2M3HA

Structure of dido phd domain
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
61
structure length
61
Chain Sequence
GSMDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death-inducer obliterator 1
publication title NMR structure note: PHD domain from death inducer obliterator protein and its interaction with H3K4me3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 7
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2013-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2m3hA00
2YQMA 4ZDTA 4FK5A 3O33A 1FP0A 3I2DA 2PUYA 4GNEA 3LRQA 4ZUXU 2ECWA 1X4JA 3VK6A 5D1KB 3PUQA 1RMDA 2LGVA 2H0DA 2L80A 2YT5A 1Z2QA 4N3WA 3RPGB 1JOCA 2YREA 4YAXA 1MM3A 2F42A 2EA6A 1XWHA 1N87A 2KE1A 2C2LA 2VJEA 2YHNA 3NG2A 1JM7A 2G43A 4PPEA 1F62A 1WILA 3SOUA 4QF2A 5H1VA 1K2FA 3DQVR 3L1XA 1FBVA 5C11A 4YBSA 4WA6A 2EGPA 2LGKA 3M63A 5LKZA 2LQ6A 5KH9A 4R8PK 3SHBA 2K1JA 2K4DA 2JRJA 5B78A 2NAAA 3KV5A 1WEEA 2MIQA 2CSYA 2YYRA 5H1UA 2RI7A 5B76A 2YU4A 3LQHA 2MA5A 4FO9A 2L43A 2DX8A 2MUMA 2YHOA 4GNDA 2JMJA 4AUQB 2HDPA 5LCWB 5KH3A 4FJCA 5JG6A 5B79A 4X3GA 1X4IA 2M1RA 2ECGA 2MA6A 5G05B 4ZQLA 2VNFA 3O34A 4S3OB 2I50A 3N9QA 2VPDA 4TKPB 3QZVA 3ZVZB 3KQIA 1Z6UA 2YSJA 3MHHA 4R7EA 5C13A 2KGIA 3LQIA 2LGLA 3L11A 5KH7A 4A4CA 4L58A 5AITA 3HTKC 4PTBA 1IYMA 4Q6FA 4LADB 3ZPVE 2UZGA 5G04B 3SOXA 2KREA 2MNYA 2Y1MA 2F6JA 2AN6A 2M3HA 5TBNA 4YADA 3ZTGA 4XI1A 2C2VS 5I3LA 3N9PA 2LV9A 1WEQA 4LLBA 4V3LC 5DINA 3U5PA 4NN2A 2XB1A 4O64A 3HCTA 3PHDA 1JM7B 5DKAA 3O7AA 5G0FA 2LXPC 4GB0A 2BAYA 2MT5A 2MNZA 5TDWA 2KWOA 2KWNA 2VPGA 2L5UA 5B75A 4IC2A 3RTRB 1Z60A 3PURA 2CT2A 1V87A 3M62A 2VP7A 2ECTA 2K17A 4I7BA 4CCGX 3GV4A 4YBMA 4B86C 3C6WA 2KGGA 5FERA 5TABA 1MM2A 3O35A 2KWKA 5B77A 2KIZA 2OXQC 3T7LA 1VD4A 1T1HA 2LRIC 4S3OC 2CSZA 4I7DA 3N9NA 2LXHC 2VPBA 2FSAA 2IDAA 2YSMA 2JMDA 1U6GB 2VPEA 2KFTA 5LKUA 3ZYQA 4UI9B 5J3XA 3U5NA 5FB1A 3HCUA 2KR4A 2LN0A 2LDRA 2YUCA 2ZETC 3FL2A 4R2YA 1WESA 4YABA 4LK9A 2M85A 2MD7B 2RSDA 5LKXA 4YATA 2VJFA 4AYCB 2F6NA 3ZNIA 3ASLA 5H9MA 3MHSA 3O36A 1BORA 2PNXA 3O70A 3L1ZB 2KU3A 2XEUA 3RPGC 2G45A 2ECNA 3N9LA 3ZVYA 4P5OB 3DPLR 2H0DB 4UP5A 5AIUA 5H1TA 5TDRA 3ZPV1 2ECJA 2YW8A 4A49A 2CKLA 4C9ZA 4QF3A 3M99A 4UP0A 4BBQA 3EB6A 3V43A 3EB5A 2D8SA 3HCSA 1WENA 2VJEB 4GNGA 4MVTA 1LDJB 4LKAA 4YBTA 2L0BA 4N4FA 1HYJA 4IC3A 1WGMA 3SOWA 1WEWA 2LGGA 2YQLA 2MD8C 2FUIA 3IHPA 1LDKC 2E6RA 5B8DA 1WFKA 2YURA 1HYIA 2ECIA 1CHCA 3T6RA 4B7YC 