4AVXA

Hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) bound to an ip2 compound at 1.68 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
218
Chain Sequence
b'GTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE SUBSTRATE
publication title Crystal Structure of the Tandem Vhs and Fyve Domains of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) Bound to an Ip2 Compound at 1.68 A Resolution
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 72
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4avxA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4avxA02
2YURA 1WENA 3N9QA 2JRJA 2M6MA 3L1XA 5G04B 2H0DB 3SOUA 1JWGA 2YSMA 5CMWA 2FUIA 1EDUA 1HG2A 5B76A 4BHWA 4Q96A 1WE9A 5LKZA 2Y1MA 5KH7A 1E4UA 2ECNA 3RPGB 4Q94A 2LXPC 2ZETC 1DVPA 3G2WA 2VJFB 2YW8A 3GL6A 1BORA 5LKTA 3ZVYA 2PUYA 1LF8A 1ZBDB 2KGIA 1V87A 3D9PA 2G6QA 3KV5A 4NACA 2KYUA 2G43A 5EYAF 3HCSA 4NN2A 4GNFA 2MD7B 1HYIA 5G05B 2KGGA 2VPDA 4YADA 3U5NA 2YQMA 2F6JA 2EA6A 3O34A 2K4DA 1HYJA 2G45A 3U5MA 2L0IA 4Q6FA 4O64A 5D1KB 2RI7A 1WESA 2LGLA 1LDKC 4R7EA 4ZDTA 1PY1A 1MM2A 5H1UA 4QF2A 5LKXA 1WEEA 3FL2A 5J08A 3V43A 2MNYA 4YATA 2KWOA 3M63A 4MSXA 5B79A 5H1VA 3O33A 4R8PK 1EYHA 2MIQA 2YUCA 3O37A 4WZ2A 4FIPA 1IYMA 2VJEA 4LK9A 3PUQA 1N87A 2KU3A 4QF3A 4X3GA 3D9OA 3O35A 4UP5A 4AYCB 3MHSA 5B77A 1JPLA 3N9OA 2Y1NA 2C2VS 2E6SA 4AP4A 3D9JA 1Z60A 2MA6A 4GB0A 4YAXA 4A49A 2YREA 1K2FA 2K17A 4R2YA 5DINA 3SOXA 3T6RA 2AN6A 3O7AA 3T7LA 3KQIA 2DCPA 2ECJA 5LCWB 2EODA 3D9MA 2MOWA 5H1TA 2IDAA 4B7YC 1UJKA 2D8SA 4W4UA 3L11A 1VDYA 4BBQA 2F42A 2Y43A 2CKLA 2L5UA 3EB5A 2JMJA 5TBNA 5JG6A 1FP0A 1X4UA 4I7CA 1JOCA 2L43A 5LOZA 2L75A 3ASLA 1CHCA 1HFAA 2VPEA 2YYRA 1MHQA 4LJNA 2H0DA 4LKAA 4N4FA 1VD4A 1WFKA 3DPLR 3LRQA 4GZDA 1WEOA 3ZPV1 1X4JA 1WILA 2KWNA 3C5KA 3G2VA 5AIUA 4CCGX 2ECTA 3DQVR 3ONKA 3D9KA 2VJFA 3O70A 3SOWA 4YBMA 3U5PA 2CSYA 1T1HA 2KE1A 4CA1A 3HCUA 2M85A 2M1RA 5TDRA 4V3LC 2FUUA 5KH3A 3ZTGA 1JM7B 2NAAA 3PHDA 5FB1A 2LRIC 2L0TB 1XGWA 5LP0A 2ECGA 2C2LA 2MA5A 2MT5A 2YHNA 2YSJA 5FB0A 4YBTA 4FK5A 2KR4A 2HDPA 3M62A 2ECWA 1VYXA 3ZYLA 2MD8C 1JUQA 3C6WA 1X4IA 2M3HA 4A4CA 1WEPA 2LN0A 3LQIA 2LGGA 4AUQB 4TKPB 3ZYQA 2LO6A 2V8SE 2EGPA 3G2TA 2DX8A 4GZCA 3U5OA 1SZAA 4L58A 3KNVA 2CSZA 3I2DA 2UZGA 4V3KC 4B86C 2LV9A 2QJ0A 2LGKA 2K1JA 5B8DA 2XEUA 4JXTA 2K16A 1WEWA 1WEUA 3M99A 5G0FA 2KWJA 3MHHA 2BAYA 2OXQC 2YHOA 1HF8A 4FO9A 4MVTA 3SHBA 3D9LA 4GNDA 2DIWA 5CMYA 2QY7A 4HFGA 2KWKA 4LLBA 2MUMA 5B75A 1XWHA 1MM3A 2QICA 4AYCA 4AVXA 1HG5A 3G2UA 1WEQA 5J3XA 1UJJA 1WIMA 3ZVZB 3ZNIA 3LDZA 3VK6A 1G25A 2VP7A 5LKUA 2I50A 5TDWA 3IHPA 4ZQLA 4IC2A 2F6NA 3N9NA 1JWFA 1RMDA 2LDRA 3EB6A 4N3WA 4F52B 4GNEA 3GV4A 1H0AA 4C9ZA 2LGVA 2YT5A 5KH9A 5TRBA 2BF0X 3RTRB 2KFTA 1X5BA 4YC9A 4FLBA 5AITA 4YBSA 4A0CD 5TABA 5D1MB 2KM4A 3L1ZB 3NG2A 4S3OC 2XB1A 4FJCA 3KV6A 3PURA 2E6RA 2QIZA 3N9MA 3D9IA 5H9MA 5I3LA 1WGMA 2PNXA 2LQ6A 2YQLA 4UP0A 4A4BA 4L7XA 1Z2QA 5C11A 2ECIA 3ONLA 4WA6A 2VPBA 1F62A 3QZVA 3CLJA 4XI1A 5C13A 4GNGA 4S3OB 3G2SA 3RRUA 3N9PA 5DKAA 1JM7A 4FU3A 1LDJB 4PTBA 1WEMA 1FBVA 2KIZA 5FERA 1Z6UA 2VJEB 3N9LA 3O36A 4P5OB 2ECVA 3ZPVE 2MNZA 2VNFA 2VPGA 2HYED 5D1LB 4UI9B 2LXHC 3LQJA 1WEVA 5B78A 3LQHA 2FSAA 2JMIA 5FEYA 4YABA 3HCTA 4WZ0A 2JMDA 1VFYA 1ELKA 1SZ9A 4WZ3B 1HX8A 2YU4A 3HTKC 2KREA 4IC3A 4I7BA 2RSDA 2CKLB 3ZYMA 1U6GB 4LADB 2CT2A 4ZUXU 4PPEA 2L0BA 3ZYKA 3D9NA 3RPGC 4I7DA 1INZA 2L80A
chains in the Genus database with same CATH superfamily
3ASGA 2M6MA 3SFYA 4D10C 2Q7FA 2EIME 2H0DB 3DSWA 2XCBA 5EN5D 4PDXA 3SOUA 1JWGA 4PUCA 1EDUA 4YVOA 3S7BA 1HG2A 4JW1A 3LVRE 1DCQA 2DSMA 4Q96A 2IU1A 1NI1A 2XCCA 2VGYA 1IQUA 3ZIMA 4O62A 2YW8A 4I6GA 3GW4A 3L9TA 1ZBDB 2KGIA 4FADA 4AEZC 2GRPB 1N0RA 3KV5A 4WWPA 3GZ2A 3FEHA 5EYAF 3EHQA 2QFCA 2KGGA 3SBTB 3U5NA 1Y8MA 1E8XA 2L6JA 2X38A 1UW4B 1QNFA 3O34A 5FZRA 3SY2A 2K4DA 1ELRA 2A5UA 2L0IA 4O64A 2RI7A 2FULA 4ZDTA 4GPKA 2WMOA 4GTMA 4L2YA 4FHJA 2BKGA 3ISMC 3AS8A 5KJNA 3V43A 4EZKA 5ITZF 3GZSA 5H1VA 2KZTA 3QC1A 3OXLA 3E4BA 1EYHA 5HRYA 3L82A 4EPZA 5AJLA 4HNAD 2MYOA 4GA0A 3VLFA 1N87A 2KU3A 3CSTA 4X3GA 3PRZA 4G26A 3RIBA 4JA9A 1E8ZA 4AYCB 1P5QA 2J9QA 1JPLA 3N9OA 3P1UA 3TXNA 5EYPF 2C2VS 2E6SA 2VSYA 3BQOA 4AP4A 4XE0A 4GB0A 2MA6A 2YREA 3APCA 2LSVA 1OUVA 1K2FA 4AOFA 3LY8A 2J8SD 3LS8A 3T6RA 4XIFA 3TAXA 3UIOC 1NL4A 2Y0BG 2AN6A 4YDWA 1IXVA 3ABKE 2YNQA 5SVXA 5H1TA 5EIBE 2KCLA 4A55A 4W4UA 3CHQA 3KS2A 5G55A 2L5UA 3DEOA 4HRNA 4FLHA 3EB5A 1S64A 3B13A 3ZFWA 3UIPC 1AP7A 1TN8A 3UQ3A 3QK0A 5ANRA 1MZCA 4O6FA 3AG3E 1X4UA 4MLPA 2KC7A 5CEDB 1MHQA 5JA4D 4U8YD 4N4FA 3VTXA 4GMRA 3L54A 3DPLR 4LUNU 1KZOA 3C5KA 3NZUA 3G2VA 2ZXWE 5J90A 4K03A 2OVFA 3P2BA 4CGWA 1BI8B 3FDHA 5EIDA 3Q78A 1T1HA 2KE1A 2IQCA 4V3LC 2FUUA 2KATA 4OGEA 4AXHA 5FINA 4G24A 4JEHA 4A63B 4KXKB 4I1OB 2C2LA 2I6HA 2YHNA 2XOCA 5KBAA 3AS4A 2ECWA 3ZYLA 3QWVA 3C6WA 1X4IA 2IOSA 2OEWA 3SI5A 3LQIA 3QKYA 3ZYQA 4GYWA 2DBAA 1MX2A 4HI8A 4TXQA 2XHEA 2DX8A 2OVBA 2OOEA 4DPRA 4PH4B 4HVBA 4ILHB 4I17A 4HQDA 2QYUA 4EBAG 5EX0A 4F7AA 2AXZA 4C0MA 1H2VC 2YHOA 4MVTA 3SHBA 1H6OA 2WXFA 5A7DB 3KAEA 5G2NA 3QOUA 3V2OA 2WQ7A 2X3MA 2MUMA 1N4RA 1GW6A 3QWWA 3E32A 1HG5A 4GCOA 1WEQA 4U0ZA 4IRUA 5J3XA 4EHMA 4U63A 1UJJA 4U96D 1Z6TA 2WXGA 3DSXA 3APFA 4I2ZA 3VK6A 3QB2A 5CECB 2Y4UA 3OAWA 2B0OE 5TDWA 5ARGA 3IHPA 2OEVA 3N9NA 1N0QA 2VSXE 4WAFA 1JCQA 2ZGDA 3DPDA 3R7RA 4U95D 4U0SA 4BFRA 5CCLA 4CYMD 3EB6A 3LYAA 3Q73A 3T9KA 1NA0A 1SA5A 4C9ZA 3TL5A 4Y6CA 4LNBA 1OWPA 3RTRB 2KFTA 5EILA 4FLBA 4KZ0A 5AITA 4BX8A 4YBSA 5T4YA 5SVYA 3FTWA 5TABA 2VGXA 4C0EA 2WXOA 3OTNA 1E8YA 4FHKA 3ZU7B 4FJCA 3ASFA 3FUKA 2E6RA 3HYMB 2GROB 3PDNA 3PE3A 2LQ6A 3O4ZA 2YQLA 4BTAA 5E75A 2XOZA 4ANWA 5IY5E 3TG5A 3ZXPA 4U8HA 4OVUA 2Y4TA 4GA2A 5C11A 4APOA 4A1GA 1BI7B 4WA6A 2AXUA 3ZW3A 4GYOA 3FUJA 4GNGA 4S3OB 3G2SA 3B7TA 3RRUA 4Y6WA 2R03A 1LDJB 4PTBA 4DK5A 1WEMA 2KZTB 5FIOA 1AWCB 1FBVA 3PE4A 3FUNA 1TJCA 2XRYA 3FTYA 5FERA 2L9BA 2P9PG 3CVXA 3FU0A 2WQ6A 3CR3A 3MKQA 4BESA 3FU6A 2XS8A 4YDOA 4J8SA 4BERA 5BV0A 2HYED 5D1LB 2CHZA 2LXHC 2B6CA 3ASNE 3HVEA 3TWSA 4U8VD 5FEYA 3DDTA 3S7FA 4UWKA 1W3BA 1ELKA 1HX8A 2H6IA 2ZGGA 5AYWD 4IC3A 1OWNA 5HQ8A 4KT6B 3ZYMA 3N71A 1OWOA 4JPSA 1DNPA 5B1BE 3FULA 4AP2A 4PPEA 1MYOA 3MJWA 5AARA 2E0IA 4EECA 3ASHA 1WENA 4CGVA 2HE0A 1U3CA 1NFIE 2IFUA 1OWMA 4J0UA 4NURA 2JRJA 2JUNA 2EINE 3URZA 3EIQC 3PNLB 4PS8A 3SUBA 2A5EA 2FUIA 4HRMB 4KVMA 3UM3A 4CDRA 2XENA 5SVIA 5AQBA 4BHWA 5HI7A 1FVFA 3FUEA 5FZQA 1E4UA 3CQGB 2VQ2A 3AU5A 1DVPA 3GL6A 1N94A 3ZVYA 4RG9A 4NACA 5G04J 3TG4A 4F6RD 3HCSA 3TWUA 4GNFA 2MD7B 2MKEA 5KJMA 2VPDA 4YADA 4DI4A 2DVWA 2F6JA 4HB5A 4XI0A 1H2UA 3IXEA 1K8KG 4HOUA 1HYJA 1S0PA 2C0MA 3U5MA 4Q6FA 2R17C 5D1KB 3B7UX 2GRNB 4EQFA 4DX7D 2WXQA 1MM2A 5H1UA 3FTZA 3PUKA 4B8CB 1WEEA 3FL2A 1NP7A 5LX8A 2MNYA 4YATA 3M63A 2PNNA 4QQ4A 1TNZA 4ZFHA 4JEUA 2GW1A 5B79A 1G3NB 4L9PA 5G05J 3O37A 1ZB1A 3PH0C 1TEZA 2DYSE 2OWAA 4HOSA 4F1PA 4TRQA 3D9OA 3O35A 4GTPA 3W9FA 3FJUB 3TXMA 1JCRA 4XKBA 5B77A 2Y1NA 2WPVA 3CHRA 3EIJA 3D9HA 4YAXA 3JQ0A 2LAUA 2ZIRA 2K17A 3VLDA 5DINA 3UXGA 2J08A 4U04A 2LNIA 1E7VA 3MZLB 2DCPA 2ECJA 3RRNB 2XRZA 2EIJE 3LXUX 3UT7A 2HO1A 4J8FA 5KNHD 2IDAA 1UJKA 2D8SA 5M72A 1KPSB 3L11A 1OCCE 1VDYA 2CONA 