  2DYS E;  4V3L C;  4GTT A;  3QAQ A;  2M6M A;  5TBN A;  4U96 D;  2EIJ E;  2YHC A;  5AIT A;  5AEN A;  2P9K G;  4OGE A;  1WEP A;  1YMP A;  2R2L A;  3CHO A;  3Q9U C;  3ZYM A;  4BEP A;  3FP3 A;  1FVF A;  1N95 A;  3SY2 A;  4UQZ A;  5G2N A;  3L1X A;  3NAW A;  1TYQ G;  4FP7 A;  4JXT A;  5LKT A;  2J09 A;  3F6Q A;  5LCW J;  2DZN A;  4N5Q A;  2KGI A;  1U2V G;  2LXH C;  3CK7 A;  2XZT G;  2PUY A;  5G0F A;  2BUG A;  3LDZ A;  2HYZ A;  3LQH A;  3U5N A;  3FTU A;  1H6O A;  1SVX A;  3J5P A;  3FTX A;  4YAD A;  2WPV A;  1S64 A;  4L7T A;  4GB0 A;  2I1J A;  4DLQ A;  2OXQ C;  1BD8 A;  4GND A;  2KCV A;  3M63 A;  3UKR G;  1H2T C;  3VLF A;  3LQI A;  1Z5S C;  2XGO A;  2IF4 A;  4DX2 A;  5DKA A;  3H7H A;  2LAU A;  4EBA A;  4DI4 A;  5ENP D;  3I4R B;  4WNE A;  2XB1 A;  5TDR A;  4UWG A;  2WXK A;  4I9E A;  4O1O A;  1WEU A;  2H6H A;  4W9R A;  1Z6T A;  2IQJ A;  2ETB A;  3MX3 A;  2X6F A;  2IJG X;  1MX4 A;  2M1R A;  3ONL A;  4ANU A;  5JG6 A;  3MHS A;  2CRR A;  4JVS A;  3EUV A;  3IHY A;  3VLE A;  2YIN A;  4OVU A;  2WXR A;  3FTW A;  5LX8 A;  5ENO D;  3FHE A;  4DX5 D;  2LSV A;  3LY9 A;  3ULY A;  2ZET C;  3V43 A;  2WQ6 A;  3PNL B;  1Z3Y A;  2K17 A;  4X8Q A;  4UWF A;  3X2Q E;  4OVV A;  4G2V A;  5AQB A;  1VD4 A;  4U8Y D;  2X6J A;  1MX2 A;  1D9S A;  1P5Q A;  4G24 A;  4GTM A;  3ZHE A;  4GTP A;  4EBA G;  3L9T A;  2KRE A;  1HS6 A;  2V5Q C;  3SFY A;  4GNE A;  5JJT A;  3E2D A;  3ZW3 A;  1MM3 A;  2IU1 A;  4N3C A;  5BUZ A;  2XEU A;  3PUR A;  3PVL A;  4G26 A;  4PS8 A;  2LNI A;  3V31 A;  2CG3 A;  2UWJ G;  3FDH A;  2VGE A;  1LTX A;  2V8S E;  3PS6 A;  2WQ7 A;  2WM9 A;  4GZ3 A;  5FIO A;  3PZD A;  3TWX A;  2BTD A;  1LD8 A;  3CGH A;  2VPD A;  5BV1 A;  4MKT A;  4CGW A;  4GTO A;  3IV0 A;  1H2V C;  1UG3 A;  4J8S A;  1IQR A;  2HO1 A;  3AG1 E;  4GMR A;  5KNH D;  4U8V D;  1Z2Q A;  5FB1 A;  1S70 B;  4BTA A;  1E8Z A;  2RFA A;  3D9I A;  2JAB A;  3FEX A;  4GZ5 A;  4L9P A;  1K2F A;  3ASD A;  3TXM A;  4GTQ A;  4F3V A;  2BKK B;  4P29 A;  3SFZ A;  3ZUV B;  2WXO A;  3JXI A;  4JC8 A;  5EIB E;  3PUQ A;  2YNQ A;  4G23 A;  3TWQ A;  5BW8 C;  3SI5 A;  3C3R A;  4G11 A;  3UIP C;  3CVW A;  1WIM A;  4O6F A;  2ZXW E;  3C5K A;  1HF8 A;  2X38 A;  4WZ2 A;  3QKY A;  4I1M A;  1MM2 A;  4HRM B;  3ZYL A;  2PM6 A;  4PS7 A;  4WZ0 A;  1QNF A;  1MBM A;  2WQH A;  2P9U G;  4LCT A;  1U3C A;  2QFC A;  5CHE E;  3CSF A;  2L0B A;  1N94 A;  3APD A;  1IHG A;  4I43 A;  2EGP A;  4B94 A;  2OEV A;  2CRW A;  1KZO A;  3L17 A;  4HLE A;  1WEM A;  3U5O A;  3E4B A;  2YHN A;  5H1T A;  1MQS A;  4B8A