2M3HA

Structure of dido phd domain
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
61
structure length
61
Chain Sequence
GSMDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death-inducer obliterator 1
publication title NMR structure note: PHD domain from death inducer obliterator protein and its interaction with H3K4me3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 7
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2013-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2m3hA00
2MA5A 3VK6A 2PUYA 3LRQA 4YADA 5LKTA 4I7CA 4N4FA 2VNFA 3T7LA 4MSXA 1X4IA 2K16A 4IC2A 2QIZA 3HCSA 3O70A 5AITA 2Y43A 3N9NA 2YHOA 2QJ0A 5FERA 2EA6A 4A4CA 3DQVR 2FUIA 2MNYA 3RPGC 2KIZA 2YQLA 2C2VS 2JMJA 2MD7B 1HYIA 4UP0A 2K4DA 2ECNA 4MVTA 1BORA 2E6SA 4F52B 3MHSA 4S3OB 3KQIA 3U5PA 5C11A 2KGGA 1JM7A 4AYCB 5TRBA 2VPGA 4XI1A 4NN2A 5G0FA 2QICA 1WEQA 2LXHC 1WESA 4GNDA 3NG2A 3O7AA 2G43A 2YREA 2KE1A 2CT2A 2ECTA 2LGGA 2K1JA 2Y1MA 3U5OA 3LQJA 1K2FA 1VFYA 2K17A 4FJCA 2YU4A 1T1HA 2KU3A 2KYUA 2EGPA 4LJNA 3ASLA 2RSDA 5FEYA 2JMDA 1WEWA 3SOUA 4A49A 2ECGA 3ZPV1 4B86C 2KWNA 2YW8A 5D1KB 1G25A 3ZNIA 2JRJA 2KWJA 1WEMA 3T6RA 3SOWA 4QF2A 1WEPA 5LKZA 3GV4A 5G04B 2L75A 4LADB 1LDJB 2L43A 2H0DA 5FB0A 2JMIA 4B7YC 2CKLA 3O35A 4FK5A 4WZ2A 4S3OC 2VJFB 1XWHA 3FL2A 5TDRA 2YHNA 4YC9A 2YT5A 4R8PK 4CCGX 3L1XA 1N87A 4GNEA 3PURA 2KWKA 2M85A 2DX8A 2IDAA 2KGIA 3DPLR 5B75A 1WILA 3N9OA 1RMDA 4BHWA 3GL6A 4LKAA 4FIPA 1FP0A 3EB5A 2BAYA 1JM7B 2LXPC 2F6NA 5KH3A 4YABA 4V3LC 5D1MB 5TDWA 2YQMA 1Z2QA 4YBTA 3PUQA 4V3KC 3SOXA 1E4UA 4I7DA 2VJEB 2MUMA 3IHPA 5H1TA 1DVPA 2VPEA 4A4BA 3M63A 5C13A 3C6WA 2LQ6A 1X4UA 2NAAA 2MT5A 3O37A 3N9LA 4I7BA 3C5KA 3RTRB 2ECVA 1WENA 2G45A 4L58A 5KH7A 4A0CD 4AYCA 4CA1A 1V87A 5JG6A 5TBNA 3O34A 2YURA 3HCUA 1X4JA 4O64A 3O33A 2L5UA 2M1RA 5D1LB 3MHHA 2E6RA 5FB1A 4YATA 4X3GA 2G6QA 5TABA 5KH9A 5LKUA 4AUQB 4WZ0A 2MNZA 3SHBA 2VP7A 2MA6A 2L80A 5EYAF 2XEUA 4UI9B 2RI7A 2KR4A 4Q6FA 4W4UA 3ZYQA 1WEEA 2CKLB 4UP5A 4PTBA 4N3WA 2UZGA 1LDKC 5J3XA 1FBVA 5LCWB 3LQHA 2PNXA 2KREA 5AIUA 4WA6A 2CSYA 5DKAA 4AP4A 2F6JA 1VD4A 4ZQLA 1MM2A 4C9ZA 2LN0A 3ZTGA 2M6MA 4LK9A 4WZ3B 3ZPVE 5B77A 1F62A 2YSJA 4YAXA 1WIMA 5I3LA 3KV6A 3KNVA 1CHCA 4YBSA 4ZUXU 4R2YA 2HDPA 2MIQA 4BBQA 2VJFA 2LV9A 2F42A 4YBMA 5G05B 2KFTA 1ZBDB 3N9QA 1MM3A 4R7EA 2HYED 4GNFA 5LKXA 1WEOA 3O36A 2YUCA 3HTKC 3QZVA 3N9PA 3ZVZB 3M99A 5H1VA 4P5OB 1WE9A 2LGLA 2FUUA 4TKPB 3U5NA 