4BBQA 4GTQA 2Y43A 5LFAA 3AG1E 4I2WA 4GAAA 4GPMA 2YHCA 3NQPA 5E76A 1ZU2A 3WXXA 5TBNA 1FP0A 1IHGA 1N4PA 3DSTA 2CHXA 1TN6A 2P9NG 3ABME 4I7CA 2VGXB 4M7CA 4FJZA 2YYRA 3E33A 1H2TC 4OYSA 1K1AA 4O60A 1V54E 3NAWA 2CRWA 3O47A 1X4JA 2IOLA 3LPZA 2ECTA 3ZGQA 4ANUA 3VTYA 4DRXE 3ONKA 2RKKA 3D9KA 2VJFA 4HI9A 5AN8A 4DX2A 3U5PA 2CSYA 1IYGA 1WDYA 4XI9A 2M85A 3NOGD 1ELWA 2NAAA 2IONA 3ZEFA 3DRAA 3PHDA 1XGWA 3UT4A 2H6FA 5JJ7A 2OV8A 3KDEC 3ZVVA 4U0UA 2MT5A 3LVQE 5FB0A 1BPOA 3M62A 3L13A 2MD8C 4ILIA 3MKQB 3I4RB 2PZIA 4ABNA 2P2CP 4YVQC 4AUQB 3Q7AA 4I9EA 2IQJA 3S7JA 3RRMB 1WG0A 3HVEB 3UM0A 4JHKA 4AY6A 5FWQA 3CVNA 2EGPA 3Q7FA 4GZCA 4U07A 3KNVA 4J7WA 3BG0B 3PZ1A 2UZGA 3HG0D 2JM3A 2IEJA 3PZ3A 2VJ8A 4QFVA 2LGKA 4NQ0A 5B1AE 4JXTA 4BT9A 2PQRA 5DBKA 3SHFA 3X2QE 3U3WA 1WEUA 4WNGA 3M99A 2WXMA 4PS3A 2KWJA 3JQ1A 1YMPA 3SZ7A 3W9GA 1KLXA 1FPPA 2DIWA 5CMYA 4DX1A 2QY7A 4HFGA 3EU5A 1XWHA 3UT8A 3FUHA 1TNUA 2WXRA 4G8KA 4C9BB 4YNDA 3GYZA 2V4LA 3CHOA 2VP7A 3KEZA 1SA4A 4DJAA 5LKUA 4LNUD 2F8XK 2I50A 4O1PA 4ZQLA 4IC2A 1RW2A 5JJ6A 3MV2B 4GYYA 3CVYA 1KZPA 3F6QA 4L1BA 3D3MA 5SVIB 4UUCA 3MYVA 2F0YA 3FTUA 4UWGA 4F52B 4CRWA 4GNEA 4URKA 5JHAA 5KWDA 2LGVA 5CRVA 4HOQA 4EBAA 3SNXA 5TRBA 3IBEA 4YC9A 1MQSA 2WB2A 2EGMA 3DPYA 1S63A 3ML9A 4DI3A 1TYQG 3ESKA 2RFMA 4BX9A 2KM4A 3L1ZB 3AG2E 3DEPA 4TUMA 2WM9A 2XB1A 3MKRA 3QNKA 4O1OA 3PURA 2X6FA 5I3LA 2H6GA 4OAUC 2PNXA 1OCZE 1Z5SC 3CKBA 4UP0A 4A4BA 3FH5A 1V55E 3FUFA 2XQ0A 3DSVA 3B95A 4R7LA 4A1SA 4L7XA 3PLWA 2GRRB 4LG6A 2ETCA 1DC2A 2LXLA 3CVLA 2VPBA 2FEZA 2RG8A 4XI1A 4GZ3A 4CCAA 2DZNA 1TNBA 4WWNA 1O1TA 4FU3A 2XGMA 4IULA 2Y3AA 3T5XA 2R59A 5A23A 4B0ZA 3NB2A 4K5CA 3C3QA 1FT1A 5DIZA 4P5OB 3SD5A 2YINA 3ZNGA 3ZPVE 3FFLA 4GTTA 2VNFA 4A3TA 3MV3B 4UWHA 3K9IA 2CHWA 3Q79A 4W9RA 3Q4AB 2GRLA 4ME2A 4G8LA 2KXPC 3EUVA 3RKVA 2FSAA 5FTPA 4Q69A 3IV0A 4JHJA 4JL0A 3I3NA 2LAHA 4WZ0A 2JMDA 3FTSA 3UI2A 3DWDA 2XOYA 4JC8A 2P9LG 5G04C 4WZ3B 2JLBA 3B7SA 3HTKC 4AV7A 4UI9J 4I7BA 3T8MA 2I9CA 2IY0C 4UWLA 2NSZA 3RPGC 4I7DA 3ESLA 3DSSA 3AJIA 2L80A 1OXJA 2DWZA 4EZJA 3N9QA 1MBMA 3JUIA 3QAQA 1LD7A 3HXCA 3L1XA 4LRZA 4GZ5A 5KJKA 4G25A 2VYIA 3AU4A 5B76A 3AAAC 5G05C 1EPUA 5ENQD 5LKZA 1H19A 2WQHA 1S70B 2ZETC 3G2WA 2VJFB 2NYJA 3E34A 1BORA 5LKTA 2XEHA 1X81A 1LF8A 3I4GA 1V87A 3D9PA 2G6QA 3KEAA 2QYJA 3CGHA 3V2XA 3SQVA 3TJPA 1Z3YA 2HYZA 3TWRA 2DJAA 4Z0OA 1YYHA 2YQMA 5JMND 2IF4A 2F37A 2VSNA 3PZ4A 4HORA 1WESA 4R7EA 2FO1E 1PY1A 1N54A 1IKND 3FTXA 4CDMA 4P29A 2BEDA 4RG6A 2KWOA 4HS2A 1FCHA 3EHNA 3Q47B 1E90A 3L22A 5AQAA 1Q2ZA 2WXHA 1K3ZD 2EILE 4R8PK 3HHMA 4X8QA 2YUCA 5FJYA 2VJEA 4GTVA 4F1SA 4LK9A 2R2LA 5FQ7A 1N52A 3CHPA 1LTXA 3ZN3A 5FQ4A 5LCWC 3KD7A 4HLLA 3E37A 4QF3A 2LAIA 3L08A 4WNEA 2ETBA 4B93B 1D8EA 3D9JA 4FJYA 1JCSA 2AJAA 3SOXA 3M7KA 3T7LA 4AY5A 3HXBA 4APFA 4N3CA 2EODA 5T3RA 1SW6A 1QYMA 5FQ6A 3CVPA 2P9IG 2ONDA 2XEVA 4HLEA 1A17A 2F42A 3HXEA 3HXDA 3UM2A 2UWJG 3DXMG 2JMJA 5JG6A 3EU9A 5CBNA 2XP0A 3CK7A 1JOCA 2L43A 5LOZA 3MDBC 2LUHA 3ASLA 1CHCA 2QC9A 4ATZD 1FVHA 2BTDA 4LJNA 5EYLA 3AS5A 1VD4A 4BWRA 2M63A 4H7YA 3FM8C 3LRQA 4GZDA 3ZPV1 3VLEA 1N11A 2KWNA 1TJFA 4OVVA 1B89A 5AIUA 4MS6A 1N4SA 4I1MA 4JHRA 4Z0RA 4GU5A 5BT1A 3U4TA 3O70A 4EZLA 4OGCA 3PEVB 3PZ2A 4YBMA 3CV0A 3ZPJA 3O48A 4H9DA 3SBSA 1N9AA 3L6AA 4CA1A 4XKCA 2UY1A 2M1RA 2DZOA 4N5CA 2LRIC 2R05A 4M3OA 3RAUA 2ECGA 3C3RA 2MA5A 5D2MC 2YSJA 1HU3A 5HKPA 1U3DA 2KR4A 2E61A 3WG7E 3LEWA 3QJZA 1VYXA 3CVVA 2MRIA 4ATGA 1FT2A 3L17A 1WEPA 2JABA 1HXIA 2LN0A 1UG3A 2WXLA 2GRQB 2HR2A 2KCKA 4HRLA 4C48B 2LO6A 1OT8A 2V8SE 3LCAA 3C3OA 3FU5A 4LCTA 1LD8A 1U2VG 3G2TA 3UKUG 4J8YA 3PREA 2OCCE 3I2DA 3J5QB 4RQIA 3FEXA 1O1SA 2LV9A 2K1JA 3PZDA 5B8DA 5H7PA 2XEEA 1H6KA 2K16A 3PNTB 3LY7A 1WEWA 1H6PA 4DX5D 5G0FA 3MHHA 3ASOE 2BAYA 2OXQC 4GZ6A 4ILGA 2WXIA 5KJLA 1N95A 5B75A 4N2QA 3CHSA 4B8AA 4AVXA 3ZRHA 3G2UA 4B94A 1KT1A 1WIMA 2KBXA 3ZNIA 1YA0A 3T5VA 5ENPD 4E6HA 4N5QA 5BW8C 4ACKA 4L7TA 3RJVA 4GA1A 2F6NA 2V4HC 3B7BA 3C72A 2P58C 4JVSA 3NOCD 1RMDA 2LDRA 4I6EA 4N3WA 3R7QA 3IKOB 1H0AA 2P9UG 2J4DA 2YT5A 5LCWJ 1E8WA 5KH9A 2BF0X 2FD4A 2XS1A 4ANVA 3FHEA 3C98A 2V5FA 5B3SE 3SF4A 4JB8P 1SVXA 5C1DA 3ZKJA 3ML8A 2QIZA 3N9MA 4L2LA 3D9IA 4CT4A 5H9MA 1WGMA 1HE8A 1Y6IA 3ENEA 1HO8A 3FU3A 4A3VA 4N3BA 4PS7A 1BLXB 1Z2QA 4WNFA 3BG1B 2ECIA 3ONLA 3BEEA 1F62A 3QZVA 4UI9C 3CQCB 5C13A 4F3VA 4FP7A 1JM7A 5BV1A 2MHKA 1QBQA 1E96B 5FZSA 1KT0A 3JXIA 4DLOA 5BPPA 3CHMA 4N3AA 1OWLA 1Z6UA 1ZBPA 2VJEB 3UPVA 3LJ3A 5CHEE 4QQIA 4HBDA 2MNZA 2CFUA 3ZHEA 2VPGA 4N2SA 3JCKC 3KSLA 3DWLG 3FTVA 5B78A 2QZAA 1TN7A 2BUGA 2JMIA 3RK6A 4YABA 2I1KA 1MX4A 2WMNA 2Y69E 4UQZA 5ENOD 3C5RA 4J8EA 3V31A 3LJNA 5ENNA 4FA6A 4H7XA 4KYOB 1SZ9A 2AVPA 3DSUA 4BY6A 2I2OA 3MGBA 2WXKA 3U64A 3ZYKA 4KBQA 5KCMA 1INZA 3TGOA 3ZXSA 2CG3A 5D0QD 5HS0A 3Q49B 2YURA 4CDNA 5G04B 1TNYA 4UWFA 2YSMA 5CMWA 3FP3A 2XPZA 2PM6A 4HXIA 4AM9A 1WE9A 4MBGA 2Y1MA 4I9CA 3ASDA 4BTBA 5KH7A 2WXPA 2ECNA 3RPGB 4Q94A 2LXPC 3BUAA 3V30A 2VSOE 3CVQA 4TXRA 2J49A 4Z68A 3Q75A 3UINC 2PUYA 2WVIA 2UY1B 2M13A 2P9KG 3EDTB 4J8DA 4WUYA 2FBNA 2KYUA 2G43A 3TWXA 5ANLA 4NN2A 3RU0A 2GRMA 1HYIA 5G05B 4BSXA 4RSYA 2EA6A 4G23A 2KCVA 2G45A 3SFXA 5KNGA 4GTRA 3E30A 2LGLA 1LDKC 4XX5A 2KKXA 3CK8A 2J09A 1YCSB 4K0RA 5BXUA 4QF2A 5LKXA 5J08A 2WXNA 4DX6D 2L6BA 4MSXA 4IN3B 1OY3D 3O33A 3KSQA 4N39A 3AG4E 3HXFA 2MIQA 2FO7A 4WZ2A 2R5SA 3Q5MA 3CSFA 2EXUA 4FIPA 4CZ2D 1IYMA 3MA5A 4AJWA 4NIKA 3U66A 3PUQA 4TXPA 4DUIA 3APDA 2ETAA 3FWVA 4UI9K 3S2AA 4UP5A 3MHSA 4RVBA 2AWIA 1IHBA 2VTBA 4WNDA 1WY6A 5AJDA 1Z60A 4A49A 4AIFA 3JXJA 1N4QA 2CG2A 4R2YA 3CK9A 4KMOA 2C0LA 3LJUX 1Z3XA 4U7EB 2XPIA 4TV3A 2XZTG 3O7AA 3KQIA 5EDSA 1BU9A 1NZNA 1PC2A 5LCWB 2RD0A 3LDYA 3IHYA 2PM7A 2CSVA 3D9MA 2MOWA 3R9MA 5K3QA 2ZU6B 4B7YC 4G2VA 4KZCA 3NBNB 2KKYA 3EHMA 4YDYA 2CKLA 5BUZA 3QARA 3TWQA 4XZ4A 3DXKG 3JYSA 3DBSA 2P57A 5CRUA 2FI7A 2L75A 2YVRA 3CEQA 3UUXA 1HFAA 4NRHB 2VPEA 1WM5A 3S7DA 3UM1A 3CKCA 4J6IA 4B89A 3MX3A 2H0DA 5ENSD 4LKAA 2J07A 2J4BA 4LERA 1WFKA 2EQXA 1UN8A 5BNWA 3IEGA 3LKUA 1WEOA 4GCNA 1WILA 5C2YA 4LNGA 4CCGX 3ZUVB 3DQVR 4GMJA 5EX3A 2AXVA 2GGFA 3SOWA 4JZYA 3HIZA 2X6IA 3PEUB 3HCUA 4ZHBA 5AENA 5TDRA 5KH3A 3ZTGA 1JM7B 2FF4A 5FB1A 2L0TB 5FQ8A 3SFZA 3Q1DA 1OCOE 3Q9NC 1UN9A 5LP0A 3FEYA 4YBTA 4FK5A 2IO3C 1DCEA 3NF1A 4UQYA 3SGHA 2HDPA 3BU8A 5D66A 1JUQA 2JEKA 4GTOA 4KVOA 4A4CA 5AQ9A 2M3HA 3E2DA 2ZISA 3ZHEB 2LGGA 4MKTA 1UOHA 1QQEA 4TKPB 2NXPA 5JHBA 4CT0A 4F53A 2YQ8A 3Q9UC 3H7HA 4JA7A 1O5MA 3OXGA 2D8UA 5ENRD 4GMLA 4G11A 3Q15A 2EIKE 2YHEA 4ACLA 3U5OA 1SZAA 4L58A 2CSZA 1IQRA 3FUDA 3NZSA 4IYPA 4V3KC 4B86C 2QJ0A 4BT8A 2XEUA 4FULA 1D9SA 1L5JA 2H6HA 4BSZB 4TUUA 3CVWA 3OXFA 1O1RA 3T8KA 2BKKB 1HS6A 5AAOA 1HF8A 1PAQA 2IO2C 4FO9A 3D9LA 4GNDA 3MEKA 4G1TA 3J5PA 2KWKA 4LLBA 1MM3A 2A4ZA 2QICA 4AYCA 2RFAA 4L23A 5CERB 4V3IA 4DLQA 2AW6A 3ZVZB 3FUMA 3QWPA 2ILRA 1EF1C 1HZ4A 3LDZA 3RSEG 5JJTA 2DYRE 1G25A 3V79K 2V0PA 1K1BA 1BD8A 2E2EA 2PL2A 1TNOA 4LSZE 1JWFA 4K5BA 3MCXA 1D8DA 3R9AB 3PS6A 3GV4A 3TWTA 1OCRE 3CIAA 3UTMA 1X5BA 5CBOA 2NC9A 2X6HA 4FC8A 2CFZA 4A0CD 5D1MB 4HOTA 3FY4A 3NG2A 4S3OC 4WWOA 2Y1LE 4ANXA 3KV6A 2L7PA 2XGOA 3ULQA 3FAOA 2FFWA 1QZ2A 5D0OD 3FUIA 4E85A 3I5PA 2X6KA 3FH8A 1RZ4A 2PQNA 5T8IA 4BEPA 1A5EA 2LXMA 3UMVA 3HRAA 2X6JA 4LEUA 3ULEG 4MRUA 1TR4A 2P9SG 3CLJA 1WAO1 3N9PA 5DKAA 3EHRA 4YDEA 4BETA 3JUEA 2KIZA 4I43A 2R02A 3IHVA 2RR4A 2XPYA 2IJGX 3QDNA 3FANA 3N9LA 3O36A 3PUJA 5AQ7A 2ECVA 5FT9A 3HDXA 5EKQD 3LY9A 4UI9B 2WXJA 1NA3A 1XNFA 3PVLA 3TWWA 2I1JA 2XGSA 5ARFA 4OAVB 3SO8A 4I1AA 3LQJA 1WEVA 2VTBB 1MJ0A 1E7UA 3LQHA 3ULYA 1MX6A 4XEIG 3ABLE 1HH8A 2XZDG 4CEMA 3HCTA 4GB9A 3RO3A 2CRRA 4K5AB 1VFYA 3EJNA 4UQXA 3GZ1A 4GTSA 1SQMA 3L16A 3CVUA 2LSUA 5CEAA 3UKRG 2HM8A 3TWVA 3RO2A 2YU4A 4RLYA 2F8YA 3FH7A 2KREA 2V5QC 4I6JA 2RSDA 2CKLB 3B7RL 1U6GB 4LADB 2CT2A 4ZUXU 4JD2G 5BXOA 2L0BA 2VGEA 5AIJA 5ENTD 5A6CA 3D9NA 3UX4A 5CCMA 3U9WA