A;  3Q75 A;  1DVP A;  3GL6 A;  3ZNI A;  3UM3 A;  4XKC A;  2RI7 A;  2VNF A;  3ASO E;  5ARG A;  1N52 A;  5CEC B;  3UT4 A;  1MJ0 A;  4ANX A;  2DX8 A;  4ILI A;  2BAY A;  2NSZ A;  4UUC A;  2C2L A;  1KPS B;  1U6G B;  3EHM A;  4N3W A;  3G2W A;  3KNV A;  2KCK A;  4KVM A;  3BU8 A;  2RR4 A;  4NRH B;  4V3K C;  3D9O A;  4GA0 A;  2FEZ A;  4WUY A;  3RRU A;  4LKA A;  5KH9 A;  3U5M A;  5KNG A;  2X6K A;  4UWK A;  4PPE A;  2MNY A;  3RPG C;  4HS2 A;  5ARF A;  5C2Y A;  3S7B A;  3ONK A;  1IYG A;  2LXP C;  4A49 A;  4B7Y C;  4ME2 A;  4I7C A;  3OAW A;  2MD8 C;  2XOY A;  3ZYQ A;  3E34 A;  3ZFW A;  4YDE A;  3M7K A;  1W3B A;  2XCB A;  2Y69 E;  2LAI A;  4YND A;  4TRQ A;  4G8K A;  3MEK A;  3UX4 A;  1NZN A;  2AWI A;  2RSD A;  4EZK A;  1RMD A;  1HO8 A;  1N4S A;  1PY1 A;  2GRP B;  3W9F A;  3TG5 A;  1E8X A;  2LQ6 A;  4JD2 G;  3N9N A;  4ANW A;  3AG3 E;  4XZ4 A;  3O34 A;  4N3B A;  3HVE B;  3QNK A;  3MKR A;  4WWO A;  2CSV A;  4GMJ A;  4HQD A;  2KZT A;  1KLX A;  3LVR E;  2PNX A;  3NZU A;  3S7F A;  4B0Z A;  3JUE A;  1IXV A;  1TNZ A;  5LKU A;  2H0D B;  3NF1 A;  3ZPJ A;  3WXX A;  4WNG A;  1DNP A;  3KEZ A;  4WA6 A;  3RO2 A;  3QWP A;  2GRL A;  3FU5 A;  1HX8 A;  1KZP A;  4HOU A;  2F0Y A;  2DBA A;  1HXI A;  4B89 A;  3VLD A;  2WXF A;  4AOF A;  3SOW A;  1XNF A;  3S2A A;  3DSU A;  2A4Z A;  3UKU G;  2YHE A;  3SUB A;  2OWA A;  3MV2 B;  2EQX A;  1BLX B;  2Y1N A;  2H6F A;  2LUH A;  5BXO A;  4GTS A;  3SGH A;  3TWR A;  1DCE A;  3FUD A;  4J7W A;  5CEA A;  5DIZ A;  4CT4 A;  1UW4 B;  2EXU A;  2ZIS A;  3MA5 A;  4XI9 A;  3MDB C;  4B93 B;  2H0D A;  2GRM A;  2R5S A;  4YBT A;  2QZA A;  3L08 A;  3SOX A;  2LGG A;  3HHM A;  1JM7 A;  5FZR A;  4KZ0 A;  4P5O B;  5ITZ F;  3TGO A;  3U66 A;  3U9W A;  2Y3A A;  1HFA A;  3ASG A;  5BNW A;  2ECJ A;  3PEU B;  1EDU A;  3DRA A;  3R9M A;  1HG2 A;  2OV8 A;  3JQ0 A;  2Y1L E;  5KJK A;  3CHS A;  2FBN A;  3PDN A;  1V54 E;  5EKQ D;  5T8I A;  1N4P A;  1Z6U A;  1WEN A;  4L1B A;  2LXM A;  5T3R A;  3TG4 A;  4DUI A;  2VJE A;  2XOZ A;  4UI9 C;  1OT8 A;  2I9C A;  4JW1 A;  1LD7 A;  1WEQ A;  4AV7 A;  3CHQ A;  3CQC B;  4CDR A;  4HNA D;  3OTN A;  4AY6 A;  4YDO A;  4KZC A;  1O1R A;  2R02 A;  4CDM A;  2KE1 A;  2VJ8 A;  4OYS A;  5CCM A;  4JA9 A;  3UUX A;  3FM8 C;  1SW6 A;  2CT2 A;  1N87 A;  3AJI A;  3R7Q A;  5H9M A;  5D66 A;  1FP0 A;  1PC2 A;  2KWJ A;  1UJK A;  3ISM C;  3RO3 A;  3EHN A;  2KR4 A;  4EEC A;  3AS5 A;  3QJZ A;  4BX8 A;  3IHV A;  2OCC E;  4K03 A;  3GZ2 A;  1H19 A;  2XEN A;  2CSY A;  4DK5 A;  3DPL R;  3LRQ A;  3B7T A;  3EB5 