3RPGB 3EB6A 2ECIA 4GNGA 5B78A 1JOCA 2C2LA 3V43A 5B76A 5H1UA 1WGMA 2EODA 4ZDTA 2YYRA 3HCTA 4GB0A 2D8SA 2ECWA 3M62A 1WFKA 2I50A 2VJEA 3I2DA 2VPBA 1U6GB 1IYMA 2YSMA 2LRIC 2VPDA 4FO9A 2CSZA 2Y1NA 1HYJA 2LGVA 2ZETC 3PHDA 2L0BA 3N9MA 3L11A 2KWOA 3U5MA 1Z60A 4PPEA 4IC3A 5B79A 2LDRA 2XB1A 2MD8C 3ZVYA 3LQIA 2H0DB 1VYXA 2M3HA 2ECJA 2LGKA 2AN6A 4LLBA 3KV5A 5H9MA 4AVXA 2FSAA 1WEVA 5DINA 1WEUA 4QF3A 2OXQC 3L1ZB 4L7XA 5B8DA 1Z6UA
chains in the Genus database with same CATH superfamily
5SVYA 2MA5A 3VK6A 2PUYA 3LRQA 4YADA 1Z6UA 4I7CA 5LKTA 4N4FA 2VNFA 3T7LA 2XOCA 4MSXA 1X4IA 2K16A 4IC2A 2QIZA 3HCSA 3O70A 5AITA 2DSMA 2Y43A 3N9NA 2YHOA 2QJ0A 5FERA 2EA6A 3H7HA 4A4CA 3DQVR 2FUIA 2MNYA 5K3QA 3RPGC 2KIZA 2YQLA 2C2VS 2JMJA 2MD7B 1HYIA 4UP0A 5SVIB 2K4DA 2ECNA 4MVTA 1BORA 2E6SA 3FEHA 4F52B 3MHSA 4S3OB 3KQIA 3U5PA 5C11A 4OGCA 2KGGA 1JM7A 4AYCB 5TRBA 2M13A 2VPGA 4XI1A 4NN2A 5G0FA 2QICA 1WEQA 2LXHC 1WESA 4GNDA 3NG2A 3O7AA 2RR4A 2G43A 2YVRA 2YREA 2KE1A 2CT2A 2D8UA 2ECTA 2LAUA 2LGGA 2K1JA 2Y1MA 3U5OA 3LQJA 3O47A 1K2FA 3FM8C 1VFYA 2K17A 4FJCA 2YU4A 2OWAA 1T1HA 2KU3A 2KYUA 2EGPA 4H9DA 4LJNA 3ASLA 2RSDA 5FEYA 2JMDA 2JUNA 2KKYA 1WEWA 3SOUA 4A49A 2ECGA 3ZPV1 4B86C 2E61A 2KWNA 2YW8A 5D1KB 5SVXA 1G25A 3ZNIA 2JRJA 2KWJA 1WEMA 3T6RA 4OGEA 4Z0OA 2CONA 3SOWA 4QF2A 1WEPA 5LKZA 2P57A 3LVRE 3GV4A 5G04B 2L75A 4LADB 1LDJB 2L43A 2H0DA 5FB0A 2JMIA 4B7YC 2CKLA 3O35A 4FK5A 4WZ2A 2FD4A 4S3OC 2VJFB 1XWHA 3FL2A 5TDRA 2YHNA 4YC9A 2YT5A 4R8PK 2FFWA 4CCGX 3L1XA 1N87A 4GNEA 3PURA 2KWKA 2M85A 2DX8A 2IDAA 2KGIA 3DPLR 5B75A 1WILA 3N9OA 2EGMA 1RMDA 4BHWA 3GL6A 4LKAA 4FIPA 1FP0A 3EB5A 2BAYA 3LDYA 1JM7B 2LXPC 2F6NA 5KH3A 4YABA 4V3LC 5D1MB 5TDWA 2YQMA 1Z2QA 4YBTA 3LJUX 2CRWA 3PUQA 4QQ4A 4V3KC 3SOXA 1E4UA 4I7DA 2VJEB 2MUMA 3FJUB 3IHPA 5H1TA 1DVPA 2VPEA 4A4BA 3M63A 2B0OE 5C13A 3C6WA 5SVIA 2LQ6A 1X4UA 2NAAA 2MT5A 3O37A 3N9LA 4I7BA 3C5KA 3RTRB 2ECVA 4Z0RA 3JUEA 1WENA 2G45A 4L58A 2L7PA 5KH7A 4A0CD 4AYCA 4CA1A 1V87A 2CRRA 5JG6A 5TBNA 3O34A 2YURA 3HCUA 1X4JA 4O64A 3FANA 2L5UA 3O33A 2M1RA 5D1LB 3MHHA 2E6RA 3PLWA 5FB1A 4YATA 4X3GA 2G6QA 3MDBC 5TABA 5KH9A 5LKUA 4AUQB 4WZ0A 2MNZA 3SHBA 2VP7A 2MA6A 2L80A 5EYAF 2XEUA 4UI9B 2RI7A 2KR4A 2IQJA 3Q1DA 4Q6FA 4W4UA 1MBMA 3ZYQA 1WEEA 2CKLB 4UP5A 4PTBA 4N3WA 2UZGA 1LDKC 5J3XA 1FBVA 5LCWB 3LQHA 2PNXA 2KREA 3KDEC 5AIUA 4WA6A 2CSYA 5DKAA 3LVQE 4AP4A 2F6JA 1VD4A 4ZQLA 1MM2A 4C9ZA 2LN0A 4O62A 3ZTGA 2M6MA 4LK9A 4WZ3B 