chains in the Genus database with same CATH topology
3ASGA 2M6MA 4D10C 2Q7FA 2H0DB 2XCBA 3SOUA 4PDXA 1JWGA 4PUCA 1EDUA 4YVOA 3S7BA 1HG2A 4JW1A 3LVRE 4Q96A 2IU1A 2XCCA 2VGYA 1IQUA 3ZIMA 2YW8A 4I6GA 3GW4A 1ZBDB 2KGIA 4FADA 4AEZC 3KV5A 4WWPA 3GZ2A 5EYAF 2QFCA 2KGGA 3SBTB 3U5NA 1Y8MA 1E8XA 2L6JA 2X38A 1UW4B 1QNFA 3O34A 5FZRA 2K4DA 1ELRA 2A5UA 2L0IA 4O64A 2RI7A 2FULA 4ZDTA 4GPKA 2WMOA 4L2YA 4FHJA 3AS8A 5KJNA 3V43A 4EZKA 3GZSA 5H1VA 2KZTA 3QC1A 3OXLA 3E4BA 1EYHA 4EPZA 5AJLA 4GA0A 3VLFA 1N87A 2KU3A 3CSTA 4X3GA 3PRZA 4G26A 3RIBA 4JA9A 1E8ZA 4AYCB 1P5QA 2J9QA 1JPLA 3N9OA 3P1UA 3TXNA 2C2VS 2E6SA 2VSYA 4AP4A 4XE0A 4GB0A 2MA6A 2YREA 3APCA 2LSVA 1OUVA 1K2FA 4AOFA 3LY8A 3LS8A 3T6RA 4XIFA 3TAXA 2AN6A 2YNQA 5H1TA 2KCLA 4A55A 4W4UA 3CHQA 3KS2A 5G55A 2L5UA 4FLHA 3EB5A 3B13A 3ZFWA 3UQ3A 3QK0A 5ANRA 4O6FA 1X4UA 4MLPA 2KC7A 1MHQA 4N4FA 3VTXA 3L54A 3DPLR 4LUNU 3C5KA 3NZUA 3G2VA 5J90A 4K03A 2OVFA 3P2BA 4CGWA 3FDHA 1T1HA 2KE1A 2IQCA 4V3LC 2FUUA 2KATA 4AXHA 4G24A 4JEHA 4KXKB 4I1OB 2C2LA 2I6HA 2YHNA 3AS4A 2ECWA 3ZYLA 3QWVA 3C6WA 1X4IA 2IOSA 3SI5A 3LQIA 3QKYA 3ZYQA 4GYWA 2DBAA 2XHEA 2DX8A 2OVBA 2OOEA 4DPRA 4PH4B 4HVBA 4ILHB 4I17A 4EBAG 5EX0A 4F7AA 2AXZA 4C0MA 1H2VC 2YHOA 4MVTA 3SHBA 2WXFA 5A7DB 3KAEA 5G2NA 3QOUA 2WQ7A 2X3MA 2MUMA 1GW6A 3QWWA 1HG5A 1WEQA 4GCOA 4U0ZA 4IRUA 5J3XA 4U63A 1UJJA 1Z6TA 2WXGA 3APFA 4I2ZA 3VK6A 3QB2A 2Y4UA 3OAWA 5TDWA 5ARGA 3IHPA 3N9NA 2VSXE 4WAFA 3DPDA 3R7RA 4U0SA 4BFRA 5CCLA 3EB6A 3LYAA 1NA0A 4C9ZA 3TL5A 4Y6CA 1OWPA 3RTRB 2KFTA 4FLBA 4KZ0A 5AITA 4BX8A 4YBSA 5T4YA 3FTWA 5TABA 2VGXA 4C0EA 2WXOA 3OTNA 1E8YA 4FHKA 4FJCA 3ASFA 3FUKA 2E6RA 3HYMB 3PDNA 3PE3A 2LQ6A 3O4ZA 2YQLA 4BTAA 5E75A 4ANWA 3TG5A 4U8HA 4OVUA 2Y4TA 4GA2A 5C11A 4APOA 4A1GA 4WA6A 2AXUA 3ZW3A 4GYOA 3FUJA 4GNGA 4S3OB 3G2SA 3B7TA 3RRUA 4Y6WA 1LDJB 4PTBA 4DK5A 1WEMA 2KZTB 1FBVA 3PE4A 3FUNA 1TJCA 2XRYA 3FTYA 5FERA 2L9BA 3CVXA 3FU0A 2WQ6A 3CR3A 3MKQA 3FU6A 4J8SA 5BV0A 2HYED 5D1LB 2CHZA 2LXHC 3HVEA 5FEYA 3S7FA 4UWKA 1W3BA 1ELKA 1HX8A 5AYWD 4IC3A 1OWNA 5HQ8A 4KT6B 3ZYMA 3N71A 1OWOA 4JPSA 1DNPA 4AP2A 3FULA 4PPEA 3MJWA 2E0IA 4EECA 3ASHA 1WENA 4CGVA 1U3CA 4J0UA 2IFUA 1OWMA 4NURA 2JRJA 3URZA 3EIQC 3PNLB 4PS8A 2FUIA 4KVMA 4CDRA 4BHWA 5HI7A 1FVFA 3FUEA 5FZQA 1E4UA 3CQGB 2VQ2A 3AU5A 1DVPA 3GL6A 3ZVYA 4RG9A 4NACA 5G04J 3TG4A 3HCSA 4GNFA 2MD7B 5KJMA 2VPDA 4YADA 4DI4A 2F6JA 4XI0A 1H2UA 4HOUA 1HYJA 1S0PA 2C0MA 3U5MA 4Q6FA 2R17C 5D1KB 3B7UX 4EQFA 2WXQA 1MM2A 5H1UA 3FTZA 3PUKA 4B8CB 1WEEA 3FL2A 1NP7A 5LX8A 2MNYA 4YATA 3M63A 4JEUA 2GW1A 5B79A 5G05J 3O37A 3PH0C 1TEZA 4HOSA 4TRQA 3D9OA 3O35A 3TXMA 4XKBA 5B77A 2Y1NA 2WPVA 3CHRA 3EIJA 4YAXA 3JQ0A 2K17A 3VLDA 5DINA 2J08A 4U04A 2LNIA 1E7VA 3MZLB 2DCPA 2ECJA 3RRNB 2XRZA 3LXUX 3UT7A 2HO1A 4J8FA 2IDAA 1UJKA 2D8SA 5M72A 3L11A 1VDYA 4BBQA 2Y43A 5LFAA 4I2WA 4GAAA 2YHCA 3NQPA 5E76A 1ZU2A 3WXXA 5TBNA 1FP0A 1IHGA 2CHXA 4I7CA 2VGXB 4FJZA 2YYRA 1H2TC 4OYSA 1X4JA 2IOLA 3LPZA 2ECTA 3ZGQA 4ANUA 3VTYA 3ONKA 3D9KA 2VJFA 3U5PA 2CSYA 1IYGA 4XI9A 2M85A 1ELWA 2NAAA 2IONA 3ZEFA 3PHDA 1XGWA 3UT4A 5JJ7A 2OV8A 3ZVVA 4U0UA 2MT5A 3LVQE 5FB0A 1BPOA 3M62A 3L13A 2MD8C 4ILIA 3MKQB 3I4RB 2PZIA 4ABNA 4YVQC 4AUQB 4I9EA 3S7JA 3RRMB 3HVEB 4JHKA 4AY6A 5FWQA 3CVNA 2EGPA 4GZCA 4U07A 3KNVA 3BG0B 2UZGA 2VJ8A 4QFVA 2LGKA 4NQ0A 4JXTA 4BT9A 2PQRA 5DBKA 3SHFA 3U3WA 1WEUA 4WNGA 3M99A 2WXMA 4PS3A 2KWJA 3JQ1A 3SZ7A 1KLXA 2DIWA 5CMYA 2QY7A 4HFGA 1XWHA 3UT8A 3FUHA 2WXRA 4C9BB 4YNDA 3GYZA 2V4LA 3CHOA 2VP7A 3KEZA 4DJAA 5LKUA 2I50A 4ZQLA 4IC2A 5JJ6A 3MV2B 4GYYA 3CVYA 4L1BA 3D3MA 3MYVA 3FTUA 4UWGA 4F52B 4CRWA 4GNEA 4URKA 5JHAA 2LGVA 4HOQA 4EBAA 3SNXA 5TRBA 3IBEA 4YC9A 1MQSA 2WB2A 3ML9A 4DI3A 3ESKA 4BX9A 2KM4A 3L1ZB 2WM9A 2XB1A 3MKRA 3QNKA 3PURA 2X6FA 5I3LA 2PNXA 3CKBA 4UP0A 4A4BA 3FH5A 3FUFA 2XQ0A 4R7LA 4A1SA 4L7XA 3CVLA 2VPBA 2FEZA 2RG8A 4XI1A 4GZ3A 4CCAA 4WWNA 4FU3A 2XGMA 4IULA 2Y3AA 3T5XA 2R59A 5A23A 4B0ZA 5DIZA 4P5OB 3SD5A 2YINA 3ZPVE 3FFLA 2VNFA 4A3TA 3MV3B 4UWHA 3K9IA 2CHWA 4W9RA 3Q4AB 2GRLA 4ME2A 3RKVA 2FSAA 5FTPA 4Q69A 3IV0A 4JHJA 4JL0A 3I3NA 2LAHA 4WZ0A 2JMDA 3FTSA 4JC8A 5G04C 4WZ3B 2JLBA 3B7SA 3HTKC 4AV7A 4UI9J 4I7BA 3T8MA 2I9CA 4UWLA 2NSZA 3RPGC 4I7DA 3ESLA 2L80A 4EZJA 3N9QA 3JUIA 3QAQA 3L1XA 4LRZA 4GZ5A 5KJKA 4G25A 2VYIA 3AU4A 5B76A 5G05C 1EPUA 5LKZA 1H19A 2WQHA 2ZETC 3G2WA 2VJFB 1BORA 5LKTA 1LF8A 3I4GA 1V87A 3D9PA 2G6QA 3CGHA 3TJPA 1Z3YA 2HYZA 2YQMA 2IF4A 2VSNA 4HORA 1WESA 4R7EA 1PY1A 1N54A 3FTXA 4CDMA 4P29A 4RG6A 2KWOA 4HS2A 1FCHA 3EHNA 3Q47B 1E90A 3L22A 2WXHA 4R8PK 3HHMA 2YUCA 5FJYA 2VJEA 4F1SA 4LK9A 5FQ7A 1N52A 3CHPA 3ZN3A 5FQ4A 5LCWC 3KD7A 4QF3A 2LAIA 3L08A 4WNEA 3D9JA 4FJYA 3SOXA 3T7LA 4AY5A 4APFA 4N3CA 2EODA 5T3RA 5FQ6A 3CVPA 2ONDA 2XEVA 4HLEA 1A17A 2F42A 2UWJG 2JMJA 5JG6A 3CK7A 1JOCA 2L43A 5LOZA 3ASLA 1CHCA 1FVHA 2BTDA 4LJNA 3AS5A 1VD4A 4BWRA 2M63A 4H7YA 3LRQA 4GZDA 3ZPV1 3VLEA 2KWNA 1TJFA 4OVVA 1B89A 5AIUA 4MS6A 4I1MA 4JHRA 4GU5A 5BT1A 3U4TA 3O70A 4EZLA 3PEVB 4YBMA 3CV0A 3ZPJA 3O48A 3SBSA 3L6AA 4CA1A 4XKCA 2UY1A 2M1RA 4N5CA 2LRIC 4M3OA 2ECGA 2MA5A 2YSJA 1HU3A 1U3DA 2KR4A 3LEWA 3QJZA 1VYXA 3CVVA 2MRIA 4ATGA 3L17A 1WEPA 1HXIA 2LN0A 1UG3A 2WXLA 2HR2A 2KCKA 2LO6A 2V8SE 3LCAA 3FU5A 4LCTA 3G2TA 3PREA 3I2DA 3FEXA 2LV9A 2K1JA 3PZDA 5B8DA 1H6KA 2K16A 3PNTB 3LY7A 1WEWA 5G0FA 3MHHA 2BAYA 2OXQC 4GZ6A 4ILGA 2WXIA 5KJLA 5B75A 4N2QA 3CHSA 4B8AA 4AVXA 3ZRHA 3G2UA 4B94A 1KT1A 1WIMA 3ZNIA 1YA0A 3T5VA 4E6HA 5BW8C 4ACKA 4L7TA 3RJVA 4GA1A 2F6NA 2P58C 4JVSA 1RMDA 2LDRA 4I6EA 4N3WA 3R7QA 3IKOB 1H0AA 2J4DA 2YT5A 5LCWJ 1E8WA 5KH9A 2BF0X 4ANVA 3FHEA 3C98A 2V5FA 3SF4A 5C1DA 3ML8A 2QIZA 3N9MA 4L2LA 3D9IA 4CT4A 5H9MA 1WGMA 1HE8A 1Y6IA 3ENEA 1HO8A 3FU3A 4A3VA 4N3BA 4PS7A 1Z2QA 4WNFA 3BG1B 2ECIA 3ONLA 3BEEA 1F62A 3QZVA 4UI9C 3CQCB 5C13A 4F3VA 4FP7A 1JM7A 5BV1A 2MHKA 1E96B 5FZSA 1KT0A 4DLOA 5BPPA 3CHMA 4N3AA 1OWLA 1Z6UA 1ZBPA 2VJEB 3UPVA 3LJ3A 5CHEE 2MNZA 2CFUA 3ZHEA 2VPGA 4N2SA 3JCKC 3FTVA 5B78A 2BUGA 2JMIA 3RK6A 4YABA 2I1KA 2WMNA 4UQZA 4J8EA 5ENNA 4FA6A 4H7XA 4KYOB 1SZ9A 2AVPA 4BY6A 2I2OA 3MGBA 2WXKA 3U64A 3ZYKA 4KBQA 5KCMA 1INZA 3TGOA 3ZXSA 2CG3A 5D0QD 3Q49B 2YURA 4CDNA 5G04B 4UWFA 2YSMA 5CMWA 3FP3A 2XPZA 2PM6A 4HXIA 4AM9A 1WE9A 2Y1MA 4I9CA 3ASDA 4BTBA 5KH7A 2WXPA 2ECNA 3RPGB 4Q94A 2LXPC 2VSOE 3CVQA 2J49A 2PUYA 2WVIA 2UY1B 3EDTB 4J8DA 4WUYA 2FBNA 2KYUA 2G43A 5ANLA 4NN2A 3RU0A 2GRMA 1HYIA 5G05B 4BSXA 4RSYA 2EA6A 4G23A 2KCVA 2G45A 2LGLA 1LDKC 4XX5A 3CK8A 2J09A 4K0RA 4QF2A 5LKXA 5J08A 2WXNA 4MSXA 4IN3B 3O33A 4N39A 2MIQA 2FO7A 4WZ2A 2R5SA 