2FUUA 3U5MA 1WEPA 3O37A 4BHWA 4FIPA 1VFYA 1DVPA 4AP4A 5D1LB 5FEYA 2EODA 2K16A 2M6MA 2QJ0A 4CA1A 1WEUA 3N9MA 4YC9A 3GL6A 4LJNA 3KNVA 2QICA 2KYUA 2KWJA 2QIZA 2HYED 4I7CA 2Y1NA 1VYXA 3LQJA 3KV6A 3C5KA 1ZBDB 5TRBA 1E4UA 1WIMA 1WEOA 3U5OA 1WE9A 2VJFB 2JMIA 4WZ3B 5FB0A 4GNFA 4WZ2A 2G6QA 4W4UA 5EYAF 2Y43A 2ECVA 4F52B 1G25A 4A0CD 5LKTA 2L75A 4WZ0A 4MSXA 1WEVA 2E6SA 4V3KC 1X4UA 5D1MB 1WEMA 2CKLB 4AYCA 4L7XA 3N9OA 4AVXA 4A4BA
chains in the Genus database with same CATH superfamily
2YQMA 4ZDTA 4FK5A 3O33A 5K3QA 1FP0A 3I2DA 2PUYA 4GNEA 3LRQA 4ZUXU 2ECWA 1X4JA 3VK6A 2XOYA 4OGCA 5D1KB 3PUQA 1RMDA 2LGVA 2H0DA 2L80A 2YT5A 1Z2QA 4N3WA 3RPGB 1JOCA 2JUNA 2YREA 1MM3A 4YAXA 2F42A 2EA6A 2XOZA 3LJUX 1XWHA 1N87A 2KE1A 2C2LA 2VJEA 2YHNA 3NG2A 4H9DA 3M7KA 1JM7A 2G43A 4PPEA 1F62A 1WILA 3SOUA 4QF2A 5H1VA 1K2FA 3DQVR 3L1XA 1FBVA 5C11A 4YBSA 4WA6A 2EGPA 2LGKA 3M63A 5LKZA 2LQ6A 5KH9A 4R8PK 2XP0A 3SHBA 2K1JA 4Z0RA 2K4DA 2JRJA 5B78A 2NAAA 3KV5A 1WEEA 2MIQA 2CSYA 2YYRA 5H1UA 2RI7A 5B76A 2YU4A 3LQHA 2MA5A 4FO9A 2L43A 2DX8A 2MUMA 2YHOA 4GNDA 2JMJA 3FAOA 4AUQB 2HDPA 5LCWB 5KH3A 4Z0OA 4FJCA 5JG6A 5B79A 4X3GA 1X4IA 2M1RA 2ECGA 2MA6A 5G05B 1DCQA 4ZQLA 3FEHA 2VNFA 3O34A 4S3OB 2YVRA 2CONA 3E2DA 2I50A 2EGMA 3N9QA 2VPDA 4TKPB 3QZVA 3ZVZB 3KQIA 2LAUA 1Z6UA 2YSJA 3MHHA 4R7EA 5C13A 2KGIA 3LQIA 2LGLA 3L11A 5KH7A 4A4CA 4L58A 5AITA 2EXUA 3HTKC 4PTBA 1IYMA 4Q6FA 4LADB 3ZPVE 2UZGA 5G04B 3SOXA 2KREA 2MNYA 2Y1MA 2F6JA 2AN6A 2M3HA 5TBNA 4YADA 3ZTGA 2P57A 4XI1A 2C2VS 5I3LA 3N9PA 2LV9A 3SUBA 1WEQA 4LLBA 4V3LC 5DINA 3LDYA 3U5PA 4F1PA 4NN2A 2XB1A 2CSVA 4O64A 3HCTA 3PHDA 3PLWA 1JM7B 5DKAA 2KKXA 3O7AA 2MKEA 2B0OE 5G0FA 2LXPC 4GB0A 2BAYA 2MT5A 2RR4A 2MNZA 5TDWA 2KWOA 3LVQE 2KWNA 2VPGA 2L5UA 5B75A 1MBMA 4IC2A 3RTRB 1Z60A 5SVYA 3PURA 2CT2A 1V87A 3M62A 4O62A 2VP7A 3MDBC 2ECTA 2K17A 4I7BA 4CCGX 3GV4A 4YBMA 4B86C 3C6WA 2KGGA 5FERA 2DJAA 5TABA 1MM2A 3O35A 2KWKA 5B77A 2KIZA 2CRRA 2OXQC 3T7LA 5SVIB 1VD4A 1T1HA 2LRIC 4S3OC 2CSZA 2CRWA 4I7DA 3LVRE 3N9NA 2LXHC 2VPBA 2FSAA 2IDAA 2YSMA 2JMDA 3O47A 3Q1DA 1U6GB 2VPEA 2KFTA 5LKUA 3ZYQA 4UI9B 5J3XA 3U5NA 5FB1A 3HCUA 2KR4A 2LN0A 2LDRA 2YUCA 2ZETC 3DDTA 3FL2A 4R2YA 1WESA 4YABA 4LK9A 2M85A 2MD7B 2RSDA 5LKXA 4YATA 2VJFA 4AYCB 2F6NA 3ZNIA 3ASLA 5H9MA 3MHSA 3FANA 3O36A 1BORA 2PNXA 3O70A 5SVXA 4QQ4A 3L1ZB 2KU3A 2XEUA 3RPGC 2G45A 2ECNA 3N9LA 3ZVYA 4P5OB 3DPLR 2H0DB 4UP5A 5AIUA 5H1TA 5TDRA 3ZPV1 2ECJA 2YW8A 4A49A 