2DJAA 3ZPVE 5B77A 1F62A 2YSJA 4YAXA 1WIMA 4F1PA 5I3LA 3KV6A 3M7KA 3KNVA 1CHCA 4YBSA 4ZUXU 4R2YA 2HDPA 2MIQA 4BBQA 2VJFA 2LV9A 2F42A 4YBMA 5G05B 2KFTA 1ZBDB 2XOZA 3N9QA 1MM3A 2XOYA 4R7EA 2HYED 4GNFA 5LKXA 1WEOA 3O36A 2YUCA 2CSVA 3HTKC 3QZVA 3N9PA 3ZVZB 3M99A 5H1VA 3E2DA 4P5OB 1WE9A 2LGLA 2FUUA 4TKPB 3U5NA 3RPGB 3EB6A 2ECIA 4GNGA 3T9KA 5B78A 1JOCA 2C2LA 3FAOA 3V43A 5B76A 5H1UA 1WGMA 2EODA 4ZDTA 2YYRA 2XP0A 3HCTA 4GB0A 2D8SA 2ECWA 3M62A 1WFKA 2I50A 2MKEA 2VJEA 3I2DA 2VPBA 1U6GB 1IYMA 2YSMA 2LRIC 2VPDA 4FO9A 2CSZA 2Y1NA 1HYJA 3SUBA 2LGVA 2ZETC 1DCQA 3PHDA 2L0BA 3N9MA 3L11A 2KWOA 3U5MA 1Z60A 2KKXA 4PPEA 4IC3A 5B79A 2JM3A 2LDRA 2XB1A 2MD8C 3ZVYA 3LQIA 2H0DB 1VYXA 2M3HA 2ECJA 2LGKA 2EXUA 2AN6A 4LLBA 3KV5A 5H9MA 4AVXA 2FSAA 1WEVA 5DINA 1WEUA 3DDTA 4QF3A 2OXQC 3L1ZB 4L7XA 5B8DA 3DWDA
chains in the Genus database with same CATH topology
2MA5A 3VK6A 2PUYA 3LRQA 4YADA 5LKTA 4I7CA 4N4FA 2VNFA 3T7LA 4MSXA 1X4IA 2K16A 4IC2A 2QIZA 3HCSA 3O70A 5AITA 2Y43A 3N9NA 2YHOA 2QJ0A 5FERA 2EA6A 4A4CA 3DQVR 2FUIA 2MNYA 3RPGC 2KIZA 2YQLA 2C2VS 2JMJA 2MD7B 1HYIA 4UP0A 2K4DA 2ECNA 4MVTA 1BORA 2E6SA 4F52B 3MHSA 4S3OB 3KQIA 3U5PA 5C11A 2KGGA 1JM7A 4AYCB 5TRBA 2VPGA 4XI1A 4NN2A 5G0FA 2QICA 1WEQA 2LXHC 1WESA 4GNDA 3NG2A 3O7AA 2G43A 2YREA 2KE1A 2CT2A 2ECTA 2LGGA 2K1JA 2Y1MA 3U5OA 3LQJA 1K2FA 1VFYA 2K17A 4FJCA 2YU4A 1T1HA 2KU3A 2KYUA 2EGPA 4LJNA 3ASLA 2RSDA 5FEYA 2JMDA 1WEWA 3SOUA 4A49A 2ECGA 3ZPV1 4B86C 2KWNA 2YW8A 5D1KB 1G25A 3ZNIA 2JRJA 2KWJA 1WEMA 3T6RA 3SOWA 4QF2A 1WEPA 5LKZA 3GV4A 5G04B 2L75A 4LADB 1LDJB 2L43A 2H0DA 5FB0A 2JMIA 4B7YC 2CKLA 3O35A 4FK5A 4WZ2A 4S3OC 2VJFB 1XWHA 3FL2A 5TDRA 2YHNA 4YC9A 2YT5A 4R8PK 4CCGX 3L1XA 1N87A 4GNEA 3PURA 2KWKA 2M85A 2DX8A 2IDAA 2KGIA 3DPLR 5B75A 1WILA 3N9OA 1RMDA 4BHWA 3GL6A 4LKAA 4FIPA 1FP0A 3EB5A 2BAYA 1JM7B 2LXPC 2F6NA 5KH3A 4YABA 4V3LC 5D1MB 5TDWA 2YQMA 1Z2QA 4YBTA 3PUQA 4V3KC 3SOXA 1E4UA 4I7DA 2VJEB 2MUMA 3IHPA 5H1TA 1DVPA 2VPEA 4A4BA 3M63A 5C13A 3C6WA 2LQ6A 1X4UA 2NAAA 2MT5A 3O37A 3N9LA 4I7BA 3C5KA 3RTRB 2ECVA 1WENA 2G45A 4L58A 5KH7A 4A0CD 4AYCA 4CA1A 1V87A 5JG6A 5TBNA 3O34A 2YURA 3HCUA 1X4JA 4O64A 3O33A 2L5UA 2M1RA 5D1LB 3MHHA 2E6RA 5FB1A 4YATA 4X3GA 2G6QA 5TABA 5KH9A 5LKUA 4AUQB 4WZ0A 2MNZA 3SHBA 2VP7A 2MA6A 2L80A 5EYAF 2XEUA 4UI9B 2RI7A 2KR4A 4Q6FA 4W4UA 3ZYQA 1WEEA 2CKLB 4UP5A 4PTBA 4N3WA 2UZGA 1LDKC 5J3XA 1FBVA 5LCWB 3LQHA 2PNXA 2KREA 5AIUA 4WA6A 2CSYA 5DKAA 