3Q5MA 3CSFA 4FIPA 1IYMA 3MA5A 4AJWA 3U66A 3PUQA 3APDA 3FWVA 4UI9K 3S2AA 4UP5A 3MHSA 4RVBA 2AWIA 2VTBA 4WNDA 1WY6A 5AJDA 1Z60A 4A49A 4AIFA 2CG2A 4R2YA 3CK9A 4KMOA 2C0LA 1Z3XA 2XPIA 4TV3A 3O7AA 3KQIA 5EDSA 1NZNA 1PC2A 5LCWB 2RD0A 3IHYA 2PM7A 3D9MA 2MOWA 2ZU6B 4B7YC 4G2VA 4KZCA 3EHMA 2CKLA 5BUZA 3QARA 4XZ4A 3JYSA 3DBSA 2FI7A 2L75A 3CEQA 3UUXA 1HFAA 4NRHB 2VPEA 1WM5A 3S7DA 3CKCA 4J6IA 4B89A 3MX3A 2H0DA 4LKAA 2J07A 2J4BA 4LERA 1WFKA 2EQXA 1UN8A 5BNWA 3IEGA 3LKUA 1WEOA 4GCNA 1WILA 5C2YA 4CCGX 3DQVR 4GMJA 5EX3A 2AXVA 2GGFA 3SOWA 4JZYA 3HIZA 2X6IA 3PEUB 3HCUA 5AENA 5TDRA 5KH3A 3ZTGA 1JM7B 2FF4A 5FB1A 2L0TB 5FQ8A 3SFZA 1UN9A 5LP0A 3FEYA 4YBTA 4FK5A 3NF1A 4UQYA 3SGHA 2HDPA 1JUQA 2JEKA 4KVOA 4A4CA 2M3HA 3ZHEB 2LGGA 4MKTA 1QQEA 4TKPB 2NXPA 5JHBA 4CT0A 4F53A 2YQ8A 4JA7A 3OXGA 4GMLA 4G11A 3Q15A 2YHEA 4ACLA 3U5OA 1SZAA 4L58A 2CSZA 1IQRA 3FUDA 3NZSA 4IYPA 4V3KC 4B86C 2QJ0A 4BT8A 2XEUA 4FULA 1L5JA 4TUUA 3CVWA 3OXFA 1HS6A 1HF8A 1PAQA 4FO9A 3D9LA 4GNDA 3MEKA 4G1TA 2KWKA 4LLBA 1MM3A 2A4ZA 2QICA 4AYCA 4L23A 4V3IA 4DLQA 2AW6A 3ZVZB 3FUMA 3QWPA 2ILRA 1EF1C 1HZ4A 3LDZA 5JJTA 1G25A 2V0PA 2E2EA 2PL2A 1JWFA 3MCXA 3R9AB 3PS6A 3GV4A 3CIAA 1X5BA 2NC9A 2X6HA 4FC8A 2CFZA 4A0CD 5D1MB 4HOTA 3FY4A 3NG2A 4S3OC 4WWOA 3KV6A 4ANXA 2XGOA 3ULQA 1QZ2A 5D0OD 3FUIA 4E85A 3I5PA 2X6KA 3FH8A 2PQNA 5T8IA 3UMVA 2X6JA 4LEUA 4MRUA 3CLJA 1WAO1 3N9PA 5DKAA 2KIZA 4I43A 3IHVA 2XPYA 2IJGX 3QDNA 3N9LA 3O36A 3PUJA 2ECVA 5FT9A 3HDXA 5EKQD 3LY9A 4UI9B 2WXJA 1NA3A 1XNFA 3PVLA 2XGSA 2I1JA 5ARFA 4I1AA 3LQJA 1WEVA 2VTBB 1E7UA 3LQHA 1HH8A 4CEMA 3HCTA 4GB9A 3RO3A 1VFYA 3EJNA 4UQXA 3GZ1A 1SQMA 3L16A 3CVUA 2LSUA 2HM8A 3RO2A 2YU4A 3FH7A 2KREA 4I6JA 2RSDA 2CKLB 3B7RL 1U6GB 4LADB 2CT2A 4ZUXU 2L0BA 5AIJA 5A6CA 3D9NA 3UX4A 5CCMA 3U9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUR A;  1WEN A;  3N9Q A;  2JRJ A;  2M6M A;  3L1X A;  5G04 B;  2H0D B;  3SOU A;  1JWG A;  2YSM A;  5CMW A;  2FUI A;  1EDU A;  1HG2 A;  5B76 A;  4BHW A;  4Q96 A;  1WE9 A;  5LKZ A;  2Y1M A;  5KH7 A;  1E4U A;  2ECN A;  3RPG B;  4Q94 A;  2LXP C;  2ZET C;  1DVP A;  3G2W A;  2VJF B;  2YW8 A;  3GL6 A;  1BOR A;  5LKT A;  3ZVY A;  2PUY A;  1LF8 A;  1ZBD B;  2KGI A;  1V87 A;  3D9P A;  2G6Q A;  3KV5 A;  4NAC A;  2KYU A;  2G43 A;  5EYA F;  3HCS A;  4NN2 A;  4GNF A;  2MD7 B;  1HYI A;  5G05 B;  2KGG A;  2VPD A;  4YAD A;  3U5N A;  2YQM A;  2F6J A;  2EA6 A;  3O34 A;  2K4D A;  1HYJ A;  2G45 A;  3U5M A;  2L0I A;  4Q6F A;  4O64 A;  5D1K B;  2RI7 A;  1WES A;  2LGL A;  1LDK C;  4R7E A;  4ZDT A;  1PY1 A;  1MM2 A;  5H1U A;  4QF2 A;  5LKX A;  1WEE A;  3FL2 A;  5J08 A;  3V43 A;  2MNY A;  4YAT A;  2KWO A;  3M63 A;  4MSX A;  5B79 A;  5H1V A;  3O33 A;  4R8P K;  1EYH A;  2MIQ A;  2YUC A;  3O37 A;  4WZ2 A;  4FIP A;  1IYM A;  2VJE A;  4LK9 A;  3PUQ A;  1N87 A;  2KU3 A;  4QF3 A;  4X3G A;  3D9O A;  3O35 A;  4UP5 A;  4AYC B;  3MHS A;  5B77 A;  1JPL A;  3N9O A;  2Y1N A;  2C2V S;  2E6S A;  4AP4 A;  3D9J A;  1Z60 A;  2MA6 A;  4GB0 A;  4YAX A;  4A49 A;  2YRE A;  1K2F A;  2K17 A;  4R2Y A;  5DIN A;  3SOX A;  3T6R A;  2AN6 A;  3O7A A;  3T7L A;  3KQI A;  2DCP A;  2ECJ A;  5LCW B;  2EOD A;  3D9M A;  2MOW A;  5H1T A;  2IDA A;  4B7Y C;  1UJK A;  2D8S A;  4W4U A;  3L11 A;  1VDY A;  4BBQ A;  2F42 A;  2Y43 A;  2CKL A;  2L5U A;  3EB5 A;  2JMJ A;  5TBN A;  5JG6 A;  1FP0 A;  1X4U A;  4I7C A;  1JOC A;  2L43 A;  5LOZ A;  2L75 A;  3ASL A;  1CHC A;  1HFA A;  2VPE A;  2YYR A;  1MHQ A;  4LJN A;  2H0D A;  4LKA A;  4N4F A;  1VD4 A;  1WFK A;  3DPL R;  3LRQ A;  4GZD A;  1WEO A;  3ZPV 1;  1X4J A;  1WIL A;  2KWN A;  3C5K A;  3G2V A;  5AIU A;  4CCG X;  2ECT A;  3DQV R;  3ONK A;  3D9K A;  2VJF A;  3O70 A;  3SOW A;  4YBM A;  3U5P A;  2CSY A;  1T1H A;  2KE1 A;  4CA1 A;  3HCU A;  2M85 A;  2M1R A;  5TDR A;  4V3L C;  2FUU A;  5KH3 A;  3ZTG A;  1JM7 B;  2NAA A;  3PHD A;  5FB1 A;  2LRI C;  2L0T B;  1XGW A;  5LP0 A;  2ECG A;  2C2L A;  2MA5 A;  2MT5 A;  2YHN A;  2YSJ A;  5FB0 A;  4YBT A;  4FK5 A;  2KR4 A;  2HDP A;  3M62 A;  2ECW A;  1VYX A;  3ZYL A;  2MD8 C;  1JUQ A;  3C6W A;  1X4I A;  2M3H A;  4A4C A;  1WEP A;  2LN0 A;  3LQI A;  2LGG A;  4AUQ B;  4TKP B;  3ZYQ A;  2LO6 A;  2V8S E;  2EGP A;  3G2T A;  2DX8 A;  4GZC A;  3U5O A;  1SZA A;  4L58 A;  3KNV A;  2CSZ A;  3I2D A;  2UZG A;  4V3K C;  4B86 C;  2LV9 A;  2QJ0 A;  2LGK A;  2K1J A;  5B8D A;  2XEU A;  4JXT A;  2K16 A;  1WEW A;  1WEU A;  3M99 A;  5G0F A;  2KWJ A;  3MHH A;  2BAY A;  2OXQ C;  2YHO A;  1HF8 A;  4FO9 A;  4MVT A;  3SHB A;  3D9L A;  4GND A;  2DIW A;  5CMY A;  2QY7 A;  4HFG A;  2KWK A;  4LLB A;  2MUM A;  5B75 A;  1XWH A;  1MM3 A;  2QIC A;  4AYC A;  4AVX A;  1HG5 A;  3G2U A;  1WEQ A;  5J3X A;  1UJJ A;  1WIM A;  3ZVZ B;  3ZNI A;  3LDZ A;  3VK6 A;  1G25 A;  2VP7 A;  5LKU A;  2I50 A;  5TDW A;  3IHP A;  4ZQL A;  4IC2 A;  2F6N A;  3N9N A;  1JWF A;  1RMD A;  2LDR A;  3EB6 A;  4N3W A;  4F52 B;  4GNE A;  3GV4 A;  1H0A A;  4C9Z A;  2LGV A;  2YT5 A;  5KH9 A;  5TRB A;  2BF0 X;  3RTR B;  2KFT A;  1X5B A;  4YC9 A;  4FLB A;  5AIT A;  4YBS A;  4A0C D;  5TAB A;  5D1M B;  2KM4 A;  3L1Z B;  3NG2 A;  4S3O C;  2XB1 A;  4FJC A;  3KV6 A;  3PUR A;  2E6R A;  2QIZ A;  3N9M A;  3D9I A;  5H9M A;  5I3L A;  1WGM A;  2PNX A;  2LQ6 A;  2YQL A;  4UP0 A;  4A4B A;  4L7X A;  1Z2Q A;  5C11 A;  2ECI A;  3ONL A;  4WA6 A;  2VPB A;  1F62 A;  3QZV A;  3CLJ A;  4XI1 A;  5C13 A;  4GNG A;  4S3O B;  3G2S A;  3RRU A;  3N9P A;  5DKA A;  1JM7 A;  4FU3 A;  1LDJ B;  4PTB A;  1WEM A;  1FBV A;  2KIZ A;  5FER A;  1Z6U A;  2VJE B;  3N9L A;  3O36 A;  4P5O B;  2ECV A;  3ZPV E;  2MNZ A;  2VNF A;  2VPG A;  2HYE D;  5D1L B;  4UI9 B;  2LXH C;  3LQJ A;  1WEV A;  5B78 A;  3LQH A;  2FSA A;  2JMI A;  5FEY A;  4YAB A;  3HCT A;  4WZ0 A;  2JMD A;  1VFY A;  1ELK A;  1SZ9 A;  4WZ3 B;  1HX8 A;  2YU4 A;  3HTK C;  2KRE A;  4IC3 A;  4I7B A;  2RSD A;  2CKL B;  3ZYM A;  1U6G B;  4LAD B;  2CT2 A;  4ZUX U;  4PPE A;  2L0B A;  3ZYK A;  3D9N A;  3RPG C;  4I7D A;  1INZ A;  2L80 A; 
#chains in the Genus database with same CATH topology
 3ASG A;  2M6M A;  3SFY A;  4D10 C;  2Q7F A;  2EIM E;  2H0D B;  3DSW A;  2XCB A;  5EN5 D;  4PDX A;  3SOU A;  1JWG A;  4PUC A;  1EDU A;  4YVO A;  3S7B A;  1HG2 A;  4JW1 A;  3LVR E;  1DCQ A;  2DSM A;  4Q96 A;  2IU1 A;  1NI1 A;  2XCC A;  2VGY A;  1IQU A;  3ZIM A;  4O62 A;  2YW8 A;  4I6G A;  3GW4 A;  3L9T A;  1ZBD B;  2KGI A;  4FAD A;  4AEZ C;  2GRP B;  1N0R A;  3KV5 A;  4WWP A;  3GZ2 A;  3FEH A;  5EYA F;  3EHQ A;  2QFC A;  2KGG A;  3SBT B;  3U5N A;  1Y8M A;  1E8X A;  2L6J A;  2X38 A;  1UW4 B;  1QNF A;  3O34 A;  5FZR A;  3SY2 A;  2K4D A;  1ELR A;  2A5U A;  2L0I A;  4O64 A;  2RI7 A;  2FUL A;  4ZDT A;  4GPK A;  2WMO A;  4GTM A;  4L2Y A;  4FHJ A;  2BKG A;  3ISM C;  3AS8 A;  5KJN A;  3V43 A;  4EZK A;  5ITZ F;  3GZS A;  5H1V A;  2KZT A;  3QC1 A;  3OXL A;  3E4B A;  1EYH A;  5HRY A;  3L82 A;  4EPZ A;  5AJL A;  4HNA D;  2MYO A;  4GA0 A;  3VLF A;  1N87 A;  2KU3 A;  3CST A;  4X3G A;  3PRZ A;  4G26 A;  3RIB A;  4JA9 A;  1E8Z A;  4AYC B;  1P5Q A;  2J9Q A;  1JPL A;  3N9O A;  3P1U A;  3TXN A;  5EYP F;  2C2V S;  2E6S A;  2VSY A;  3BQO