A;  1ELR A;  3EJN A;  4FO9 A;  4XEI G;  5FQ6 A;  4BET A;  4G25 A;  5BT1 A;  3KV5 A;  3ZXS A;  4RVB A;  3JQ1 A;  2QIC A;  4I7B A;  1ZB1 A;  1OWN A;  3MHH A;  2LGL A;  1OWP A;  1WEO A;  4H7Y A;  4L23 A;  3AG4 E;  2FUI A;  3DEO A;  2YT5 A;  5D1L B;  2NYJ A;  4U95 D;  1FT1 A;  1BI7 B;  3D9H A;  3RJV A;  4QF3 A;  5B8D A;  1D8D A;  3T5V A;  5EID A;  3ML8 A;  3PH0 C;  2YQL A;  4HRN A;  2ETC A;  4LG6 A;  2E6S A;  2XRY A;  2AXZ A;  2PZI A;  3HDX A;  5B1A E;  3JXJ A;  3ML9 A;  2L5U A;  3N9O A;  3V79 K;  4CRW A;  1NFI E;  2AXV A;  2KAT A;  3CHM A;  2D8U A;  3FL2 A;  3CHR A;  4JEU A;  1N9A A;  2MUM A;  4YVQ C;  2CKL A;  4EZJ A;  3J5Q B;  4CEM A;  3L13 A;  5FQ4 A;  1NL4 A;  3I2D A;  5E75 A;  5CER B;  1OY3 D;  2NXP A;  3Q78 A;  3HXC A;  3O47 A;  3TWS A;  4XI0 A;  1NI1 A;  3JUI A;  4E85 A;  3O36 A;  3T9K A;  3N71 A;  4UP5 A;  4N3A A;  4ACL A;  4FC8 A;  3IBE A;  2KIZ A;  5AYW D;  1WM5 A;  4JHJ A;  5B1B E;  2IO2 C;  3I5P A;  3KS2 A;  3TXN A;  3ZXP A;  2QY7 A;  3I3N A;  1HG5 A;  4V3I A;  4L7X A;  3MZL B;  1AP7 A;  3RTR B;  5CMY A;  4RSY A;  5ANR A;  5HQ8 A;  4PH4 B;  3Q49 B;  3FUK A;  4DJA A;  4A4B A;  2J07 A;  2UY1 A;  3HYM B;  3FUF A;  2X6I A;  1HYJ A;  3GZ1 A;  3EU9 A;  2RFM A;  3CST A;  3ULQ A;  2L7P A;  2L0T B;  5KJN A;  4WWP A;  4FLH A;  2KWN A;  2GGF A;  2G6Q A;  2CSZ A;  3ZEF A;  4F53 A;  5AQA A;  1FT2 A;  1JOC A;  2K1J A;  5TDW A;  4TKP B;  4GCN A;  1N4Q A;  4BY6 A;  5EIL A;  3UXG A;  1WDY A;  2H6I A;  5K3Q A;  4F1P A;  3GV4 A;  2VJF A;  2P9S G;  4ILH B;  5FJY A;  4ABN A;  3SF4 A;  2KWK A;  2KBX A;  5E76 A;  3QK0 A;  3NZS A;  4APF A;  4A1S A;  3CVP A;  2LAH A;  2GRR B;  1ELW A;  5J90 A;  2PQR A;  3GZS A;  2F6J A;  3RU0 A;  4GNF A;  4I7D A;  3QOU A;  3PUK A;  4JPS A;  3ZHE B;  4LNG A;  3EDT B;  4L58 A;  4MS6 A;  4WNF A;  2KC7 A;  3T8M A;  2EA6 A;  2YRE A;  3ZN3 A;  2WXI A;  5ENR D;  2J4B A;  2E6R A;  4NAC A;  5FWQ A;  3FUL A;  4ILG A;  3PE3 A;  2ILR A;  4HRL A;  4U0S A;  1LDJ B;  1NA0 A;  3G2T A;  4AY5 A;  3CR3 A;  4H9D A;  1F62 A;  3LVQ E;  3DXM G;  4Z0R A;  3Q47 B;  4J8Y A;  5LKZ A;  5HI7 A;  5G04 B;  4TV3 A;  5HRY A;  4OAU C;  4G1T A;  3EB6 A;  2P9I G;  3E32 A;  5ENS D;  5C11 A;  3FWV A;  2P2C P;  3APC A;  5CRV A;  1JWF A;  4TXR A;  4KT6 B;  3FTY A;  3C3Q A;  3KV6 A;  3MKQ A;  2OVB A;  4C9Z A;  3JYS A;  3RRN B;  1WY6 A;  3C72 A;  5BXU A;  1OWL A;  5CCL A;  4AYC A;  1S0P A;  3E33 A;  2VGX A;  4I6G A;  3O33 A;  3MYV A;  4UQX A;  3PZ1 A;  2QYU A;  1QBQ A;  2OVF A;  1WE9 A;  2P57 A;  4D10 C;  4J0U A;  3Q79 A;  2MD7 B;  4R7E A;  2VSX E;  4BHW A;  2NC9 A;  3U4T A;  3B13 A;  4RQI A;  2CFU A;  2FF4 A;  5SVI A;  4U07 A;  2KCL A;  3MCX A;  5G05 C;  2PQN A;  2V5F A;  4BX9 A;  4XX5 A;  2FO1 E;  4O60 A;  3AS8 A;  1WEE A;  5EX3 A;  2RG8 A;  1LF8 A;  2WMN A;  3WG7 E;  3SBT B;  2LSU A;  4IC2 A;  3KSL A;  3UQ3 A;  1WES A;  2QC9 A; 