4AP4A 2F6JA 1VD4A 4ZQLA 1MM2A 4C9ZA 2LN0A 3ZTGA 2M6MA 4LK9A 4WZ3B 3ZPVE 5B77A 1F62A 2YSJA 4YAXA 1WIMA 5I3LA 3KV6A 3KNVA 1CHCA 4YBSA 4ZUXU 4R2YA 2HDPA 2MIQA 4BBQA 2VJFA 2LV9A 2F42A 4YBMA 5G05B 2KFTA 1ZBDB 3N9QA 1MM3A 4R7EA 2HYED 4GNFA 5LKXA 1WEOA 3O36A 2YUCA 3HTKC 3QZVA 3N9PA 3ZVZB 3M99A 5H1VA 4P5OB 1WE9A 2LGLA 2FUUA 4TKPB 3U5NA 3RPGB 3EB6A 2ECIA 4GNGA 5B78A 1JOCA 2C2LA 3V43A 5B76A 5H1UA 1WGMA 2EODA 4ZDTA 2YYRA 3HCTA 4GB0A 2D8SA 2ECWA 3M62A 1WFKA 2I50A 2VJEA 3I2DA 2VPBA 1U6GB 1IYMA 2YSMA 2LRIC 2VPDA 4FO9A 2CSZA 2Y1NA 1HYJA 2LGVA 2ZETC 3PHDA 2L0BA 3N9MA 3L11A 2KWOA 3U5MA 1Z60A 4PPEA 4IC3A 5B79A 2LDRA 2XB1A 2MD8C 3ZVYA 3LQIA 2H0DB 1VYXA 2M3HA 2ECJA 2LGKA 2AN6A 4LLBA 3KV5A 5H9MA 4AVXA 2FSAA 1WEVA 5DINA 1WEUA 4QF3A 2OXQC 3L1ZB 4L7XA 5B8DA 1Z6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MA5 A;  3VK6 A;  2PUY A;  3LRQ A;  4YAD A;  5LKT A;  4I7C A;  4N4F A;  2VNF A;  3T7L A;  4MSX A;  1X4I A;  2K16 A;  4IC2 A;  2QIZ A;  3HCS A;  3O70 A;  5AIT A;  2Y43 A;  3N9N A;  2YHO A;  2QJ0 A;  5FER A;  2EA6 A;  4A4C A;  3DQV R;  2FUI A;  2MNY A;  3RPG C;  2KIZ A;  2YQL A;  2C2V S;  2JMJ A;  2MD7 B;  1HYI A;  4UP0 A;  2K4D A;  2ECN A;  4MVT A;  1BOR A;  2E6S A;  4F52 B;  3MHS A;  4S3O B;  3KQI A;  3U5P A;  5C11 A;  2KGG A;  1JM7 A;  4AYC B;  5TRB A;  2VPG A;  4XI1 A;  4NN2 A;  5G0F A;  2QIC A;  1WEQ A;  2LXH C;  1WES A;  4GND A;  3NG2 A;  3O7A A;  2G43 A;  2YRE A;  2KE1 A;  2CT2 A;  2ECT A;  2LGG A;  2K1J A;  2Y1M A;  3U5O A;  3LQJ A;  1K2F A;  1VFY A;  2K17 A;  4FJC A;  2YU4 A;  1T1H A;  2KU3 A;  2KYU A;  2EGP A;  4LJN A;  3ASL A;  2RSD A;  5FEY A;  2JMD A;  1WEW A;  3SOU A;  4A49 A;  2ECG A;  3ZPV 1;  4B86 C;  2KWN A;  2YW8 A;  5D1K B;  1G25 A;  3ZNI A;  2JRJ A;  2KWJ A;  1WEM A;  3T6R A;  3SOW A;  4QF2 A;  1WEP A;  5LKZ A;  3GV4 A;  5G04 B;  2L75 A;  4LAD B;  1LDJ B;  2L43 A;  2H0D A;  5FB0 A;  2JMI A;  4B7Y C;  2CKL A;  3O35 A;  4FK5 A;  4WZ2 A;  4S3O C;  2VJF B;  1XWH A;  3FL2 A;  5TDR A;  2YHN A;  4YC9 A;  2YT5 A;  4R8P K;  4CCG X;  3L1X A;  1N87 A;  4GNE A;  3PUR A;  2KWK A;  2M85 A;  2DX8 A;  2IDA A;  2KGI A;  3DPL R;  5B75 A;  1WIL A;  3N9O A;  1RMD A;  4BHW A;  3GL6 A;  4LKA A;  4FIP A;  1FP0 A;  3EB5 A;  2BAY A;  1JM7 B;  2LXP C;  2F6N A;  5KH3 A;  4YAB A;  4V3L C;  5D1M B;  5TDW A;  2YQM A;  1Z2Q A;  4YBT A;  3PUQ A;  4V3K C;  3SOX A;  1E4U A;  4I7D A;  2VJE B;  2MUM A;  3IHP