A;  4AP4 A;  4XE0 A;  4GB0 A;  2MA6 A;  2YRE A;  3APC A;  2LSV A;  1OUV A;  1K2F A;  4AOF A;  3LY8 A;  2J8S D;  3LS8 A;  3T6R A;  4XIF A;  3TAX A;  3UIO C;  1NL4 A;  2Y0B G;  2AN6 A;  4YDW A;  1IXV A;  3ABK E;  2YNQ A;  5SVX A;  5H1T A;  5EIB E;  2KCL A;  4A55 A;  4W4U A;  3CHQ A;  3KS2 A;  5G55 A;  2L5U A;  3DEO A;  4HRN A;  4FLH A;  3EB5 A;  1S64 A;  3B13 A;  3ZFW A;  3UIP C;  1AP7 A;  1TN8 A;  3UQ3 A;  3QK0 A;  5ANR A;  1MZC A;  4O6F A;  3AG3 E;  1X4U A;  4MLP A;  2KC7 A;  5CED B;  1MHQ A;  5JA4 D;  4U8Y D;  4N4F A;  3VTX A;  4GMR A;  3L54 A;  3DPL R;  4LUN U;  1KZO A;  3C5K A;  3NZU A;  3G2V A;  2ZXW E;  5J90 A;  4K03 A;  2OVF A;  3P2B A;  4CGW A;  1BI8 B;  3FDH A;  5EID A;  3Q78 A;  1T1H A;  2KE1 A;  2IQC A;  4V3L C;  2FUU A;  2KAT A;  4OGE A;  4AXH A;  5FIN A;  4G24 A;  4JEH A;  4A63 B;  4KXK B;  4I1O B;  2C2L A;  2I6H A;  2YHN A;  2XOC A;  5KBA A;  3AS4 A;  2ECW A;  3ZYL A;  3QWV A;  3C6W A;  1X4I A;  2IOS A;  2OEW A;  3SI5 A;  3LQI A;  3QKY A;  3ZYQ A;  4GYW A;  2DBA A;  1MX2 A;  4HI8 A;  4TXQ A;  2XHE A;  2DX8 A;  2OVB A;  2OOE A;  4DPR A;  4PH4 B;  4HVB A;  4ILH B;  4I17 A;  4HQD A;  2QYU A;  4EBA G;  5EX0 A;  4F7A A;  2AXZ A;  4C0M A;  1H2V C;  2YHO A;  4MVT A;  3SHB A;  1H6O A;  2WXF A;  5A7D B;  3KAE A;  5G2N A;  3QOU A;  3V2O A;  2WQ7 A;  2X3M A;  2MUM A;  1N4R A;  1GW6 A;  3QWW A;  3E32 A;  1HG5 A;  4GCO A;  1WEQ A;  4U0Z A;  4IRU A;  5J3X A;  4EHM A;  4U63 A;  1UJJ A;  4U96 D;  1Z6T A;  2WXG A;  3DSX A;  3APF A;  4I2Z A;  3VK6 A;  3QB2 A;  5CEC B;  2Y4U A;  3OAW A;  2B0O E;  5TDW A;  5ARG A;  3IHP A;  2OEV A;  3N9N A;  1N0Q A;  2VSX E;  4WAF A;  1JCQ A;  2ZGD A;  3DPD A;  3R7R A;  4U95 D;  4U0S A;  4BFR A;  5CCL A;  4CYM D;  3EB6 A;  3LYA A;  3Q73 A;  3T9K A;  1NA0 A;  1SA5 A;  4C9Z A;  3TL5 A;  4Y6C A;  4LNB A;  1OWP A;  3RTR B;  2KFT A;  5EIL A;  4FLB A;  4KZ0 A;  5AIT A;  4BX8 A;  4YBS A;  5T4Y A;  5SVY A;  3FTW A;  5TAB A;  2VGX A;  4C0E A;  2WXO A;  3OTN A;  1E8Y A;  4FHK A;  3ZU7 B;  4FJC A;  3ASF A;  3FUK A;  2E6R A;  3HYM B;  2GRO B;  3PDN A;  3PE3 A;  2LQ6 A;  3O4Z A;  2YQL A;  4BTA A;  5E75 A;  2XOZ A;  4ANW A;  5IY5 E;  3TG5 A;  3ZXP A;  4U8H A;  4OVU A;  2Y4T A;  4GA2 A;  5C11 A;  4APO A;  4A1G A;  1BI7 B;  4WA6 A;  2AXU A;  3ZW3 A;  4GYO A;  3FUJ A;  4GNG A;  4S3O B;  3G2S A;  3B7T A;  3RRU A;  4Y6W A;  2R03 A;  1LDJ B;  4PTB A;  4DK5 A;  1WEM A;  2KZT B;  5FIO A;  1AWC B;  1FBV A;  3PE4 A;  3FUN A;  1TJC A;  2XRY A;  3FTY A;  5FER A;  2L9B A;  2P9P G;  3CVX A;  3FU0 A;  2WQ6 A;  3CR3 A;  3MKQ A;  4BES A;  3FU6 A;  2XS8 A;  4YDO A;  4J8S A;  4BER A;  5BV0 A;  2HYE D;  5D1L B;  2CHZ A;  2LXH C;  2B6C A;  3ASN E;  3HVE A;  3TWS A;  4U8V D;  5FEY A;  3DDT A;  3S7F A;  4UWK A;  1W3B A;  1ELK A;  1HX8 A;  2H6I A;  2ZGG A;  5AYW D;  4IC3 A;  1OWN A;  5HQ8 A;  4KT6 B;  3ZYM A;  3N71 A;  1OWO A;  4JPS A;  1DNP A;  5B1B E;  3FUL A;  4AP2 A;  4PPE A;  1MYO A;  3MJW A;  5AAR A;  2E0I A;  4EEC A;  3ASH A;  1WEN A;  4CGV A;  2HE0 A;  1U3C A;  1NFI E;  2IFU A;  1OWM A;  4J0U A;  4NUR A;  2JRJ A;  2JUN A;  2EIN E;  3URZ A;  3EIQ C;  3PNL B;  4PS8 A;  3SUB A;  2A5E A;  2FUI A;  4HRM B;  4KVM A;  3UM3 A;  4CDR A;  2XEN A;  5SVI A;  5AQB A;  4BHW A;  5HI7 A;  1FVF A;  3FUE A;  5FZQ A;  1E4U A;  3CQG B;  2VQ2 A;  3AU5 A;  1DVP A;  3GL6 A;  1N94 A;  3ZVY A;  4RG9 A;  4NAC A;  5G04 J;  3TG4 A;  4F6R D;  3HCS A;  3TWU A;  4GNF A;  2MD7 B;  2MKE A;  5KJM A;  2VPD A;  4YAD A;  4DI4 A;  2DVW A;  2F6J A;  4HB5 A;  4XI0 A;  1H2U A;  3IXE A;  1K8K G;  4HOU A;  1HYJ A;  1S0P A;  2C0M A;  3U5M A;  4Q6F A;  2R17 C;  5D1K B;  3B7U X;  2GRN B;  4EQF A;  4DX7 D;  2WXQ A;  1MM2 A;  5H1U A;  3FTZ A;  3PUK A;  4B8C B;  1WEE A;  3FL2 A;  1NP7 A;  5LX8 A;  2MNY A;  4YAT A;  3M63 A;  2PNN A;  4QQ4 A;  1TNZ A;  4ZFH A;  4JEU A;  2GW1 A;  5B79 A;  1G3N B;  4L9P A;  5G05 J;  3O37 A;  1ZB1 A;  3PH0 C;  1TEZ A;  2DYS E;  2OWA A;  4HOS A;  4F1P A;  4TRQ A;  3D9O A;  3O35 A;  4GTP A;  3W9F A;  3FJU B;  3TXM A;  1JCR A;  4XKB A;  5B77 A;  2Y1N A;  2WPV A;  3CHR A;  3EIJ A;  3D9H A;  4YAX A;  3JQ0 A;  2LAU A;  2ZIR A;  2K17 A;  3VLD A;  5DIN A;  3UXG A;  2J08 A;  4U04 A;  2LNI A;  1E7V A;  3MZL B;  2DCP A;  2ECJ A;  3RRN B;  2XRZ A;  2EIJ E;  3LXU X;  3UT7 A;  2HO1 A;  4J8F A;  5KNH D;  2IDA A;  1UJK A;  2D8S A;  5M72 A;  1KPS B;  3L11 A;  1OCC E;  1VDY A;  2CON A;  4BBQ A;  4GTQ A;  2Y43 A;  5LFA A;  3AG1 E;  4I2W A;  4GAA A;  4GPM A;  2YHC A;  3NQP A;  5E76 A;  1ZU2 A;  3WXX A;  5TBN A;  1FP0 A;  1IHG A;  1N4P A;  3DST A;  2CHX A;  1TN6 A;  2P9N G;  3ABM E;  4I7C A;  2VGX B;  4M7C A;  4FJZ A;  2YYR A;  3E33 A;  1H2T C;  4OYS A;  1K1A A;  4O60 A;  1V54 E;  3NAW A;  2CRW A;  3O47 A;  1X4J A;  2IOL A;  3LPZ A;  2ECT A;  3ZGQ A;  4ANU A;  3VTY A;  4DRX E;  3ONK A;  2RKK A;  3D9K A;  2VJF A;  4HI9 A;  5AN8 A;  4DX2 A;  3U5P A;  2CSY A;  1IYG A;  1WDY A;  4XI9 A;  2M85 A;  3NOG D;  1ELW A;  2NAA A;  2ION A;  3ZEF A;  3DRA A;  3PHD A;  1XGW A;  3UT4 A;  2H6F A;  5JJ7 A;  2OV8 A;  3KDE C;  3ZVV A;  4U0U A;  2MT5 A;  3LVQ E;  5FB0 A;  1BPO A;  3M62 A;  3L13 A;  2MD8 C;  4ILI A;  3MKQ B;  3I4R B;  2PZI A;  4ABN A;  2P2C P;  4YVQ C;  4AUQ B;  3Q7A A;  4I9E A;  2IQJ A;  3S7J A;  3RRM B;  1WG0 A;  3HVE B;  3UM0 A;  4JHK A;  4AY6 A;  5FWQ A;  3CVN A;  2EGP A;  3Q7F A;  4GZC A;  4U07 A;  3KNV A;  4J7W A;  3BG0 B;  3PZ1 A;  2UZG A;  3HG0 D;  2JM3 A;  2IEJ A;  3PZ3 A;  2VJ8 A;  4QFV A;  2LGK A;  4NQ0 A;  5B1A E;  4JXT A;  4BT9 A;  2PQR A;  5DBK A;  3SHF A;  3X2Q E;  3U3W A;  1WEU A;  4WNG A;  3M99 A;  2WXM A;  4PS3 A;  2KWJ A;  3JQ1 A;  1YMP A;  3SZ7 A;  3W9G A;  1KLX A;  1FPP A;  2DIW A;  5CMY A;  4DX1 A;  2QY7 A;  4HFG A;  3EU5 A;  1XWH A;  3UT8 A;  3FUH A;  1TNU A;  2WXR A;  4G8K A;  4C9B B;  4YND A;  3GYZ A;  2V4L A;  3CHO A;  2VP7 A;  3KEZ A;  1SA4 A;  4DJA A;  5LKU A;  4LNU D;  2F8X K;  2I50 A;  4O1P A;  4ZQL A;  4IC2 A;  1RW2 A;  5JJ6 A;  3MV2 B;  4GYY A;  3CVY A;  1KZP A;  3F6Q A;  4L1B A;  3D3M A;  5SVI B;  4UUC A;  3MYV A;  2F0Y A;  3FTU A;  4UWG A;  4F52 B;  4CRW A;  4GNE A;  4URK A;  5JHA A;  5KWD A;  2LGV A;  5CRV A;  4HOQ A;  4EBA A;  3SNX A;  5TRB A;  3IBE A;  4YC9 A;  1MQS A;  2WB2 A;  2EGM A;  3DPY A;  1S63 A;  3ML9 A;  4DI3 A;  1TYQ G;  3ESK A;  2RFM A;  4BX9 A;  2KM4 A;  3L1Z B;  3AG2 E;  3DEP A;  4TUM A;  2WM9 A;  2XB1 A;  3MKR A;  3QNK A;  4O1O A;  3PUR A;  2X6F A;  5I3L A;  2H6G A;  4OAU C;  2PNX A;  1OCZ E;  1Z5S C;  3CKB A;  4UP0 A;  4A4B A;  3FH5 A;  1V55 E;  3FUF A;  2XQ0 A;  3DSV A;  3B95 A;  4R7L A;  4A1S A;  4L7X A;  3PLW A;  2GRR B;  4LG6 A;  2ETC A;  1DC2 A;  2LXL A;  3CVL A;  2VPB A;  2FEZ A;  2RG8 A;  4XI1 A;  4GZ3 A;  4CCA A;  2DZN A;  1TNB A;  4WWN A;  1O1T A;  4FU3 A;  2XGM A;  4IUL A;  2Y3A A;  3T5X A;  2R59 A;  5A23 A;  4B0Z A;  3NB2 A;  4K5C A;  3C3Q A;  1FT1 A;  5DIZ A;  4P5O B;  3SD5 A;  2YIN A;  3ZNG A;  3ZPV E;  3FFL A;  4GTT A;  2VNF A;  4A3T A;  3MV3 B;  4UWH A;  3K9I A;  2CHW A;  3Q79 A;  4W9R A;  3Q4A B;  2GRL A;  4ME2 A;  4G8L A;  2KXP C;  3EUV