#chains in the Genus database with same CATH homology
 2VSN A;  4FK5 A;  5D1K B;  2WXJ A;  4YAB A;  2VYI A;  5FQ7 A;  3LS8 A;  3U5P A;  2XPY A;  4YAT A;  3I4G A;  5EX0 A;  3FUM A;  4APO A;  3L11 A;  2WB2 A;  5G05 B;  2AVP A;  4YC9 A;  3ASF A;  5D0Q D;  3QB2 A;  3ZVY A;  3UPV A;  1WIL A;  2MA6 A;  4R8P K;  2GW1 A;  3FU6 A;  4H7X A;  4A55 A;  3BEE A;  1EF1 C;  2LV9 A;  2KWO A;  3OXG A;  5FB0 A;  3FUE A;  5FER A;  3G2S A;  5LCW B;  3O7A A;  3FEY A;  4GYO A;  4X3G A;  4LAD B;  3PEV B;  3MGB A;  4DLO A;  2E2E A;  2KZT B;  3LKU A;  1JUQ A;  4UI9 J;  4GYY A;  4LLB A;  2L80 A;  1LDK C;  4MVT A;  4J8D A;  2NAA A;  4C9B B;  4UWH A;  2M3H A;  2R59 A;  3GW4 A;  4ATG A;  4LJN A;  1GW6 A;  3AU5 A;  4B86 C;  1SZ9 A;  2PL2 A;  4XIF A;  3ZRH A;  4I1O B;  5KCM A;  4F52 B;  4HVB A;  2IOS A;  4XKB A;  2OOE A;  3UT7 A;  4Q96 A;  4M3O A;  1A17 A;  1U3D A;  4HXI A;  3CVL A;  3B7R L;  2XPZ A;  5AIU A;  2JMJ A;  3TJP A;  1IYM A;  2WXH A;  4U8H A;  2Y43 A;  2K4D A;  5BPP A;  4ACK A;  1NA3 A;  2WXL A;  3QZV A;  1FCH A;  1JM7 B;  4LRZ A;  5JHB A;  2ECG A;  4HOS A;  4I6J A;  4F7A A;  4J8E A;  3U64 A;  4Q6F A;  2KGG A;  3OXF A;  4N4F A;  3SZ7 A;  2WVI A;  4LK9 A;  4AJW A;  4PDX A;  2VJE B;  1PAQ A;  4S3O B;  4TUU A;  1TJC A;  4GML A;  2VTB A;  4B8C B;  1H0A A;  3QDN A;  3CVV A;  2AN6 A;  4GU5 A;  3IKO B;  2WXP A;  4UP0 A;  2I1K A;  2YHO A;  5FQ8 A;  2HM8 A;  5ANL A;  3ASH A;  2LGV A;  3HCU A;  5AJD A;  1L5J A;  2I2O A;  1WFK A;  4YAX A;  2XCC A;  1EPU A;  2WXM A;  3N9L A;  3OXL A;  2J4D A;  3LXU X;  5B79 A;  4WAF A;  2ZU6 B;  1FBV A;  4IC3 A;  2MA5 A;  2MNZ A;  1VFY A;  3M62 A;  4N2S A;  5KH7 A;  2VGY A;  4A3T A;  3S7D A;  5FTP A;  1XWH A;  3DBS A;  2YSJ A;  3BG0 B;  4YBS A;  3R9A B;  3QWW A;  3PNT B;  4UQY A;  5A23 A;  5LOZ A;  5G04 J;  1E7V A;  4W4U A;  3RIB A;  3FFL A;  2VPE A;  2FI7 A;  3FUH A;  4GCO A;  2Y1M A;  2MHK A;  3CLJ A;  4I6E A;  4FHK A;  3O4Z A;  1Z60 A;  3L16 A;  3RRM B;  5TRB A;  2CKL B;  1CHC A;  3D9L A;  3FUI A;  2MOW A;  4JHK A;  3ENE A;  3CIA A;  4A1G A;  4KBQ A;  4JEH A;  1WAO 1;  1ZBD B;  2CHX A;  2P58 C;  5TAB A;  4MRU A;  5H1U A;  4GPK A;  1MHQ A;  3D9P A;  4FJC A;  2UY1 