A;  5H1T A;  1DVP A;  2VPE A;  4A4B A;  3M63 A;  5C13 A;  3C6W A;  2LQ6 A;  1X4U A;  2NAA A;  2MT5 A;  3O37 A;  3N9L A;  4I7B A;  3C5K A;  3RTR B;  2ECV A;  1WEN A;  2G45 A;  4L58 A;  5KH7 A;  4A0C D;  4AYC A;  4CA1 A;  1V87 A;  5JG6 A;  5TBN A;  3O34 A;  2YUR A;  3HCU A;  1X4J A;  4O64 A;  3O33 A;  2L5U A;  2M1R A;  5D1L B;  3MHH A;  2E6R A;  5FB1 A;  4YAT A;  4X3G A;  2G6Q A;  5TAB A;  5KH9 A;  5LKU A;  4AUQ B;  4WZ0 A;  2MNZ A;  3SHB A;  2VP7 A;  2MA6 A;  2L80 A;  5EYA F;  2XEU A;  4UI9 B;  2RI7 A;  2KR4 A;  4Q6F A;  4W4U A;  3ZYQ A;  1WEE A;  2CKL B;  4UP5 A;  4PTB A;  4N3W A;  2UZG A;  1LDK C;  5J3X A;  1FBV A;  5LCW B;  3LQH A;  2PNX A;  2KRE A;  5AIU A;  4WA6 A;  2CSY A;  5DKA A;  4AP4 A;  2F6J A;  1VD4 A;  4ZQL A;  1MM2 A;  4C9Z A;  2LN0 A;  3ZTG A;  2M6M A;  4LK9 A;  4WZ3 B;  3ZPV E;  5B77 A;  1F62 A;  2YSJ A;  4YAX A;  1WIM A;  5I3L A;  3KV6 A;  3KNV A;  1CHC A;  4YBS A;  4ZUX U;  4R2Y A;  2HDP A;  2MIQ A;  4BBQ A;  2VJF A;  2LV9 A;  2F42 A;  4YBM A;  5G05 B;  2KFT A;  1ZBD B;  3N9Q A;  1MM3 A;  4R7E A;  2HYE D;  4GNF A;  5LKX A;  1WEO A;  3O36 A;  2YUC A;  3HTK C;  3QZV A;  3N9P A;  3ZVZ B;  3M99 A;  5H1V A;  4P5O B;  1WE9 A;  2LGL A;  2FUU A;  4TKP B;  3U5N A;  3RPG B;  3EB6 A;  2ECI A;  4GNG A;  5B78 A;  1JOC A;  2C2L A;  3V43 A;  5B76 A;  5H1U A;  1WGM A;  2EOD A;  4ZDT A;  2YYR A;  3HCT A;  4GB0 A;  2D8S A;  2ECW A;  3M62 A;  1WFK A;  2I50 A;  2VJE A;  3I2D A;  2VPB A;  1U6G B;  1IYM A;  2YSM A;  2LRI C;  2VPD A;  4FO9 A;  2CSZ A;  2Y1N A;  1HYJ A;  2LGV A;  2ZET C;  3PHD A;  2L0B A;  3N9M A;  3L11 A;  2KWO A;  3U5M A;  1Z60 A;  4PPE A;  4IC3 A;  5B79 A;  2LDR A;  2XB1 A;  2MD8 C;  3ZVY A;  3LQI A;  2H0D B;  1VYX A;  2M3H A;  2ECJ A;  2LGK A;  2AN6 A;  4LLB A;  3KV5 A;  5H9M A;  4AVX A;  2FSA A;  1WEV A;  5DIN A;  1WEU A;  4QF3 A;  2OXQ C;  3L1Z B;  4L7X A;  5B8D A;  1Z6U A; 
#chains in the Genus database with same CATH topology
 5SVY A;  2MA5 A;  3VK6 A;  2PUY A;  3LRQ A;  4YAD A;  1Z6U A;  4I7C A;  5LKT A;  4N4F A;  2VNF A;  3T7L A;  2XOC A;  4MSX A;  1X4I A;  2K16 A;  4IC2 A;  2QIZ A;  3HCS A;  3O70 A;  5AIT A;  2DSM A;  2Y43 A;  3N9N A;  2YHO A;  2QJ0 A;  5FER A;  2EA6 A;  3H7H A;  4A4C A;  3DQV R;  2FUI A;  2MNY A;  5K3Q A;  3RPG C;  2KIZ A;  2YQL A;  2C2V S;  2JMJ A;  2MD7 B;  1HYI A;  4UP0 A;  5SVI B;  2K4D A;  2ECN A;  4MVT A;  1BOR A;  2E6S A;  3FEH