2CKLA 4C9ZA 4QF3A 3M99A 4UP0A 4BBQA 3EB6A 3V43A 3EB5A 2OWAA 2D8UA 2D8SA 3HCSA 1WENA 2VJEB 4GNGA 4MVTA 1LDJB 4LKAA 4YBTA 2L0BA 2FD4A 4N4FA 1HYJA 4IC3A 1WGMA 3SOWA 1WEWA 2XOCA 2LGGA 2YQLA 2MD8C 2FUIA 3IHPA 1LDKC 2E6RA 5B8DA 1WFKA 2YURA 2KKYA 1HYIA 2ECIA 1CHCA 3T6RA 4B7YC 2FUUA 3U5MA 1WEPA 3O37A 4BHWA 4FIPA 1VFYA 1DVPA 4AP4A 5D1LB 3JUEA 5FEYA 2EODA 2K16A 2M13A 2M6MA 2QJ0A 4CA1A 1WEUA 3N9MA 4YC9A 3GL6A 4OGEA 2DSMA 4LJNA 3KNVA 2QICA 2KYUA 2KWJA 2QIZA 2HYED 4I7CA 2Y1NA 3H7HA 1VYXA 3LQJA 3KV6A 3C5KA 1ZBDB 3FJUB 2L7PA 5TRBA 1E4UA 1WIMA 5SVIA 1WEOA 3KDEC 3U5OA 1WE9A 3FM8C 2VJFB 2JMIA 4WZ3B 5FB0A 4GNFA 4WZ2A 3T9KA 2G6QA 4W4UA 5EYAF 2Y43A 2ECVA 4F52B 1G25A 4A0CD 2FFWA 3DWDA 5LKTA 2L75A 4WZ0A 4MSXA 2IQJA 1WEVA 2E6SA 4V3KC 1X4UA 5D1MB 1WEMA 2JM3A 2CKLB 2E61A 4AYCA 4L7XA 3N9OA 4AVXA 4A4BA
chains in the Genus database with same CATH topology
2YQMA 4ZDTA 4FK5A 3O33A 1FP0A 3I2DA 2PUYA 4GNEA 3LRQA 4ZUXU 2ECWA 1X4JA 3VK6A 5D1KB 3PUQA 1RMDA 2LGVA 2H0DA 2L80A 2YT5A 1Z2QA 4N3WA 3RPGB 1JOCA 2YREA 4YAXA 1MM3A 2F42A 2EA6A 1XWHA 1N87A 2KE1A 2C2LA 2VJEA 2YHNA 3NG2A 1JM7A 2G43A 4PPEA 1F62A 1WILA 3SOUA 4QF2A 5H1VA 1K2FA 3DQVR 3L1XA 1FBVA 5C11A 4YBSA 4WA6A 2EGPA 2LGKA 3M63A 5LKZA 2LQ6A 5KH9A 4R8PK 3SHBA 2K1JA 2K4DA 2JRJA 5B78A 2NAAA 3KV5A 1WEEA 2MIQA 2CSYA 2YYRA 5H1UA 2RI7A 5B76A 2YU4A 3LQHA 2MA5A 4FO9A 2L43A 2DX8A 2MUMA 2YHOA 4GNDA 2JMJA 4AUQB 2HDPA 5LCWB 5KH3A 4FJCA 5JG6A 5B79A 4X3GA 1X4IA 2M1RA 2ECGA 2MA6A 5G05B 4ZQLA 2VNFA 3O34A 4S3OB 2I50A 3N9QA 2VPDA 4TKPB 3QZVA 3ZVZB 3KQIA 1Z6UA 2YSJA 3MHHA 4R7EA 5C13A 2KGIA 3LQIA 2LGLA 3L11A 5KH7A 4A4CA 4L58A 5AITA 3HTKC 4PTBA 1IYMA 4Q6FA 4LADB 3ZPVE 2UZGA 5G04B 3SOXA 2KREA 2MNYA 2Y1MA 2F6JA 2AN6A 2M3HA 5TBNA 4YADA 3ZTGA 4XI1A 2C2VS 5I3LA 3N9PA 2LV9A 1WEQA 4LLBA 4V3LC 5DINA 3U5PA 4NN2A 2XB1A 4O64A 3HCTA 3PHDA 1JM7B 5DKAA 3O7AA 5G0FA 2LXPC 4GB0A 2BAYA 2MT5A 2MNZA 5TDWA 2KWOA 2KWNA 2VPGA 2L5UA 5B75A 4IC2A 3RTRB 1Z60A 3PURA 2CT2A 1V87A 3M62A 2VP7A 2ECTA 2K17A 4I7BA 4CCGX 3GV4A 4YBMA 4B86C 3C6WA 2KGGA 5FERA 5TABA 1MM2A 3O35A 2KWKA 5B77A 2KIZA 2OXQC 3T7LA 1VD4A 1T1HA 2LRIC 4S3OC 2CSZA 4I7DA 3N9NA 2LXHC 2VPBA 2FSAA 2IDAA 2YSMA 2JMDA 1U6GB 2VPEA 2KFTA 5LKUA 3ZYQA 4UI9B 5J3XA 3U5NA 5FB1A 3HCUA 2KR4A 2LN0A 2LDRA 2YUCA 2ZETC 3FL2A 4R2YA 1WESA 4YABA 4LK9A 2M85A 2MD7B 2RSDA 5LKXA 4YATA 2VJFA 4AYCB 2F6NA 3ZNIA 3ASLA 5H9MA 3MHSA 3O36A 1BORA 2PNXA 3O70A 3L1ZB 2KU3A 2XEUA 3RPGC 