B;  2R17 C;  2X3M A;  4CCG X;  1BOR A;  3Q5M A;  5AIJ A;  4AVX A;  1HZ4 A;  4JZY A;  1TJF A;  1N54 A;  2A5U A;  4RG6 A;  4J8F A;  3SHB A;  4LER A;  4IUL A;  1X4J A;  4IRU A;  2Q7F A;  3AU4 A;  4L2Y A;  2ECI A;  1E96 B;  5KJL A;  3ZPV E;  2YUR A;  4R7L A;  4CT0 A;  2KU3 A;  5JHA A;  4I2Z A;  2ECN A;  4BFR A;  2VJF B;  4WZ3 B;  5DIN A;  2VQ2 A;  3AS4 A;  1EYH A;  4A0C D;  2LGK A;  1E90 A;  4FJZ A;  2L43 A;  4I17 A;  3URZ A;  3O35 A;  3B7S A;  3S7J A;  5G05 J;  2AXU A;  3C98 A;  5LFA A;  3ZPV 1;  2YSM A;  3CK9 A;  5FZS A;  3FTZ A;  3P1U A;  3O70 A;  2WXQ A;  2YU4 A;  4KMO A;  2QJ0 A;  3M99 A;  2WMO A;  3CV0 A;  3ZYK A;  2J49 A;  5KH3 A;  2F6N A;  2VP7 A;  4GB9 A;  3HCS A;  5B78 A;  2V0P A;  2L9B A;  1X4I A;  4U0U A;  1X4U A;  1ZBP A;  2C0M A;  2E0I A;  5ENN A;  2ECT A;  3N9P A;  2X6H A;  5G04 C;  1HYI A;  4URK A;  2XEV A;  3EIQ C;  4FA6 A;  4Y6C A;  1E7U A;  2FO7 A;  2FUL A;  3O48 A;  1Y6I A;  2XGS A;  2LDR A;  3FU0 A;  3MKQ B;  3D9M A;  5B76 A;  3K9I A;  4WWN A;  1WEW A;  3CKB A;  5LP0 A;  4AYC B;  2I6H A;  2VGX B;  4U0Z A;  4FIP A;  4ZUX U;  3D3M A;  3D9N A;  4U04 A;  4DPR A;  3FTS A;  4AEZ C;  2PM7 A;  1QZ2 A;  2ION A;  2I50 A;  3RK6 A;  4DI3 A;  3KQI A;  3L1Z B;  3EIJ A;  2KYU A;  2G43 A;  4GAA A;  3LEW A;  3T5X A;  3DPD A;  4QFV A;  4I2W A;  2Y4T A;  3TAX A;  3SD5 A;  3D9K A;  2EOD A;  2BF0 X;  5KJM A;  4FU3 A;  3HIZ A;  2JMI A;  1JPL A;  4Q69 A;  1H2U A;  4FUL A;  5B77 A;  5H1V A;  3MJW A;  4KXK B;  4GZD A;  4I1A A;  4C0M A;  3ZVV A;  4U63 A;  4O64 A;  5EDS A;  4JA7 A;  4A3V A;  3LPZ A;  1XGW A;  2VSO E;  2LRI C;  5J08 A;  3CK8 A;  4ZDT A;  4GA2 A;  4YBM A;  2YUC A;  1YA0 A;  2XRZ A;  4NQ0 A;  1Z3X A;  4CDN A;  2JMD A;  4UWL A;  2UZG A;  3CHP A;  4ANV A;  1TEZ A;  4HOT A;  3CVY A;  3DQV R;  4JL0 A;  1B89 A;  3UMV A;  2FSA A;  4CA1 A;  1KT0 A;  1V87 A;  1SQM A;  5I3L A;  5LCW C;  2IDA A;  3LY8 A;  3RKV A;  2JLB A;  2XQ0 A;  3G2V A;  3N9M A;  5FEY A;  5B75 A;  4LEU A;  2MIQ A;  5EYA F;  3ASL A;  4UI9 K;  4IN3 B;  3UT8 A;  2LN0 A;  2DIW A;  4AP4 A;  5DBK A;  2C2V S;  3VK6 A;  3CVU A;  4PS3 A;  2AW6 A;  4XE0 A;  3ZGQ A;  2L75 A;  1H6K A;  4EPZ A;  4GNG A;  3QC1 A;  2RD0 A;  2G45 A;  3FH8 A;  2YQ8 A;  4FHJ A;  4A4C A;  4HOR A;  4AXH A;  1IQU A;  5FZQ A;  3R7R A;  3C6W A;  3D9J A;  3LQJ A;  4EQF A;  3HCT A;  2YW8 A;  4L2L A;  3FUN A;  4BT8 A;  5G55 A;  5J3X A;  3HTK C;  3KAE A;  2VPG A;  1SZA A;  1JWG A;  3P2B A;  2VSY A;  3CVN A;  2Y4U A;  5LKX A;  3G2U A;  1HE8 A;  4J6I A;  2HR2 A;  3CVX