A;  4F52 B;  3MHS A;  4S3O B;  3KQI A;  3U5P A;  5C11 A;  4OGC A;  2KGG A;  1JM7 A;  4AYC B;  5TRB A;  2M13 A;  2VPG A;  4XI1 A;  4NN2 A;  5G0F A;  2QIC A;  1WEQ A;  2LXH C;  1WES A;  4GND A;  3NG2 A;  3O7A A;  2RR4 A;  2G43 A;  2YVR A;  2YRE A;  2KE1 A;  2CT2 A;  2D8U A;  2ECT A;  2LAU A;  2LGG A;  2K1J A;  2Y1M A;  3U5O A;  3LQJ A;  3O47 A;  1K2F A;  3FM8 C;  1VFY A;  2K17 A;  4FJC A;  2YU4 A;  2OWA A;  1T1H A;  2KU3 A;  2KYU A;  2EGP A;  4H9D A;  4LJN A;  3ASL A;  2RSD A;  5FEY A;  2JMD A;  2JUN A;  2KKY A;  1WEW A;  3SOU A;  4A49 A;  2ECG A;  3ZPV 1;  4B86 C;  2E61 A;  2KWN A;  2YW8 A;  5D1K B;  5SVX A;  1G25 A;  3ZNI A;  2JRJ A;  2KWJ A;  1WEM A;  3T6R A;  4OGE A;  4Z0O A;  2CON A;  3SOW A;  4QF2 A;  1WEP A;  5LKZ A;  2P57 A;  3LVR E;  3GV4 A;  5G04 B;  2L75 A;  4LAD B;  1LDJ B;  2L43 A;  2H0D A;  5FB0 A;  2JMI A;  4B7Y C;  2CKL A;  3O35 A;  4FK5 A;  4WZ2 A;  2FD4 A;  4S3O C;  2VJF B;  1XWH A;  3FL2 A;  5TDR A;  2YHN A;  4YC9 A;  2YT5 A;  4R8P K;  2FFW A;  4CCG X;  3L1X A;  1N87 A;  4GNE A;  3PUR A;  2KWK A;  2M85 A;  2DX8 A;  2IDA A;  2KGI A;  3DPL R;  5B75 A;  1WIL A;  3N9O A;  2EGM A;  1RMD A;  4BHW A;  3GL6 A;  4LKA A;  4FIP A;  1FP0 A;  3EB5 A;  2BAY A;  3LDY A;  1JM7 B;  2LXP C;  2F6N A;  5KH3 A;  4YAB A;  4V3L C;  5D1M B;  5TDW A;  2YQM A;  1Z2Q A;  4YBT A;  3LJU X;  2CRW A;  3PUQ A;  4QQ4 A;  4V3K C;  3SOX A;  1E4U A;  4I7D A;  2VJE B;  2MUM A;  3FJU B;  3IHP A;  5H1T A;  1DVP A;  2VPE A;  4A4B A;  3M63 A;  2B0O E;  5C13 A;  3C6W A;  5SVI A;  2LQ6 A;  1X4U A;  2NAA A;  2MT5 A;  3O37 A;  3N9L A;  4I7B A;  3C5K A;  3RTR B;  2ECV A;  4Z0R A;  3JUE A;  1WEN A;  2G45 A;  4L58 A;  2L7P A;  5KH7 A;  4A0C D;  4AYC A;  4CA1 A;  1V87 A;  2CRR A;  5JG6 A;  5TBN A;  3O34 A;  2YUR A;  3HCU A;  1X4J A;  4O64 A;  3FAN A;  2L5U A;  3O33 A;  2M1R A;  5D1L B;  3MHH A;  2E6R A;  3PLW A;  5FB1 A;  4YAT A;  4X3G A;  2G6Q A;  3MDB C;  5TAB A;  5KH9 A;  5LKU A;  4AUQ B;  4WZ0 A;  2MNZ A;  3SHB A;  2VP7 A;  2MA6 A;  2L80 A;  5EYA F;  2XEU A;  4UI9 B;  2RI7 A;  2KR4 A;  2IQJ A;  3Q1D A;  4Q6F A;  4W4U A;  1MBM A;  3ZYQ A;  1WEE A;  2CKL B;  4UP5 A;  4PTB A;  4N3W A;  2UZG A;  1LDK C;  5J3X A;  1FBV A;  5LCW B;  3LQH A;  2PNX A;  2KRE A;  3KDE C;  5AIU A;  4WA6 A;  2CSY A;  5DKA A;  3LVQ E;  4AP4 A;  2F6J A;  1VD4 A;  4ZQL A;  1MM2 A;  4C9Z A;  2LN0 A;  4O62 A;  3ZTG A;  2M6M A;  4LK9 A;  