A;  3RKV A;  2FSA A;  5FTP A;  4Q69 A;  3IV0 A;  4JHJ A;  4JL0 A;  3I3N A;  2LAH A;  4WZ0 A;  2JMD A;  3FTS A;  3UI2 A;  3DWD A;  2XOY A;  4JC8 A;  2P9L G;  5G04 C;  4WZ3 B;  2JLB A;  3B7S A;  3HTK C;  4AV7 A;  4UI9 J;  4I7B A;  3T8M A;  2I9C A;  2IY0 C;  4UWL A;  2NSZ A;  3RPG C;  4I7D A;  3ESL A;  3DSS A;  3AJI A;  2L80 A;  1OXJ A;  2DWZ A;  4EZJ A;  3N9Q A;  1MBM A;  3JUI A;  3QAQ A;  1LD7 A;  3HXC A;  3L1X A;  4LRZ A;  4GZ5 A;  5KJK A;  4G25 A;  2VYI A;  3AU4 A;  5B76 A;  3AAA C;  5G05 C;  1EPU A;  5ENQ D;  5LKZ A;  1H19 A;  2WQH A;  1S70 B;  2ZET C;  3G2W A;  2VJF B;  2NYJ A;  3E34 A;  1BOR A;  5LKT A;  2XEH A;  1X81 A;  1LF8 A;  3I4G A;  1V87 A;  3D9P A;  2G6Q A;  3KEA A;  2QYJ A;  3CGH A;  3V2X A;  3SQV A;  3TJP A;  1Z3Y A;  2HYZ A;  3TWR A;  2DJA A;  4Z0O A;  1YYH A;  2YQM A;  5JMN D;  2IF4 A;  2F37 A;  2VSN A;  3PZ4 A;  4HOR A;  1WES A;  4R7E A;  2FO1 E;  1PY1 A;  1N54 A;  1IKN D;  3FTX A;  4CDM A;  4P29 A;  2BED A;  4RG6 A;  2KWO A;  4HS2 A;  1FCH A;  3EHN A;  3Q47 B;  1E90 A;  3L22 A;  5AQA A;  1Q2Z A;  2WXH A;  1K3Z D;  2EIL E;  4R8P K;  3HHM A;  4X8Q A;  2YUC A;  5FJY A;  2VJE A;  4GTV A;  4F1S A;  4LK9 A;  2R2L A;  5FQ7 A;  1N52 A;  3CHP A;  1LTX A;  3ZN3 A;  5FQ4 A;  5LCW C;  3KD7 A;  4HLL A;  3E37 A;  4QF3 A;  2LAI A;  3L08 A;  4WNE A;  2ETB A;  4B93 B;  1D8E A;  3D9J A;  4FJY A;  1JCS A;  2AJA A;  3SOX A;  3M7K A;  3T7L A;  4AY5 A;  3HXB A;  4APF A;  4N3C A;  2EOD A;  5T3R A;  1SW6 A;  1QYM A;  5FQ6 A;  3CVP A;  2P9I G;  2OND A;  2XEV A;  4HLE A;  1A17 A;  2F42 A;  3HXE A;  3HXD A;  3UM2 A;  2UWJ G;  3DXM G;  2JMJ A;  5JG6 A;  3EU9 A;  5CBN A;  2XP0 A;  3CK7 A;  1JOC A;  2L43 A;  5LOZ A;  3MDB C;  2LUH A;  3ASL A;  1CHC A;  2QC9 A;  4ATZ D;  1FVH A;  2BTD A;  4LJN A;  5EYL A;  3AS5 A;  1VD4 A;  4BWR A;  2M63 A;  4H7Y A;  3FM8 C;  3LRQ A;  4GZD A;  3ZPV 1;  3VLE A;  1N11 A;  2KWN A;  1TJF A;  4OVV A;  1B89 A;  5AIU A;  4MS6 A;  1N4S A;  4I1M A;  4JHR A;  4Z0R A;  4GU5 A;  5BT1 A;  3U4T A;  3O70 A;  4EZL A;  4OGC A;  3PEV B;  3PZ2 A;  4YBM A;  3CV0 A;  3ZPJ A;  3O48 A;  4H9D A;  3SBS A;  1N9A A;  3L6A A;  4CA1 A;  4XKC A;  2UY1 A;  2M1R A;  2DZO A;  4N5C A;  2LRI C;  2R05 A;  4M3O A;  3RAU A;  2ECG A;  3C3R A;  2MA5 A;  5D2M C;  2YSJ A;  1HU3 A;  5HKP A;  1U3D A;  2KR4 A;  2E61 A;  3WG7 E;  3LEW A;  3QJZ A;  1VYX A;  3CVV A;  2MRI A;  4ATG A;  1FT2 A;  3L17 A;  1WEP A;  2JAB A;  1HXI A;  2LN0 A;  1UG3 A;  2WXL A;  2GRQ B;  2HR2 A;  2KCK A;  4HRL A;  4C48 B;  2LO6 A;  1OT8 A;  2V8S E;  3LCA A;  3C3O A;  3FU5 A;  4LCT A;  1LD8 A;  1U2V G;  3G2T A;  3UKU G;  4J8Y A;  3PRE A;  2OCC E;  3I2D A;  3J5Q B;  4RQI A;  3FEX A;  1O1S A;  2LV9 A;  2K1J A;  3PZD A;  5B8D A;  5H7P A;  2XEE A;  1H6K A;  2K16 A;  3PNT B;  3LY7 A;  1WEW A;  1H6P A;  4DX5 D;  5G0F A;  3MHH A;  3ASO E;  2BAY A;  2OXQ C;  4GZ6 A;  4ILG A;  2WXI A;  5KJL A;  1N95 A;  5B75 A;  4N2Q A;  3CHS A;  4B8A A;  4AVX A;  3ZRH A;  3G2U A;  4B94 A;  1KT1 A;  1WIM A;  2KBX A;  3ZNI A;  1YA0 A;  3T5V A;  5ENP D;  4E6H A;  4N5Q A;  5BW8 C;  4ACK A;  4L7T A;  3RJV A;  4GA1 A;  2F6N A;  2V4H C;  3B7B A;  3C72 A;  2P58 C;  4JVS A;  3NOC D;  1RMD A;  2LDR A;  4I6E A;  4N3W A;  3R7Q A;  3IKO B;  1H0A A;  2P9U G;  2J4D A;  2YT5 A;  5LCW J;  1E8W A;  5KH9 A;  2BF0 X;  2FD4 A;  2XS1 A;  4ANV A;  3FHE A;  3C98 A;  2V5F A;  5B3S E;  3SF4 A;  4JB8 P;  1SVX A;  5C1D A;  3ZKJ A;  3ML8 A;  2QIZ A;  3N9M A;  4L2L A;  3D9I A;  4CT4 A;  5H9M A;  1WGM A;  1HE8 A;  1Y6I A;  3ENE A;  1HO8 A;  3FU3 A;  4A3V A;  4N3B A;  4PS7 A;  1BLX B;  1Z2Q A;  4WNF A;  3BG1 B;  2ECI A;  3ONL A;  3BEE A;  1F62 A;  3QZV A;  4UI9 C;  3CQC B;  5C13 A;  4F3V A;  4FP7 A;  1JM7 A;  5BV1 A;  2MHK A;  1QBQ A;  1E96 B;  5FZS A;  1KT0 A;  3JXI A;  4DLO A;  5BPP A;  3CHM A;  4N3A A;  1OWL A;  1Z6U A;  1ZBP A;  2VJE B;  3UPV A;  3LJ3 A;  5CHE E;  4QQI A;  4HBD A;  2MNZ A;  2CFU A;  3ZHE A;  2VPG A;  4N2S A;  3JCK C;  3KSL A;  3DWL G;  3FTV A;  5B78 A;  2QZA A;  1TN7 A;  2BUG A;  2JMI A;  3RK6 A;  4YAB A;  2I1K A;  1MX4 A;  2WMN A;  2Y69 E;  4UQZ A;  5ENO D;  3C5R A;  4J8E A;  3V31 A;  3LJN A;  5ENN A;  4FA6 A;  4H7X A;  4KYO B;  1SZ9 A;  2AVP A;  3DSU A;  4BY6 A;  2I2O A;  3MGB A;  2WXK A;  3U64 A;  3ZYK A;  4KBQ A;  5KCM A;  1INZ A;  3TGO A;  3ZXS A;  2CG3 A;  5D0Q D;  5HS0 A;  3Q49 B;  2YUR A;  4CDN A;  5G04 B;  1TNY A;  4UWF A;  2YSM A;  5CMW A;  3FP3 A;  2XPZ A;  2PM6 A;  4HXI A;  4AM9 A;  1WE9 A;  4MBG A;  2Y1M A;  4I9C A;  3ASD A;  4BTB A;  5KH7 A;  2WXP A;  2ECN A;  3RPG B;  4Q94 A;  2LXP C;  3BUA A;  3V30 A;  2VSO E;  3CVQ A;  4TXR A;  2J49 A;  4Z68 A;  3Q75 A;  3UIN C;  2PUY A;  2WVI A;  2UY1 B;  2M13 A;  2P9K G;  3EDT B;  4J8D A;  4WUY A;  2FBN A;  2KYU A;  2G43 A;  3TWX A;  5ANL A;  4NN2 A;  3RU0 A;  2GRM A;  1HYI A;  5G05 B;  4BSX A;  4RSY A;  2EA6 A;  4G23 A;  2KCV A;  2G45 A;  3SFX A;  5KNG A;  4GTR A;  3E30 A;  2LGL A;  1LDK C;  4XX5 A;  2KKX A;  3CK8 A;  2J09 A;  1YCS B;  4K0R A;  5BXU A;  4QF2 A;  5LKX A;  5J08 A;  2WXN A;  4DX6 D;  2L6B A;  4MSX A;  4IN3 B;  1OY3 D;  3O33 A;  3KSQ A;  4N39 A;  3AG4 E;  3HXF A;  2MIQ A;  2FO7 A;  4WZ2 A;  2R5S A;  3Q5M A;  3CSF A;  2EXU A;  4FIP A;  4CZ2 D;  1IYM A;  3MA5 A;  4AJW A;  4NIK A;  3U66 A;  3PUQ A;  4TXP A;  4DUI A;  3APD A;  2ETA A;  3FWV A;  4UI9 K;  3S2A A;  4UP5 A;  3MHS A;  4RVB A;  2AWI A;  1IHB A;  2VTB A;  4WND A;  1WY6 A;  5AJD A;  1Z60 A;  4A49 A;  4AIF A;  3JXJ A;  1N4Q A;  2CG2 A;  4R2Y A;  3CK9 A;  4KMO A;  2C0L A;  3LJU X;  1Z3X A;  4U7E B;  2XPI A;  4TV3 A;  2XZT G;  3O7A A;  3KQI A;  5EDS A;  1BU9 A;  1NZN A;  1PC2 A;  5LCW B;  2RD0 A;  3LDY A;  3IHY A;  2PM7 A;  2CSV A;  3D9M A;  2MOW A;  3R9M A;  5K3Q A;  2ZU6 B;  4B7Y C;  4G2V A;  4KZC A;  3NBN B;  2KKY A;  3EHM A;  4YDY A;  2CKL A;  5BUZ A;  3QAR A;  3TWQ A;  4XZ4 A;  3DXK G;  3JYS A;  3DBS A;  2P57 A;  5CRU A;  2FI7 A;  2L75 A;  2YVR A;  3CEQ A;  3UUX A;  1HFA A;  4NRH B;  2VPE A;  1WM5 A;  3S7D A;  3UM1 A;  3CKC A;  4J6I A;  4B89 A;  3MX3 A;  2H0D A;  5ENS D;  4LKA A;  2J07 A;  2J4B A;  4LER A;  1WFK A;  2EQX A;  1UN8 A;  5BNW A;  3IEG A;  3LKU A;  1WEO A;  4GCN A;  1WIL A;  5C2Y A;  4LNG A;  4CCG X;  3ZUV B;  3DQV R;  4GMJ A;  5EX3 A;  2AXV A;  2GGF A;  3SOW A;  4JZY A;  3HIZ A;  2X6I A;  3PEU B;  3HCU A;  4ZHB A;  5AEN A;  5TDR A;  5KH3 A;  3ZTG A;  1JM7 B;  2FF4 A;  5FB1 A;  2L0T B;  5FQ8 A;  3SFZ A;  3Q1D A;  1OCO E;  3Q9N C;  1UN9 A;  5LP0 A;  3FEY A;  4YBT A;  4FK5 A;  2IO3 C;  1DCE A;  3NF1 A;  4UQY A;  3SGH A;  2HDP A;  3BU8 A;  5D66 A;  1JUQ A;  2JEK A;  4GTO A;  4KVO A;  4A4C A;  5AQ9 A;  2M3H A;  3E2D A;  2ZIS A;  3ZHE B;  2LGG A;  4MKT A;  1UOH A;  1QQE A;  4TKP B;  2NXP A;  5JHB A;  4CT0 A;  4F53 A;  2YQ8 A;  3Q9U C;  3H7H A;  4JA7 A;  1O5M A;  3OXG A;  2D8U A;  5ENR D;  4GML A;  4G11 A;  3Q15 A;  2EIK E;  2YHE A;  4ACL A;  3U5O A;  1SZA A;  4L58 A;  2CSZ A;  1IQR A;  3FUD A;  3NZS A;  4IYP A;  4V3K C;  4B86 C;  2QJ0 A;  4BT8 A;  2XEU A;  4FUL A;  1D9S A;  1L5J A;  2H6H A;  4BSZ B;  4TUU A;  3CVW