A;  1UN8 A;  1OWM A;  1NP7 A;  4HOQ A;  4S3O C;  1UJJ A;  2M63 A;  1T1H A;  2VTB B;  1INZ A;  2XHE A;  3IHP A;  2M85 A;  4AUQ B;  3PUJ A;  4GYW A;  2CFZ A;  3VTX A;  4QF2 A;  2L6J A;  4N39 A;  4N2Q A;  3RPG B;  3TL5 A;  4C0E A;  1QQE A;  2J08 A;  2F42 A;  3LJ3 A;  3Q15 A;  1KT1 A;  4RG9 A;  4R2Y A;  2FUU A;  3L22 A;  3CKC A;  2CHZ A;  2L0I A;  3L6A A;  3NG2 A;  2XGM A;  4F1S A;  1ELK A;  3O37 A;  4PUC A;  3ZTG A;  3B7U X;  1VYX A;  3FU3 A;  4AIF A;  4GZC A;  4E6H A;  3ESK A;  4N5C A;  4FLB A;  2ECV A;  3FUJ A;  3LCA A;  1VDY A;  1E8Y A;  5C1D A;  3HVE A;  3L54 A;  1G25 A;  2YQM A;  3ZIM A;  2J9Q A;  3ESL A;  5JJ7 A;  3SBS A;  3T7L A;  5T4Y A;  2K16 A;  3KD7 A;  2LO6 A;  4Q94 A;  2CG2 A;  4LUN U;  4GA1 A;  4KYO B;  1UN9 A;  2CHW A;  3VTY A;  3APF A;  4WND A;  2D8S A;  4MSX A;  2MT5 A;  3LYA A;  4ZQL A;  5D1M B;  4GZ6 A;  2IQC A;  2WXG A;  4CGV A;  3GYZ A;  4AP2 A;  3PHD A;  4K0R A;  3SHF A;  3QWV A;  4NN2 A;  1WGM A;  2MRI A;  3U3W A;  5AJL A;  4BBQ A;  3FH5 A;  1HH8 A;  3Q4A B;  3CEQ A;  5M72 A;  3CQG B;  3JCK C;  4NUR A;  4FAD A;  2JRJ A;  1E4U A;  4XI1 A;  4PTB A;  4BTB A;  2HDP A;  4FJY A;  3SOU A;  3SNX A;  3ZVZ B;  4Y6W A;  5FT9 A;  2V4L A;  3CVQ A;  2VPB A;  2C0L A;  3PRZ A;  1X5B A;  4EZL A;  3IEG A;  4BWR A;  4UI9 B;  2YYR A;  5D0O D;  2WXN A;  1WEV A;  3FH7 A;  4JHR A;  3QAR A;  4CCA A;  5BV0 A;  4BT9 A;  3FY4 A;  2QIZ A;  4IYP A;  1OWO A;  3NQP A;  2ECW A;  4I9C A;  3T6R A;  3MV3 B;  1ZU2 A;  2OND A;  1FVH A;  2DCP A;  3N9Q A;  4BSX A;  4HFG A;  1BPO A;  4MLP A;  5JJ6 A;  2XPI A;  1OUV A;  1E8W A;  1HU3 A;  3LY7 A;  3PRE A;  3FTV A;  5CMW A;  5A6C A;  3BG1 B;  5C13 A;  4YVO A;  2HYE D;  4KVO A;  5A7D B;  2JEK A;  2KM4 A;  4AM9 A;  1Y8M A;  3PE4 A;  2IFU A;  2IOL A;  2KFT A;  4V3L C;  3QAQ A;  2M6M A;  5TBN A;  2YHC A;  5AIT A;  5AEN A;  1WEP A;  3CHO A;  3ZYM A;  3FP3 A;  1FVF A;  4UQZ A;  5G2N A;  3L1X A;  4FP7 A;  4JXT A;  5LKT A;  2J09 A;  5LCW J;  2KGI A;  2LXH C;  3CK7 A;  2PUY A;  5G0F A;  2BUG A;  3LDZ A;  2HYZ A;  3LQH A;  3U5N A;  3FTU A;  3FTX A;  4YAD A;  2WPV A;  4L7T A;  4GB0 A;  2I1J A;  4DLQ A;  2OXQ C;  4GND A;  2KCV A;  3M63 A;  1H2T C;  3VLF A;  3LQI A;  2XGO A;  2IF4 A;  5DKA A;  4EBA A;  4DI4 A;  3I4R B;  4WNE A;  2XB1 A;  5TDR A;  4UWG A;  2WXK A;  4I9E A;  1WEU A;  4W9R A;  1Z6T A;  3MX3 A;  2X6F A;  2IJG X;  2M1R A;  3ONL A;  4ANU A;  5JG6 A;  3MHS A;  4JVS A;  3IHY A;  3VLE A;  2YIN A;  4OVU A;  2WXR A;  3FTW A;  5LX8 A;  3FHE A;  2LSV A;  3LY9 A;  2ZET