4WZ3 B;  2DJA A;  3ZPV E;  5B77 A;  1F62 A;  2YSJ A;  4YAX A;  1WIM A;  4F1P A;  5I3L A;  3KV6 A;  3M7K A;  3KNV A;  1CHC A;  4YBS A;  4ZUX U;  4R2Y A;  2HDP A;  2MIQ A;  4BBQ A;  2VJF A;  2LV9 A;  2F42 A;  4YBM A;  5G05 B;  2KFT A;  1ZBD B;  2XOZ A;  3N9Q A;  1MM3 A;  2XOY A;  4R7E A;  2HYE D;  4GNF A;  5LKX A;  1WEO A;  3O36 A;  2YUC A;  2CSV A;  3HTK C;  3QZV A;  3N9P A;  3ZVZ B;  3M99 A;  5H1V A;  3E2D A;  4P5O B;  1WE9 A;  2LGL A;  2FUU A;  4TKP B;  3U5N A;  3RPG B;  3EB6 A;  2ECI A;  4GNG A;  3T9K A;  5B78 A;  1JOC A;  2C2L A;  3FAO A;  3V43 A;  5B76 A;  5H1U A;  1WGM A;  2EOD A;  4ZDT A;  2YYR A;  2XP0 A;  3HCT A;  4GB0 A;  2D8S A;  2ECW A;  3M62 A;  1WFK A;  2I50 A;  2MKE A;  2VJE A;  3I2D A;  2VPB A;  1U6G B;  1IYM A;  2YSM A;  2LRI C;  2VPD A;  4FO9 A;  2CSZ A;  2Y1N A;  1HYJ A;  3SUB A;  2LGV A;  2ZET C;  1DCQ A;  3PHD A;  2L0B A;  3N9M A;  3L11 A;  2KWO A;  3U5M A;  1Z60 A;  2KKX A;  4PPE A;  4IC3 A;  5B79 A;  2JM3 A;  2LDR A;  2XB1 A;  2MD8 C;  3ZVY A;  3LQI A;  2H0D B;  1VYX A;  2M3H A;  2ECJ A;  2LGK A;  2EXU A;  2AN6 A;  4LLB A;  3KV5 A;  5H9M A;  4AVX A;  2FSA A;  1WEV A;  5DIN A;  1WEU A;  3DDT A;  4QF3 A;  2OXQ C;  3L1Z B;  4L7X A;  5B8D A;  3DWD A; 
#chains in the Genus database with same CATH homology
 2MA5 A;  3VK6 A;  2PUY A;  3LRQ A;  4YAD A;  5LKT A;  4I7C A;  4N4F A;  2VNF A;  3T7L A;  4MSX A;  1X4I A;  2K16 A;  4IC2 A;  2QIZ A;  3HCS A;  3O70 A;  5AIT A;  2Y43 A;  3N9N A;  2YHO A;  2QJ0 A;  5FER A;  2EA6 A;  4A4C A;  3DQV R;  2FUI A;  2MNY A;  3RPG C;  2KIZ A;  2YQL A;  2C2V S;  2JMJ A;  2MD7 B;  1HYI A;  4UP0 A;  2K4D A;  2ECN A;  4MVT A;  1BOR A;  2E6S A;  4F52 B;  3MHS A;  4S3O B;  3KQI A;  3U5P A;  5C11 A;  2KGG A;  1JM7 A;  4AYC B;  5TRB A;  2VPG A;  4XI1 A;  4NN2 A;  5G0F A;  2QIC A;  1WEQ A;  2LXH C;  1WES A;  4GND A;  3NG2 A;  3O7A A;  2G43 A;  2YRE A;  2KE1 A;  2CT2 A;  2ECT A;  2LGG A;  2K1J A;  2Y1M A;  3U5O A;  3LQJ A;  1K2F A;  1VFY A;  2K17 A;  4FJC A;  2YU4 A;  1T1H A;  2KU3 A;  2KYU A;  2EGP A;  4LJN A;  3ASL A;  2RSD A;  5FEY A;  2JMD A;  1WEW A;  3SOU A;  4A49 A;  2ECG A;  3ZPV 1;  4B86 C;  2KWN A;  2YW8 A;  5D1K B;  1G25 A;  3ZNI A;  2JRJ A;  2KWJ A;  1WEM A;  3T6R A;  3SOW A;  4QF2 A;  1WEP A;  5LKZ A;  3GV4 A;  5G04 B;  2L75 A;  4LAD B;  1LDJ B;  2L43 A;  2H0D A;  5FB0 A;  2JMI A;  4B7Y C;  2CKL A;  3O35 A;  4FK5 A;  4WZ2 A;  