A;  3OXF A;  1O1R A;  3T8K A;  2BKK B;  1HS6 A;  5AAO A;  1HF8 A;  1PAQ A;  2IO2 C;  4FO9 A;  3D9L A;  4GND A;  3MEK A;  4G1T A;  3J5P A;  2KWK A;  4LLB A;  1MM3 A;  2A4Z A;  2QIC A;  4AYC A;  2RFA A;  4L23 A;  5CER B;  4V3I A;  4DLQ A;  2AW6 A;  3ZVZ B;  3FUM A;  3QWP A;  2ILR A;  1EF1 C;  1HZ4 A;  3LDZ A;  3RSE G;  5JJT A;  2DYR E;  1G25 A;  3V79 K;  2V0P A;  1K1B A;  1BD8 A;  2E2E A;  2PL2 A;  1TNO A;  4LSZ E;  1JWF A;  4K5B A;  3MCX A;  1D8D A;  3R9A B;  3PS6 A;  3GV4 A;  3TWT A;  1OCR E;  3CIA A;  3UTM A;  1X5B A;  5CBO A;  2NC9 A;  2X6H A;  4FC8 A;  2CFZ A;  4A0C D;  5D1M B;  4HOT A;  3FY4 A;  3NG2 A;  4S3O C;  4WWO A;  2Y1L E;  4ANX A;  3KV6 A;  2L7P A;  2XGO A;  3ULQ A;  3FAO A;  2FFW A;  1QZ2 A;  5D0O D;  3FUI A;  4E85 A;  3I5P A;  2X6K A;  3FH8 A;  1RZ4 A;  2PQN A;  5T8I A;  4BEP A;  1A5E A;  2LXM A;  3UMV A;  3HRA A;  2X6J A;  4LEU A;  3ULE G;  4MRU A;  1TR4 A;  2P9S G;  3CLJ A;  1WAO 1;  3N9P A;  5DKA A;  3EHR A;  4YDE A;  4BET A;  3JUE A;  2KIZ A;  4I43 A;  2R02 A;  3IHV A;  2RR4 A;  2XPY A;  2IJG X;  3QDN A;  3FAN A;  3N9L A;  3O36 A;  3PUJ A;  5AQ7 A;  2ECV A;  5FT9 A;  3HDX A;  5EKQ D;  3LY9 A;  4UI9 B;  2WXJ A;  1NA3 A;  1XNF A;  3PVL A;  3TWW A;  2I1J A;  2XGS A;  5ARF A;  4OAV B;  3SO8 A;  4I1A A;  3LQJ A;  1WEV A;  2VTB B;  1MJ0 A;  1E7U A;  3LQH A;  3ULY A;  1MX6 A;  4XEI G;  3ABL E;  1HH8 A;  2XZD G;  4CEM A;  3HCT A;  4GB9 A;  3RO3 A;  2CRR A;  4K5A B;  1VFY A;  3EJN A;  4UQX A;  3GZ1 A;  4GTS A;  1SQM A;  3L16 A;  3CVU A;  2LSU A;  5CEA A;  3UKR G;  2HM8 A;  3TWV A;  3RO2 A;  2YU4 A;  4RLY A;  2F8Y A;  3FH7 A;  2KRE A;  2V5Q C;  4I6J A;  2RSD A;  2CKL B;  3B7R L;  1U6G B;  4LAD B;  2CT2 A;  4ZUX U;  4JD2 G;  5BXO A;  2L0B A;  2VGE A;  5AIJ A;  5ENT D;  5A6C A;  3D9N A;  3UX4 A;  5CCM A;  3U9W A; 
#chains in the Genus database with same CATH homology
 3ASG A;  2M6M A;  4D10 C;  2Q7F A;  2H0D B;  2XCB A;  3SOU A;  4PDX A;  1JWG A;  4PUC A;  1EDU A;  4YVO A;  3S7B A;  1HG2 A;  4JW1 A;  3LVR E;  4Q96 A;  2IU1 A;  2XCC A;  2VGY A;  1IQU A;  3ZIM A;  2YW8 A;  4I6G A;  3GW4 A;  1ZBD B;  2KGI A;  4FAD A;  4AEZ C;  3KV5 A;  4WWP A;  3GZ2 A;  5EYA F;  2QFC A;  2KGG A;  3SBT B;  3U5N A;  1Y8M A;  1E8X A;  2L6J A;  2X38 A;  1UW4 B;  1QNF A;  3O34 A;  5FZR A;  2K4D A;  1ELR A;  2A5U A;  2L0I A;  4O64 A;  2RI7 A;  2FUL A;  4ZDT A;  4GPK A;  2WMO A;  4L2Y A;  4FHJ A;  3AS8 A;  5KJN A;  3V43 A;  4EZK A;  3GZS A;  5H1V A;  2KZT A;  3QC1 A;  3OXL A;  3E4B A;  1EYH A;  4EPZ A;  5AJL A;  4GA0 A;  3VLF A;  1N87 A;  2KU3 A;  3CST A;  4X3G A;  3PRZ A;  4G26 A;  3RIB A;  4JA9 A;  1E8Z A;  4AYC B;  1P5Q A;  2J9Q A;  1JPL A;  3N9O A;  3P1U A;  3TXN A;  2C2V S;  2E6S A;  2VSY A;  4AP4 A;  4XE0 A;  4GB0 A;  2MA6 A;  2YRE A;  3APC A;  2LSV A;  1OUV A;  1K2F A;  4AOF A;  3LY8 A;  3LS8 A;  3T6R A;  4XIF A;  3TAX A;  2AN6 A;  2YNQ A;  5H1T A;  2KCL A;  4A55 A;  4W4U A;  3CHQ A;  3KS2 A;  5G55 A;  2L5U A;  4FLH A;  3EB5 A;  3B13 A;  3ZFW A;  3UQ3 A;  3QK0 A;  5ANR A;  4O6F A;  1X4U A;  4MLP A;  2KC7 A;  1MHQ A;  4N4F A;  3VTX A;  3L54 A;  3DPL R;  4LUN U;  3C5K A;  3NZU A;  3G2V A;  5J90 A;  4K03 A;  2OVF A;  3P2B A;  4CGW A;  3FDH A;  1T1H A;  2KE1 A;  2IQC A;  4V3L C;  2FUU A;  2KAT A;  4AXH A;  4G24 A;  4JEH A;  4KXK B;  4I1O B;  2C2L A;  2I6H A;  2YHN A;  3AS4 A;  2ECW A;  3ZYL A;  3QWV A;  3C6W A;  1X4I A;  2IOS A;  3SI5 A;  3LQI A;  3QKY A;  3ZYQ A;  4GYW A;  2DBA A;  2XHE A;  2DX8 A;  2OVB A;  2OOE A;  4DPR A;  4PH4 B;  4HVB A;  4ILH B;  4I17 A;  4EBA G;  5EX0 A;  4F7A A;  2AXZ A;  4C0M A;  1H2V C;  2YHO A;  4MVT A;  3SHB A;  2WXF A;  5A7D B;  3KAE A;  5G2N A;  3QOU A;  2WQ7 A;  2X3M A;  2MUM A;  1GW6 A;  3QWW A;  1HG5 A;  1WEQ A;  4GCO A;  4U0Z A;  4IRU A;  5J3X A;  4U63 A;  1UJJ A;  1Z6T A;  2WXG A;  3APF A;  4I2Z A;  3VK6 A;  3QB2 A;  2Y4U A;  3OAW A;  5TDW A;  5ARG A;  3IHP A;  3N9N A;  2VSX E;  4WAF A;  3DPD A;  3R7R A;  4U0S A;  4BFR A;  5CCL A;  3EB6 A;  3LYA A;  1NA0 A;  4C9Z A;  3TL5 A;  4Y6C A;  1OWP A;  3RTR B;  2KFT A;  4FLB A;  4KZ0 A;  5AIT A;  4BX8 A;  4YBS A;  5T4Y A;  3FTW A;  5TAB A;  2VGX A;  4C0E A;  2WXO A;  3OTN A;  1E8Y A;  4FHK A;  4FJC A;  3ASF A;  3FUK A;  2E6R A;  3HYM B;  3PDN A;  3PE3 A;  2LQ6 A;  3O4Z A;  2YQL A;  4BTA A;  5E75 A;  4ANW A;  3TG5 A;  4U8H A;  4OVU A;  2Y4T A;  4GA2 A;  5C11 A;  4APO A;  4A1G A;  4WA6 A;  2AXU A;  3ZW3 A;  4GYO A;  3FUJ A;  4GNG A;  4S3O B;  3G2S A;  3B7T A;  3RRU A;  4Y6W A;  1LDJ B;  4PTB A;  4DK5 A;  1WEM A;  2KZT B;  1FBV A;  3PE4 A;  3FUN A;  1TJC A;  2XRY A;  3FTY A;  5FER A;  2L9B A;  3CVX A;  3FU0 A;  2WQ6 A;  3CR3 A;  3MKQ A;  3FU6 A;  4J8S A;  5BV0 A;  2HYE D;  5D1L B;  2CHZ A;  2LXH C;  3HVE A;  5FEY A;  3S7F A;  4UWK A;  1W3B A;  1ELK A;  1HX8 A;  5AYW D;  4IC3 A;  1OWN A;  5HQ8 A;  4KT6 B;  3ZYM A;  3N71 A;  1OWO A;  4JPS A;  1DNP A;  4AP2 A;  3FUL A;  4PPE A;  3MJW A;  2E0I A;  4EEC A;  3ASH A;  1WEN A;  4CGV A;  1U3C A;  4J0U A;  2IFU A;  1OWM A;  4NUR A;  2JRJ A;  3URZ A;  3EIQ C;  3PNL B;  4PS8 A;  2FUI A;  4KVM A;  4CDR A;  4BHW A;  5HI7 A;  1FVF A;  3FUE A;  5FZQ A;  1E4U A;  3CQG B;  2VQ2 A;  3AU5 A;  1DVP A;  3GL6 A;  3ZVY A;  4RG9 A;  4NAC A;  5G04 J;  3TG4 A;  3HCS A;  4GNF A;  2MD7 B;  5KJM A;  2VPD A;  4YAD A;  4DI4 A;  2F6J A;  4XI0 A;  1H2U A;  4HOU A;  1HYJ A;  1S0P A;  2C0M A;  3U5M A;  4Q6F A;  2R17 C;  5D1K B;  3B7U X;  4EQF A;  2WXQ A;  1MM2 A;  5H1U A;  3FTZ A;  3PUK A;  4B8C B;  1WEE A;  3FL2 A;  1NP7 A;  5LX8 A;  2MNY A;  4YAT A;  3M63 A;  4JEU A;  2GW1 A;  5B79 A;  5G05 J;  3O37 A;  3PH0 C;  1TEZ A;  4HOS A;  4TRQ A;  3D9O A;  3O35 A;  3TXM A;  4XKB A;  5B77 A;  2Y1N A;  2WPV A;  3CHR A;  3EIJ A;  4YAX A;  3JQ0 A;  2K17 A;  3VLD A;  5DIN A;  2J08 A;  4U04 A;  2LNI A;  1E7V A;  3MZL B;  2DCP A;  2ECJ A;  3RRN B;  2XRZ A;  3LXU X;  3UT7 A;  2HO1 A;  4J8F A;  2IDA A;  1UJK A;  2D8S A;  5M72 A;  3L11 A;  1VDY A;  4BBQ A;  2Y43 A;  5LFA A;  4I2W A;  4GAA A;  2YHC A;  3NQP A;  5E76 A;  1ZU2 A;  3WXX A;  5TBN A;  1FP0 A;  1IHG A;  2CHX A;  4I7C A;  2VGX B;  4FJZ A;  2YYR A;  1H2T C;  4OYS A;  1X4J A;  2IOL A;  3LPZ A;  2ECT A;  3ZGQ A;  4ANU A;  3VTY A;  3ONK A;  3D9K A;  2VJF A;  3U5P A;  2CSY A;  1IYG A;  4XI9 A;  2M85 A;  1ELW A;  2NAA A;  2ION A;  3ZEF A;  3PHD A;  1XGW A;  3UT4 A;  5JJ7 A;  2OV8 A;  3ZVV A;  4U0U A;  2MT5 A;  3LVQ E;  5FB0 A;  1BPO A;  3M62 A;  3L13 A;  2MD8 C;  4ILI A;  3MKQ B;  3I4R B;  2PZI A;  4ABN A;  4YVQ C;  4AUQ B;  4I9E A;  3S7J A;  3RRM B;  3HVE B;  4JHK A;  4AY6 A;  5FWQ A;  3CVN A;  2EGP A;  4GZC A;  4U07 A;  3KNV A;  3BG0 B;  2UZG A;  2VJ8 A;  4QFV A;  2LGK A;  4NQ0 A;  4JXT A;  4BT9 A;  2PQR A;  5DBK A;  3SHF A;  3U3W A;  1WEU A;  4WNG A;  3M99 A;  2WXM A;  4PS3 A;  2KWJ A;  3JQ1 A;  3SZ7 A;  1KLX A;  2DIW A;  5CMY A;  2QY7 A;  4HFG A;  1XWH A;  3UT8 A;  3FUH A;  2WXR A;  4C9B B;  4YND A;  3GYZ A;  2V4L A;  3CHO A;  2VP7 A;  3KEZ A;  4DJA A;  5LKU A;  2I50 A;  4ZQL A;  4IC2 A;  5JJ6 A;  3MV2 B;  4GYY A;  3CVY A;  4L1B A;  3D3M A;  3MYV