2G45A 2ECNA 3N9LA 3ZVYA 4P5OB 3DPLR 2H0DB 4UP5A 5AIUA 5H1TA 5TDRA 3ZPV1 2ECJA 2YW8A 4A49A 2CKLA 4C9ZA 4QF3A 3M99A 4UP0A 4BBQA 3EB6A 3V43A 3EB5A 2D8SA 3HCSA 1WENA 2VJEB 4GNGA 4MVTA 1LDJB 4LKAA 4YBTA 2L0BA 4N4FA 1HYJA 4IC3A 1WGMA 3SOWA 1WEWA 2LGGA 2YQLA 2MD8C 2FUIA 3IHPA 1LDKC 2E6RA 5B8DA 1WFKA 2YURA 1HYIA 2ECIA 1CHCA 3T6RA 4B7YC 2FUUA 3U5MA 1WEPA 3O37A 4BHWA 4FIPA 1VFYA 1DVPA 4AP4A 5D1LB 5FEYA 2EODA 2K16A 2M6MA 2QJ0A 4CA1A 1WEUA 3N9MA 4YC9A 3GL6A 4LJNA 3KNVA 2QICA 2KYUA 2KWJA 2QIZA 2HYED 4I7CA 2Y1NA 1VYXA 3LQJA 3KV6A 3C5KA 1ZBDB 5TRBA 1E4UA 1WIMA 1WEOA 3U5OA 1WE9A 2VJFB 2JMIA 4WZ3B 5FB0A 4GNFA 4WZ2A 2G6QA 4W4UA 5EYAF 2Y43A 2ECVA 4F52B 1G25A 4A0CD 5LKTA 2L75A 4WZ0A 4MSXA 1WEVA 2E6SA 4V3KC 1X4UA 5D1MB 1WEMA 2CKLB 4AYCA 4L7XA 3N9OA 4AVXA 4A4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQM A;  4ZDT A;  4FK5 A;  3O33 A;  1FP0 A;  3I2D A;  2PUY A;  4GNE A;  3LRQ A;  4ZUX U;  2ECW A;  1X4J A;  3VK6 A;  5D1K B;  3PUQ A;  1RMD A;  2LGV A;  2H0D A;  2L80 A;  2YT5 A;  1Z2Q A;  4N3W A;  3RPG B;  1JOC A;  2YRE A;  4YAX A;  1MM3 A;  2F42 A;  2EA6 A;  1XWH A;  1N87 A;  2KE1 A;  2C2L A;  2VJE A;  2YHN A;  3NG2 A;  1JM7 A;  2G43 A;  4PPE A;  1F62 A;  1WIL A;  3SOU A;  4QF2 A;  5H1V A;  1K2F A;  3DQV R;  3L1X A;  1FBV A;  5C11 A;  4YBS A;  4WA6 A;  2EGP A;  2LGK A;  3M63 A;  5LKZ A;  2LQ6 A;  5KH9 A;  4R8P K;  3SHB A;  2K1J A;  2K4D A;  2JRJ A;  5B78 A;  2NAA A;  3KV5 A;  1WEE A;  2MIQ A;  2CSY A;  2YYR A;  5H1U A;  2RI7 A;  5B76 A;  2YU4 A;  3LQH A;  2MA5 A;  4FO9 A;  2L43 A;  2DX8 A;  2MUM A;  2YHO A;  4GND A;  2JMJ A;  4AUQ B;  2HDP A;  5LCW B;  5KH3 A;  4FJC A;  5JG6 A;  5B79 A;  4X3G A;  1X4I A;  2M1R A;  2ECG A;  2MA6 A;  5G05 B;  4ZQL A;  2VNF A;  3O34 A;  4S3O B;  2I50 A;  3N9Q A;  2VPD A;  4TKP B;  3QZV A;  3ZVZ B;  3KQI A;  1Z6U A;  2YSJ A;  3MHH A;  4R7E A;  5C13 A;  2KGI A;  3LQI A;  2LGL A;  3L11 A;  5KH7 A;  4A4C A;  4L58 A;  5AIT A;  3HTK C;  4PTB A;  1IYM A;  4Q6F A;  4LAD B;  3ZPV E;  2UZG A;  5G04 B;  3SOX A;  2KRE A;  2MNY A;  2Y1M A;  2F6J A;  2AN6 A;  2M3H A;  5TBN A;  4YAD A;  3ZTG A;  4XI1 A;  2C2V S;  5I3L A;  3N9P A;  2LV9 A;  1WEQ A;  4LLB A;  4V3L C;  5DIN A;  3U5P A;  4NN2 A;  2XB1 A;  4O64 A;  3HCT A;  3PHD A;  1JM7 B;  5DKA A;  3O7A A;  5G0F A;  2LXP C;  4GB0 A;  2BAY A;  2MT5 A;  2MNZ A;  5TDW A;  2KWO A;  2KWN A;  2VPG A;  2L5U A;  5B75 A;  4IC2 A;  3RTR