C;  3V43 A;  2WQ6 A;  3PNL B;  1Z3Y A;  2K17 A;  4UWF A;  4OVV A;  4G2V A;  1VD4 A;  2X6J A;  1P5Q A;  4G24 A;  3ZHE A;  4EBA G;  2KRE A;  1HS6 A;  4GNE A;  5JJT A;  3ZW3 A;  1MM3 A;  2IU1 A;  4N3C A;  5BUZ A;  2XEU A;  3PUR A;  3PVL A;  4G26 A;  4PS8 A;  2LNI A;  2CG3 A;  2UWJ G;  3FDH A;  2V8S E;  3PS6 A;  2WQ7 A;  2WM9 A;  4GZ3 A;  3PZD A;  2BTD A;  3CGH A;  2VPD A;  5BV1 A;  4MKT A;  4CGW A;  3IV0 A;  1H2V C;  1UG3 A;  4J8S A;  1IQR A;  2HO1 A;  1Z2Q A;  5FB1 A;  4BTA A;  1E8Z A;  3D9I A;  3FEX A;  4GZ5 A;  1K2F A;  3ASD A;  3TXM A;  4F3V A;  4P29 A;  3SFZ A;  2WXO A;  4JC8 A;  3PUQ A;  2YNQ A;  4G23 A;  5BW8 C;  3SI5 A;  4G11 A;  1WIM A;  3CVW A;  4O6F A;  3C5K A;  1HF8 A;  2X38 A;  4WZ2 A;  3QKY A;  4I1M A;  1MM2 A;  3ZYL A;  2PM6 A;  4PS7 A;  4WZ0 A;  1QNF A;  2WQH A;  4LCT A;  1U3C A;  2QFC A;  5CHE E;  3CSF A;  2L0B A;  3APD A;  4I43 A;  1IHG A;  2EGP A;  4B94 A;  3L17 A;  4HLE A;  1WEM A;  3U5O A;  3E4B A;  2YHN A;  5H1T A;  1MQS A;  4B8A A;  1DVP A;  3GL6 A;  3ZNI A;  4XKC A;  2RI7 A;  2VNF A;  5ARG A;  1N52 A;  3UT4 A;  4ANX A;  2DX8 A;  4ILI A;  2BAY A;  2NSZ A;  2C2L A;  1U6G B;  3EHM A;  4N3W A;  3G2W A;  3KNV A;  2KCK A;  4KVM A;  4NRH B;  4V3K C;  3D9O A;  4GA0 A;  2FEZ A;  4WUY A;  3RRU A;  4LKA A;  5KH9 A;  3U5M A;  2X6K A;  4UWK A;  4PPE A;  2MNY A;  3RPG C;  4HS2 A;  5ARF A;  5C2Y A;  3S7B A;  3ONK A;  1IYG A;  2LXP C;  4A49 A;  4B7Y C;  4ME2 A;  4I7C A;  3OAW A;  2MD8 C;  3ZYQ A;  3ZFW A;  1W3B A;  2XCB A;  2LAI A;  4YND A;  4TRQ A;  3MEK A;  3UX4 A;  1NZN A;  2AWI A;  2RSD A;  4EZK A;  1RMD A;  1HO8 A;  1PY1 A;  3TG5 A;  1E8X A;  2LQ6 A;  3N9N A;  4ANW A;  4XZ4 A;  3O34 A;  4N3B A;  3HVE B;  3QNK A;  3MKR A;  4WWO A;  4GMJ A;  2KZT A;  1KLX A;  3LVR E;  2PNX A;  3NZU A;  3S7F A;  4B0Z A;  5LKU A;  2H0D B;  3NF1 A;  3ZPJ A;  3WXX A;  4WNG A;  1DNP A;  3KEZ A;  4WA6 A;  3RO2 A;  3QWP A;  2GRL A;  3FU5 A;  1HX8 A;  4HOU A;  2DBA A;  1HXI A;  4B89 A;  3VLD A;  2WXF A;  4AOF A;  3SOW A;  1XNF A;  3S2A A;  2A4Z A;  2YHE A;  3MV2 B;  2EQX A;  2Y1N A;  3SGH A;  3FUD A;  5DIZ A;  4CT4 A;  1UW4 B;  3MA5 A;  4XI9 A;  2H0D A;  2GRM A;  2R5S A;  4YBT A;  3L08 A;  3SOX A;  2LGG A;  3HHM A;  1JM7 A;  5FZR A;  4KZ0 A;  4P5O B;  3TGO A;  3U66 A;  3U9W A;  2Y3A A;  1HFA A;  3ASG A;  5BNW A;  2ECJ A;  3PEU B;  1EDU A;  1HG2 A;  2OV8 A;  3JQ0 A;  5KJK A;  3CHS A;  2FBN A;  3PDN A;  5EKQ D;  5T8I A;  1Z6U A;  1WEN A;  4L1B A;  5T3R A;  3TG4 A;  2VJE A;  4UI9 C;  2I9C A;  4JW1 A;  1WEQ A;  4AV7 A;  3CHQ A;  3CQC B;  4CDR A;  4AY6 A;  3OTN A;  4KZC A;  4CDM A;  2KE1 A;  2VJ8 A;  4OYS A;  5CCM A;  4JA9 A;  3UUX A;  2CT2 A;  1N87 A;  3R7Q A;  5H9M A;  1FP0 A;  1PC2 A;  2KWJ A;  1UJK A;  3RO3 A;  3EHN A;  2KR4 A;  4EEC A;  3AS5 A;  3QJZ A;  4BX8 A;  3IHV A;  4K03 A;  3GZ2 A;  1H19 A;  2CSY A;  4DK5 A;  3DPL R;  3LRQ A;  3B7T A;  3EB5 A;  1ELR A;  3EJN A;  4FO9 A;  5FQ6 A;  4G25 A;  5BT1 A;  3KV5 A;  3ZXS A;  4RVB A;  3JQ1 A;  2QIC A;  4I7B A;  1OWN A;  3MHH A;  2LGL A;  1OWP A;  1WEO A;  4H7Y A;  4L23 A;  2FUI A;  2YT5 A;  5D1L B;  3RJV A;  4QF3 A;  5B8D A;  3T5V A;  3ML8 A;  3PH0 C;  2YQL A;  2E6S A;  2XRY A;  2AXZ A;  2PZI A;  3HDX A;  3ML9 A;  2L5U A;  3N9O A;  4CRW A;  2AXV A;  2KAT A;  3CHM A;  3FL2 A;  3CHR A;  4JEU A;  2MUM A;  4YVQ C;  2CKL A;  4EZJ A;  4CEM A;  3L13 A;  5FQ4 A;  3I2D A;  5E75 A;  2NXP A;  4XI0 A;  3JUI A;  4E85 A;  3O36 A;  3N71 A;  4UP5 A;  4N3A A;  4ACL A;  4FC8 A;  3IBE A;  2KIZ A;  5AYW D;  1WM5 A;  4JHJ A;  3I5P A;  3KS2 A;  3TXN A;  2QY7 A;  3I3N A;  1HG5 A;  4V3I A;  4L7X A;  3MZL B;  3RTR B;  5CMY A;  4RSY A;  5ANR A;  5HQ8 A;  4PH4 B;  3Q49 B;  3FUK A;  4DJA A;  4A4B A;  2J07 A;  2UY1 A;  3HYM B;  3FUF A;  2X6I A;  1HYJ A;  3GZ1 A;  3CST A;  3ULQ A;  2L0T B;  5KJN A;  4WWP A;  4FLH A;  2KWN A;  2GGF A;  2G6Q A;  2CSZ A;  3ZEF A;  4F53 A;  1JOC A;  2K1J A;  5TDW A;  4TKP B;  4GCN A;  4BY6 A;  3GV4 A;  2VJF A;  4ILH B;  5FJY A;  4ABN A;  3SF4 A;  2KWK A;  5E76 A;  3QK0 A;  3NZS A;  4APF A;  4A1S A;  3CVP A;  2LAH A;  1ELW A;  5J90 A;  2PQR A;  3GZS A;  2F6J A;  3RU0 A;  4GNF A;  4I7D A;  3QOU A;  3PUK A;  4JPS A;  3ZHE B;  3EDT B;  4L58 A;  4MS6 A;  4WNF A;  2KC7 A;  3T8M A;  2EA6 A;  2YRE A;  3ZN3 A;  2WXI A;  2J4B A;  2E6R A;  4NAC A;  5FWQ A;  3FUL A;  4ILG A;  3PE3 A;  2ILR A;  4U0S A;  1LDJ B;  1NA0 A;  3G2T A;  4AY5 A;  3CR3 A;  1F62 A;  3LVQ E;  3Q47 B;  5LKZ A;  5HI7 A;  5G04 B;  4TV3 A;  4G1T A;  3EB6 A;  5C11 A;  3FWV A;  3APC A;  1JWF A;  4KT6 B;  3FTY A;  3KV6 A;  3MKQ A;  2OVB A;  4C9Z A;  3JYS A;  3RRN B;  1WY6 A;  1OWL A;  5CCL A;  4AYC A;  1S0P A;  2VGX A;  4I6G A;  3O33 A;  3MYV A;  4UQX A;  2OVF A;  1WE9 A;  4D10 C;  4J0U A;  2MD7 B;  4R7E A;  2VSX E;  4BHW A;  2NC9 A;  3U4T A;  3B13 A;  2CFU A;  2FF4 A;  4U07 A;  2KCL A;  3MCX A;  5G05 C;  2PQN A;  2V5F A;  4BX9 A;  4XX5 A;  3AS8 A;  1WEE A;  5EX3 A;  2RG8 A;  1LF8 A;  2WMN A;  3SBT B;  2LSU A;  4IC2 A;  3UQ3 A;  1WES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...