A;  3FTU A;  4UWG A;  4F52 B;  4CRW A;  4GNE A;  4URK A;  5JHA A;  2LGV A;  4HOQ A;  4EBA A;  3SNX A;  5TRB A;  3IBE A;  4YC9 A;  1MQS A;  2WB2 A;  3ML9 A;  4DI3 A;  3ESK A;  4BX9 A;  2KM4 A;  3L1Z B;  2WM9 A;  2XB1 A;  3MKR A;  3QNK A;  3PUR A;  2X6F A;  5I3L A;  2PNX A;  3CKB A;  4UP0 A;  4A4B A;  3FH5 A;  3FUF A;  2XQ0 A;  4R7L A;  4A1S A;  4L7X A;  3CVL A;  2VPB A;  2FEZ A;  2RG8 A;  4XI1 A;  4GZ3 A;  4CCA A;  4WWN A;  4FU3 A;  2XGM A;  4IUL A;  2Y3A A;  3T5X A;  2R59 A;  5A23 A;  4B0Z A;  5DIZ A;  4P5O B;  3SD5 A;  2YIN A;  3ZPV E;  3FFL A;  2VNF A;  4A3T A;  3MV3 B;  4UWH A;  3K9I A;  2CHW A;  4W9R A;  3Q4A B;  2GRL A;  4ME2 A;  3RKV A;  2FSA A;  5FTP A;  4Q69 A;  3IV0 A;  4JHJ A;  4JL0 A;  3I3N A;  2LAH A;  4WZ0 A;  2JMD A;  3FTS A;  4JC8 A;  5G04 C;  4WZ3 B;  2JLB A;  3B7S A;  3HTK C;  4AV7 A;  4UI9 J;  4I7B A;  3T8M A;  2I9C A;  4UWL A;  2NSZ A;  3RPG C;  4I7D A;  3ESL A;  2L80 A;  4EZJ A;  3N9Q A;  3JUI A;  3QAQ A;  3L1X A;  4LRZ A;  4GZ5 A;  5KJK A;  4G25 A;  2VYI A;  3AU4 A;  5B76 A;  5G05 C;  1EPU A;  5LKZ A;  1H19 A;  2WQH A;  2ZET C;  3G2W A;  2VJF B;  1BOR A;  5LKT A;  1LF8 A;  3I4G A;  1V87 A;  3D9P A;  2G6Q A;  3CGH A;  3TJP A;  1Z3Y A;  2HYZ A;  2YQM A;  2IF4 A;  2VSN A;  4HOR A;  1WES A;  4R7E A;  1PY1 A;  1N54 A;  3FTX A;  4CDM A;  4P29 A;  4RG6 A;  2KWO A;  4HS2 A;  1FCH A;  3EHN A;  3Q47 B;  1E90 A;  3L22 A;  2WXH A;  4R8P K;  3HHM A;  2YUC A;  5FJY A;  2VJE A;  4F1S A;  4LK9 A;  5FQ7 A;  1N52 A;  3CHP A;  3ZN3 A;  5FQ4 A;  5LCW C;  3KD7 A;  4QF3 A;  2LAI A;  3L08 A;  4WNE A;  3D9J A;  4FJY A;  3SOX A;  3T7L A;  4AY5 A;  4APF A;  4N3C A;  2EOD A;  5T3R A;  5FQ6 A;  3CVP A;  2OND A;  2XEV A;  4HLE A;  1A17 A;  2F42 A;  2UWJ G;  2JMJ A;  5JG6 A;  3CK7 A;  1JOC A;  2L43 A;  5LOZ A;  3ASL A;  1CHC A;  1FVH A;  2BTD A;  4LJN A;  3AS5 A;  1VD4 A;  4BWR A;  2M63 A;  4H7Y A;  3LRQ A;  4GZD A;  3ZPV 1;  3VLE A;  2KWN A;  1TJF A;  4OVV A;  1B89 A;  5AIU A;  4MS6 A;  4I1M A;  4JHR A;  4GU5 A;  5BT1 A;  3U4T A;  3O70 A;  4EZL A;  3PEV B;  4YBM A;  3CV0 A;  3ZPJ A;  3O48 A;  3SBS A;  3L6A A;  4CA1 A;  4XKC A;  2UY1 A;  2M1R A;  4N5C A;  2LRI C;  4M3O A;  2ECG A;  2MA5 A;  2YSJ A;  1HU3 A;  1U3D A;  2KR4 A;  3LEW A;  3QJZ A;  1VYX A;  3CVV A;  2MRI A;  4ATG A;  3L17 A;  1WEP A;  1HXI A;  2LN0 A;  1UG3 A;  2WXL A;  2HR2 A;  2KCK A;  2LO6 A;  2V8S E;  3LCA A;  3FU5 A;  4LCT A;  3G2T A;  3PRE A;  3I2D A;  3FEX A;  2LV9 A;  2K1J A;  3PZD A;  5B8D A;  1H6K A;  2K16 A;  3PNT B;  3LY7 A;  1WEW A;  5G0F A;  3MHH A;  2BAY A;  2OXQ C;  4GZ6 A;  4ILG A;  2WXI A;  5KJL A;  5B75 A;  4N2Q A;  3CHS A;  4B8A A;  4AVX A;  3ZRH A;  3G2U A;  4B94 A;  1KT1 A;  1WIM A;  3ZNI A;  1YA0 A;  3T5V A;  4E6H A;  5BW8 C;  4ACK A;  4L7T A;  3RJV A;  4GA1 A;  2F6N A;  2P58 C;  4JVS A;  1RMD A;  2LDR A;  4I6E A;  4N3W A;  3R7Q A;  3IKO B;  1H0A A;  2J4D A;  2YT5 A;  5LCW J;  1E8W A;  5KH9 A;  2BF0 X;  4ANV A;  3FHE A;  3C98 A;  2V5F A;  3SF4 A;  5C1D A;  3ML8 A;  2QIZ A;  3N9M A;  4L2L A;  3D9I A;  4CT4 A;  5H9M A;  1WGM A;  1HE8 A;  1Y6I A;  3ENE A;  1HO8 A;  3FU3 A;  4A3V A;  4N3B A;  4PS7 A;  1Z2Q A;  4WNF A;  3BG1 B;  2ECI A;  3ONL A;  3BEE A;  1F62 A;  3QZV A;  4UI9 C;  3CQC B;  5C13 A;  4F3V A;  4FP7 A;  1JM7 A;  5BV1 A;  2MHK A;  1E96 B;  5FZS A;  1KT0 A;  4DLO A;  5BPP A;  3CHM A;  4N3A A;  1OWL A;  1Z6U A;  1ZBP A;  2VJE B;  3UPV A;  3LJ3 A;  5CHE E;  2MNZ A;  2CFU A;  3ZHE A;  2VPG A;  4N2S A;  3JCK C;  3FTV A;  5B78 A;  2BUG A;  2JMI A;  3RK6 A;  4YAB A;  2I1K A;  2WMN A;  4UQZ A;  4J8E A;  5ENN A;  4FA6 A;  4H7X A;  4KYO B;  1SZ9 A;  2AVP A;  4BY6 A;  2I2O A;  3MGB A;  2WXK A;  3U64 A;  3ZYK A;  4KBQ A;  5KCM A;  1INZ A;  3TGO A;  3ZXS A;  2CG3 A;  5D0Q D;  3Q49 B;  2YUR A;  4CDN A;  5G04 B;  4UWF A;  2YSM A;  5CMW A;  3FP3 A;  2XPZ A;  2PM6 A;  4HXI A;  4AM9 A;  1WE9 A;  2Y1M A;  4I9C A;  3ASD A;  4BTB A;  5KH7 A;  2WXP A;  2ECN A;  3RPG B;  4Q94 A;  2LXP C;  2VSO E;  3CVQ A;  2J49 A;  2PUY A;  2WVI A;  2UY1 B;  3EDT B;  4J8D A;  4WUY A;  2FBN A;  2KYU A;  2G43 A;  5ANL A;  4NN2 A;  3RU0 A;  2GRM A;  1HYI A;  5G05 B;  4BSX A;  4RSY A;  2EA6 A;  4G23 A;  2KCV A;  2G45 A;  2LGL A;  1LDK C;  4XX5 A;  3CK8 A;  2J09 A;  4K0R A;  4QF2 A;  5LKX A;  5J08 A;  2WXN A;  4MSX A;  4IN3 B;  3O33 A;  4N39 A;  2MIQ A;  2FO7 A;  4WZ2 A;  2R5S A;  3Q5M A;  3CSF A;  4FIP A;  1IYM A;  3MA5 A;  4AJW A;  3U66 A;  3PUQ A;  3APD A;  3FWV A;  4UI9 K;  3S2A A;  4UP5 A;  3MHS A;  4RVB A;  2AWI A;  2VTB A;  4WND A;  1WY6 A;  5AJD A;  1Z60 A;  4A49 A;  4AIF A;  2CG2 A;  4R2Y A;  3CK9 A;  4KMO A;  2C0L A;  1Z3X A;  2XPI A;  4TV3 A;  3O7A A;  3KQI A;  5EDS A;  1NZN A;  1PC2 A;  5LCW B;  2RD0 A;  3IHY A;  2PM7 A;  3D9M A;  2MOW A;  2ZU6 B;  4B7Y C;  4G2V A;  4KZC A;  3EHM A;  2CKL A;  5BUZ A;  3QAR A;  4XZ4 A;  3JYS A;  3DBS A;  2FI7 A;  2L75 A;  3CEQ A;  3UUX A;  1HFA A;  4NRH B;  2VPE A;  1WM5 A;  3S7D A;  3CKC A;  4J6I A;  4B89 A;  3MX3 A;  2H0D A;  4LKA A;  2J07 A;  2J4B A;  4LER A;  1WFK A;  2EQX A;  1UN8 A;  5BNW A;  3IEG A;  3LKU A;  1WEO A;  4GCN A;  1WIL A;  5C2Y A;  4CCG X;  3DQV R;  4GMJ A;  5EX3 A;  2AXV A;  2GGF A;  3SOW A;  4JZY A;  3HIZ A;  2X6I A;  3PEU B;  3HCU A;  5AEN A;  5TDR A;  5KH3 A;  3ZTG A;  1JM7 B;  2FF4 A;  5FB1 A;  2L0T B;  5FQ8 A;  3SFZ A;  1UN9 A;  5LP0 A;  3FEY A;  4YBT A;  4FK5 A;  3NF1 A;  4UQY A;  3SGH A;  2HDP A;  1JUQ A;  2JEK A;  4KVO A;  4A4C A;  2M3H A;  3ZHE B;  2LGG A;  4MKT A;  1QQE A;  4TKP B;  2NXP A;  5JHB A;  4CT0 A;  4F53 A;  2YQ8 A;  4JA7 A;  3OXG A;  4GML A;  4G11 A;  3Q15 A;  2YHE A;  4ACL A;  3U5O A;  1SZA A;  4L58 A;  2CSZ A;  1IQR A;  3FUD A;  3NZS A;  4IYP A;  4V3K C;  4B86 C;  2QJ0 A;  4BT8 A;  2XEU A;  4FUL A;  1L5J A;  4TUU A;  3CVW A;  3OXF A;  1HS6 A;  1HF8 A;  1PAQ A;  4FO9 A;  3D9L A;  4GND A;  3MEK A;  4G1T A;  2KWK A;  4LLB A;  1MM3 A;  2A4Z A;  2QIC A;  4AYC A;  4L23 A;  4V3I A;  4DLQ A;  2AW6 A;  3ZVZ B;  3FUM A;  3QWP A;  2ILR A;  1EF1 C;  1HZ4 A;  3LDZ A;  5JJT A;  1G25 A;  2V0P A;  2E2E A;  2PL2 A;  1JWF A;  3MCX A;  3R9A B;  3PS6 A;  3GV4 A;  3CIA A;  1X5B A;  2NC9 A;  2X6H A;  4FC8 A;  2CFZ A;  4A0C D;  5D1M B;  4HOT A;  3FY4 A;  3NG2 A;  4S3O C;  4WWO A;  3KV6 A;  4ANX A;  2XGO A;  3ULQ A;  1QZ2 A;  5D0O D;  3FUI A;  4E85 A;  3I5P A;  2X6K A;  3FH8 A;  2PQN A;  5T8I A;  3UMV A;  2X6J A;  4LEU A;  4MRU A;  3CLJ A;  1WAO 1;  3N9P A;  5DKA A;  2KIZ A;  4I43 A;  3IHV A;  2XPY A;  2IJG X;  3QDN A;  3N9L A;  3O36 A;  3PUJ A;  2ECV A;  5FT9 A;  3HDX A;  5EKQ D;  3LY9 A;  4UI9 B;  2WXJ A;  1NA3 A;  1XNF A;  3PVL A;  2XGS A;  2I1J A;  5ARF A;  4I1A A;  3LQJ A;  1WEV A;  2VTB B;  1E7U A;  3LQH A;  1HH8 A;  4CEM A;  3HCT A;  4GB9 A;  3RO3 A;  1VFY A;  3EJN A;  4UQX A;  3GZ1 A;  1SQM A;  3L16 A;  3CVU A;  2LSU A;  2HM8 A;  3RO2 A;  2YU4 A;  3FH7 A;  2KRE A;  4I6J A;  2RSD A;  2CKL B;  3B7R L;  1U6G B;  4LAD B;  2CT2 A;  4ZUX U;  2L0B A;  5AIJ A;  5A6C A;  3D9N A;  3UX4 A;  5CCM A;  3U9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...