B;  1Z60 A;  3PUR A;  2CT2 A;  1V87 A;  3M62 A;  2VP7 A;  2ECT A;  2K17 A;  4I7B A;  4CCG X;  3GV4 A;  4YBM A;  4B86 C;  3C6W A;  2KGG A;  5FER A;  5TAB A;  1MM2 A;  3O35 A;  2KWK A;  5B77 A;  2KIZ A;  2OXQ C;  3T7L A;  1VD4 A;  1T1H A;  2LRI C;  4S3O C;  2CSZ A;  4I7D A;  3N9N A;  2LXH C;  2VPB A;  2FSA A;  2IDA A;  2YSM A;  2JMD A;  1U6G B;  2VPE A;  2KFT A;  5LKU A;  3ZYQ A;  4UI9 B;  5J3X A;  3U5N A;  5FB1 A;  3HCU A;  2KR4 A;  2LN0 A;  2LDR A;  2YUC A;  2ZET C;  3FL2 A;  4R2Y A;  1WES A;  4YAB A;  4LK9 A;  2M85 A;  2MD7 B;  2RSD A;  5LKX A;  4YAT A;  2VJF A;  4AYC B;  2F6N A;  3ZNI A;  3ASL A;  5H9M A;  3MHS A;  3O36 A;  1BOR A;  2PNX A;  3O70 A;  3L1Z B;  2KU3 A;  2XEU A;  3RPG C;  2G45 A;  2ECN A;  3N9L A;  3ZVY A;  4P5O B;  3DPL R;  2H0D B;  4UP5 A;  5AIU A;  5H1T A;  5TDR A;  3ZPV 1;  2ECJ A;  2YW8 A;  4A49 A;  2CKL A;  4C9Z A;  4QF3 A;  3M99 A;  4UP0 A;  4BBQ A;  3EB6 A;  3V43 A;  3EB5 A;  2D8S A;  3HCS A;  1WEN A;  2VJE B;  4GNG A;  4MVT A;  1LDJ B;  4LKA A;  4YBT A;  2L0B A;  4N4F A;  1HYJ A;  4IC3 A;  1WGM A;  3SOW A;  1WEW A;  2LGG A;  2YQL A;  2MD8 C;  2FUI A;  3IHP A;  1LDK C;  2E6R A;  5B8D A;  1WFK A;  2YUR A;  1HYI A;  2ECI A;  1CHC A;  3T6R A;  4B7Y C;  2FUU A;  3U5M A;  1WEP A;  3O37 A;  4BHW A;  4FIP A;  1VFY A;  1DVP A;  4AP4 A;  5D1L B;  5FEY A;  2EOD A;  2K16 A;  2M6M A;  2QJ0 A;  4CA1 A;  1WEU A;  3N9M A;  4YC9 A;  3GL6 A;  4LJN A;  3KNV A;  2QIC A;  2KYU A;  2KWJ A;  2QIZ A;  2HYE D;  4I7C A;  2Y1N A;  1VYX A;  3LQJ A;  3KV6 A;  3C5K A;  1ZBD B;  5TRB A;  1E4U A;  1WIM A;  1WEO A;  3U5O A;  1WE9 A;  2VJF B;  2JMI A;  4WZ3 B;  5FB0 A;  4GNF A;  4WZ2 A;  2G6Q A;  4W4U A;  5EYA F;  2Y43 A;  2ECV A;  4F52 B;  1G25 A;  4A0C D;  5LKT A;  2L75 A;  4WZ0 A;  4MSX A;  1WEV A;  2E6S A;  4V3K C;  1X4U A;  5D1M B;  1WEM A;  2CKL B;  4AYC A;  4L7X A;  3N9O A;  4AVX A;  4A4B A; 
#chains in the Genus database with same CATH topology
 2YQM A;  4ZDT A;  4FK5 A;  3O33 A;  5K3Q A;  1FP0 A;  3I2D A;  2PUY A;  4GNE A;  3LRQ A;  4ZUX U;  2ECW A;  1X4J A;  3VK6 A;  2XOY A;  4OGC A;  5D1K B;  3PUQ A;  1RMD A;  2LGV A;  2H0D A;  2L80 A;  2YT5 A;  1Z2Q A;  4N3W A;  3RPG B;  1JOC A;  2JUN A;  2YRE A;  1MM3 A;  4YAX A;  2F42 A;  2EA6 A;  2XOZ A;  3LJU X;  1XWH A;  1N87 A;  2KE1 A;  2C2L A;  2VJE A;  2YHN A;  3NG2 A;  4H9D A;  3M7K A;  1JM7 A;  2G43 A;  4PPE A;  1F62 A;  1WIL A;  3SOU A;  4QF2 A;  5H1V A;  1K2F A;  3DQV R;  3L1X A;  1FBV A;  5C11 A;  4YBS A;  4WA6 A;  2EGP A;  2LGK A;  3M63 A;  5LKZ A;  2LQ6 A;  5KH9 A;  4R8P K;  2XP0 A;  3SHB A;  2K1J A;  4Z0R A;  2K4D A;  2JRJ A;  5B78 A;  2NAA A;  3KV5 A;  1WEE A;  2MIQ A;  2CSY A;  2YYR A;  5H1U A;  2RI7 A;  5B76 A;  2YU4 A;  3LQH A;  2MA5 A;  4FO9 A;  2L43 A;  2DX8 A;  2MUM A;  2YHO A;  4GND A;  2JMJ A;  3FAO A;  4AUQ B;  2HDP A;  5LCW B;  5KH3 A;  4Z0O A;  4FJC A;  5JG6 A;  5B79 A;  4X3G A;  1X4I A;  2M1R A;  2ECG A;  2MA6 A;  5G05 B;  1DCQ A;  4ZQL A;  3FEH A;  2VNF A;  3O34 A;  4S3O B;  2YVR A;  2CON A;  3E2D A;  2I50 A;  2EGM A;  3N9Q A;  2VPD A;  4TKP B;  3QZV A;  3ZVZ B;  3KQI A;  2LAU A;  1Z6U A;  2YSJ A;  3MHH A;  4R7E A;  5C13 A;  2KGI A;  3LQI A;  2LGL A;  3L11 A;  5KH7 A;  4A4C A;  4L58 A;  5AIT A;  2EXU A;  3HTK C;  4PTB A;  1IYM A;  4Q6F A;  4LAD B;  3ZPV E;  2UZG A;  5G04 B;  3SOX A;  2KRE A;  2MNY A;  2Y1M A;  2F6J A;  2AN6 A;  2M3H A;  5TBN A;  4YAD A;  3ZTG A;  2P57 A;  4XI1 A;  2C2V S;  5I3L A;  3N9P A;  2LV9 A;  3SUB A;  1WEQ A;  4LLB A;  4V3L C;  5DIN A;  3LDY A;  3U5P A;  4F1P A;  4NN2 A;  2XB1 A;  2CSV A;  4O64 A;  3HCT A;  3PHD A;  3PLW A;  1JM7 B;  5DKA A;  2KKX A;  3O7A A;  2MKE A;  2B0O E;  5G0F A;  2LXP C;  4GB0 A;  2BAY A;  2MT5 A;  2RR4 A;  2MNZ A;  5TDW A;  2KWO A;  3LVQ E;  2KWN A;  2VPG A;  2L5U A;  5B75 A;  1MBM A;  4IC2 A;  3RTR B;  1Z60 A;  5SVY A;  3PUR A;  2CT2 A;  1V87 A;  3M62 A;  4O62 A;  2VP7 A;  3MDB C;  2ECT A;  2K17 A;  4I7B A;  4CCG X;  3GV4 A;  4YBM A;  4B86 C;  3C6W A;  2KGG A;  5FER A;  2DJA A;  5TAB A;  1MM2 A;  3O35 A;  2KWK A;  5B77 A;  2KIZ A;  2CRR A;  2OXQ C;  3T7L A;  5SVI B;  1VD4 A;  1T1H A;  2LRI C;  4S3O C;  2CSZ A;  2CRW A;  4I7D A;  3LVR E;  3N9N A;  2LXH C;  2VPB A;  2FSA A;  2IDA A;  2YSM A;  2JMD A;  3O47 A;  3Q1D A;  1U6G B;  2VPE A;  2KFT A;  5LKU A;  3ZYQ A;  4UI9 B;  5J3X A;  3U5N A;  5FB1 A;  3HCU A;  2KR4 A;  2LN0 A;  2LDR A;  2YUC A;  2ZET C;  3DDT A;  3FL2 A;  4R2Y A;  1WES A;  4YAB A;  4LK9 A;  2M85 A;  2MD7 B;  2RSD A;  5LKX A;  4YAT A;  2VJF A;  4AYC B;  2F6N A;  3ZNI A;  3ASL A;  5H9M A;  3MHS A;  3FAN A;  3O36 A;  1BOR A;  2PNX A;  3O70 A;  5SVX A;  4QQ4 A;  3L1Z B;  2KU3 A;  2XEU A;  3RPG C;  2G45 A;  2ECN A;  3N9L A;  3ZVY A;  4P5O B;  3DPL R;  2H0D B;  4UP5 A;  5AIU A;  5H1T A;  5TDR A;  3ZPV 1;  2ECJ A;  2YW8 A;  