4S3O C;  2VJF B;  1XWH A;  3FL2 A;  5TDR A;  2YHN A;  4YC9 A;  2YT5 A;  4R8P K;  4CCG X;  3L1X A;  1N87 A;  4GNE A;  3PUR A;  2KWK A;  2M85 A;  2DX8 A;  2IDA A;  2KGI A;  3DPL R;  5B75 A;  1WIL A;  3N9O A;  1RMD A;  4BHW A;  3GL6 A;  4LKA A;  4FIP A;  1FP0 A;  3EB5 A;  2BAY A;  1JM7 B;  2LXP C;  2F6N A;  5KH3 A;  4YAB A;  4V3L C;  5D1M B;  5TDW A;  2YQM A;  1Z2Q A;  4YBT A;  3PUQ A;  4V3K C;  3SOX A;  1E4U A;  4I7D A;  2VJE B;  2MUM A;  3IHP A;  5H1T A;  1DVP A;  2VPE A;  4A4B A;  3M63 A;  5C13 A;  3C6W A;  2LQ6 A;  1X4U A;  2NAA A;  2MT5 A;  3O37 A;  3N9L A;  4I7B A;  3C5K A;  3RTR B;  2ECV A;  1WEN A;  2G45 A;  4L58 A;  5KH7 A;  4A0C D;  4AYC A;  4CA1 A;  1V87 A;  5JG6 A;  5TBN A;  3O34 A;  2YUR A;  3HCU A;  1X4J A;  4O64 A;  3O33 A;  2L5U A;  2M1R A;  5D1L B;  3MHH A;  2E6R A;  5FB1 A;  4YAT A;  4X3G A;  2G6Q A;  5TAB A;  5KH9 A;  5LKU A;  4AUQ B;  4WZ0 A;  2MNZ A;  3SHB A;  2VP7 A;  2MA6 A;  2L80 A;  5EYA F;  2XEU A;  4UI9 B;  2RI7 A;  2KR4 A;  4Q6F A;  4W4U A;  3ZYQ A;  1WEE A;  2CKL B;  4UP5 A;  4PTB A;  4N3W A;  2UZG A;  1LDK C;  5J3X A;  1FBV A;  5LCW B;  3LQH A;  2PNX A;  2KRE A;  5AIU A;  4WA6 A;  2CSY A;  5DKA A;  4AP4 A;  2F6J A;  1VD4 A;  4ZQL A;  1MM2 A;  4C9Z A;  2LN0 A;  3ZTG A;  2M6M A;  4LK9 A;  4WZ3 B;  3ZPV E;  5B77 A;  1F62 A;  2YSJ A;  4YAX A;  1WIM A;  5I3L A;  3KV6 A;  3KNV A;  1CHC A;  4YBS A;  4ZUX U;  4R2Y A;  2HDP A;  2MIQ A;  4BBQ A;  2VJF A;  2LV9 A;  2F42 A;  4YBM A;  5G05 B;  2KFT A;  1ZBD B;  3N9Q A;  1MM3 A;  4R7E A;  2HYE D;  4GNF A;  5LKX A;  1WEO A;  3O36 A;  2YUC A;  3HTK C;  3QZV A;  3N9P A;  3ZVZ B;  3M99 A;  5H1V A;  4P5O B;  1WE9 A;  2LGL A;  2FUU A;  4TKP B;  3U5N A;  3RPG B;  3EB6 A;  2ECI A;  4GNG A;  5B78 A;  1JOC A;  2C2L A;  3V43 A;  5B76 A;  5H1U A;  1WGM A;  2EOD A;  4ZDT A;  2YYR A;  3HCT A;  4GB0 A;  2D8S A;  2ECW A;  3M62 A;  1WFK A;  2I50 A;  2VJE A;  3I2D A;  2VPB A;  1U6G B;  1IYM A;  2YSM A;  2LRI C;  2VPD A;  4FO9 A;  2CSZ A;  2Y1N A;  1HYJ A;  2LGV A;  2ZET C;  3PHD A;  2L0B A;  3N9M A;  3L11 A;  2KWO A;  3U5M A;  1Z60 A;  4PPE A;  4IC3 A;  5B79 A;  2LDR A;  2XB1 A;  2MD8 C;  3ZVY A;  3LQI A;  2H0D B;  1VYX A;  2M3H A;  2ECJ A;  2LGK A;  2AN6 A;  4LLB A;  3KV5 A;  5H9M A;  4AVX A;  2FSA A;  1WEV A;  5DIN A;  1WEU A;  4QF3 A;  2OXQ C;  3L1Z B;  4L7X A;  5B8D A;  1Z6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...