4A49 A;  2CKL A;  4C9Z A;  4QF3 A;  3M99 A;  4UP0 A;  4BBQ A;  3EB6 A;  3V43 A;  3EB5 A;  2OWA A;  2D8U A;  2D8S A;  3HCS A;  1WEN A;  2VJE B;  4GNG A;  4MVT A;  1LDJ B;  4LKA A;  4YBT A;  2L0B A;  2FD4 A;  4N4F A;  1HYJ A;  4IC3 A;  1WGM A;  3SOW A;  1WEW A;  2XOC A;  2LGG A;  2YQL A;  2MD8 C;  2FUI A;  3IHP A;  1LDK C;  2E6R A;  5B8D A;  1WFK A;  2YUR A;  2KKY A;  1HYI A;  2ECI A;  1CHC A;  3T6R A;  4B7Y C;  2FUU A;  3U5M A;  1WEP A;  3O37 A;  4BHW A;  4FIP A;  1VFY A;  1DVP A;  4AP4 A;  5D1L B;  3JUE A;  5FEY A;  2EOD A;  2K16 A;  2M13 A;  2M6M A;  2QJ0 A;  4CA1 A;  1WEU A;  3N9M A;  4YC9 A;  3GL6 A;  4OGE A;  2DSM A;  4LJN A;  3KNV A;  2QIC A;  2KYU A;  2KWJ A;  2QIZ A;  2HYE D;  4I7C A;  2Y1N A;  3H7H A;  1VYX A;  3LQJ A;  3KV6 A;  3C5K A;  1ZBD B;  3FJU B;  2L7P A;  5TRB A;  1E4U A;  1WIM A;  5SVI A;  1WEO A;  3KDE C;  3U5O A;  1WE9 A;  3FM8 C;  2VJF B;  2JMI A;  4WZ3 B;  5FB0 A;  4GNF A;  4WZ2 A;  3T9K A;  2G6Q A;  4W4U A;  5EYA F;  2Y43 A;  2ECV A;  4F52 B;  1G25 A;  4A0C D;  2FFW A;  3DWD A;  5LKT A;  2L75 A;  4WZ0 A;  4MSX A;  2IQJ A;  1WEV A;  2E6S A;  4V3K C;  1X4U A;  5D1M B;  1WEM A;  2JM3 A;  2CKL B;  2E61 A;  4AYC A;  4L7X A;  3N9O A;  4AVX A;  4A4B A; 
#chains in the Genus database with same CATH homology
 2YQM A;  4ZDT A;  4FK5 A;  3O33 A;  1FP0 A;  3I2D A;  2PUY A;  4GNE A;  3LRQ A;  4ZUX U;  2ECW A;  1X4J A;  3VK6 A;  5D1K B;  3PUQ A;  1RMD A;  2LGV A;  2H0D A;  2L80 A;  2YT5 A;  1Z2Q A;  4N3W A;  3RPG B;  1JOC A;  2YRE A;  4YAX A;  1MM3 A;  2F42 A;  2EA6 A;  1XWH A;  1N87 A;  2KE1 A;  2C2L A;  2VJE A;  2YHN A;  3NG2 A;  1JM7 A;  2G43 A;  4PPE A;  1F62 A;  1WIL A;  3SOU A;  4QF2 A;  5H1V A;  1K2F A;  3DQV R;  3L1X A;  1FBV A;  5C11 A;  4YBS A;  4WA6 A;  2EGP A;  2LGK A;  3M63 A;  5LKZ A;  2LQ6 A;  5KH9 A;  4R8P K;  3SHB A;  2K1J A;  2K4D A;  2JRJ A;  5B78 A;  2NAA A;  3KV5 A;  1WEE A;  2MIQ A;  2CSY A;  2YYR A;  5H1U A;  2RI7 A;  5B76 A;  2YU4 A;  3LQH A;  2MA5 A;  4FO9 A;  2L43 A;  2DX8 A;  2MUM A;  2YHO A;  4GND A;  2JMJ A;  4AUQ B;  2HDP A;  5LCW B;  5KH3 A;  4FJC A;  5JG6 A;  5B79 A;  4X3G A;  1X4I A;  2M1R A;  2ECG A;  2MA6 A;  5G05 B;  4ZQL A;  2VNF A;  3O34 A;  4S3O B;  2I50 A;  3N9Q A;  2VPD A;  4TKP B;  3QZV A;  3ZVZ B;  3KQI A;  1Z6U A;  2YSJ A;  3MHH A;  4R7E A;  5C13 A;  2KGI A;  3LQI A;  2LGL A;  3L11 A;  5KH7 A;  4A4C A;  4L58 A;  5AIT A;  3HTK C;  4PTB A;  1IYM A;  4Q6F A;  4LAD B;  3ZPV E;  2UZG A;  5G04 B;  3SOX A;  2KRE A;  2MNY A;  2Y1M A;  2F6J A;  2AN6 A;  2M3H A;  5TBN A;  4YAD A;  3ZTG A;  4XI1 A;  2C2V S;  5I3L A;  3N9P A;  2LV9 A;  1WEQ A;  4LLB A;  4V3L C;  5DIN A;  3U5P A;  4NN2 A;  2XB1 A;  4O64 A;  3HCT A;  3PHD A;  1JM7 B;  5DKA A;  3O7A A;  5G0F A;  2LXP C;  4GB0 A;  2BAY A;  2MT5 A;  2MNZ A;  5TDW A;  2KWO A;  2KWN A;  2VPG A;  2L5U A;  5B75 A;  4IC2 A;  3RTR B;  1Z60 A;  3PUR A;  2CT2 A;  1V87 A;  3M62 A;  2VP7 A;  2ECT A;  2K17 A;  4I7B A;  4CCG X;  3GV4 A;  4YBM A;  4B86 C;  3C6W A;  2KGG A;  5FER A;  5TAB A;  1MM2 A;  3O35 A;  2KWK A;  5B77 A;  2KIZ A;  2OXQ C;  3T7L A;  1VD4 A;  1T1H A;  2LRI C;  4S3O C;  2CSZ A;  4I7D A;  3N9N A;  2LXH C;  2VPB A;  2FSA A;  2IDA A;  2YSM A;  2JMD A;  1U6G B;  2VPE A;  2KFT A;  5LKU A;  3ZYQ A;  4UI9 B;  5J3X A;  3U5N A;  5FB1 A;  3HCU A;  2KR4 A;  2LN0 A;  2LDR A;  2YUC A;  2ZET C;  3FL2 A;  4R2Y A;  1WES A;  4YAB A;  4LK9 A;  2M85 A;  2MD7 B;  2RSD A;  5LKX A;  4YAT A;  2VJF A;  4AYC B;  2F6N A;  3ZNI A;  3ASL A;  5H9M A;  3MHS A;  3O36 A;  1BOR A;  2PNX A;  3O70 A;  3L1Z B;  2KU3 A;  2XEU A;  3RPG C;  2G45 A;  2ECN A;  3N9L A;  3ZVY A;  4P5O B;  3DPL R;  2H0D B;  4UP5 A;  5AIU A;  5H1T A;  5TDR A;  3ZPV 1;  2ECJ A;  2YW8 A;  4A49 A;  2CKL A;  4C9Z A;  4QF3 A;  3M99 A;  4UP0 A;  4BBQ A;  3EB6 A;  3V43 A;  3EB5 A;  2D8S A;  3HCS A;  1WEN A;  2VJE B;  4GNG A;  4MVT A;  1LDJ B;  4LKA A;  4YBT A;  2L0B A;  4N4F A;  1HYJ A;  4IC3 A;  1WGM A;  3SOW A;  1WEW A;  2LGG A;  2YQL A;  2MD8 C;  2FUI A;  3IHP A;  1LDK C;  2E6R A;  5B8D A;  1WFK A;  2YUR A;  1HYI A;  2ECI A;  1CHC A;  3T6R A;  4B7Y C;  2FUU A;  3U5M A;  1WEP A;  3O37 A;  4BHW A;  4FIP A;  1VFY A;  1DVP A;  4AP4 A;  5D1L B;  5FEY A;  2EOD A;  2K16 A;  2M6M A;  2QJ0 A;  4CA1 A;  1WEU A;  3N9M A;  4YC9 A;  3GL6 A;  4LJN A;  3KNV A;  2QIC A;  2KYU A;  2KWJ A;  2QIZ A;  2HYE D;  4I7C A;  2Y1N A;  1VYX A;  3LQJ A;  3KV6 A;  3C5K A;  1ZBD B;  5TRB A;  1E4U A;  1WIM A;  1WEO A;  3U5O A;  1WE9 A;  2VJF B;  2JMI A;  4WZ3 B;  5FB0 A;  4GNF A;  4WZ2 A;  2G6Q A;  4W4U A;  5EYA F;  2Y43 A;  2ECV A;  4F52 B;  1G25 A;  4A0C D;  5LKT A;  2L75 A;  4WZ0 A;  4MSX A;  1WEV A;  2E6S A;  4V3K C;  1X4U A;  5D1M B;  1WEM A;  2CKL B;  4AYC A;  4L7X A;  3N9O A;  4AVX A;  4A4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...