2YU4A

Solution structure of the sp-ring domain in non-smc element 2 homolog (mms21, s. cerevisiae)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
94
Chain Sequence
GSSGSSGFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SP-RING domain in non-SMC element 2 homolog (MMS21, S. cerevisiae)
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords E3 SUMO-protein ligase NSE2
total genus 14
structure length 94
sequence length 94
ec nomenclature ec 6.-.-.-:
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yu4A00
1WEMA 1CHCA 2KR4A 3MHHA 3PHDA 3N9NA 3RPGB 1X4UA 2LGVA 3O34A 3HTKC 2LRIC 4B86C 5B8DA 2LV9A 4A4CA 2MT5A 2VJEA 2MA6A 2VJEB 4W4UA 3N9MA 5EYAF 2YQMA 4AP4A 1Z2QA 4YAXA 4V3KC 2K17A 4BBQA 2F6NA 2YHOA 3PUQA 5TBNA 2C2LA 3T6RA 5LKXA 1VD4A 3O35A 4WZ3B 2G6QA 3SOWA 3L11A 2FUUA 4BHWA 1F62A 5B76A 1Z60A 4AYCB 4QF2A 1WEUA 3SHBA 4F52B 4YBSA 4FJCA 5G04B 2MNYA 1MM3A 3ZVYA 2KGIA 2CKLB 2LN0A 2CSZA 2ECTA 1WEEA 4FIPA 3ASLA 4YBMA 1VFYA 4GNFA 2CSYA 1N87A 3EB5A 5H9MA 2Y1MA 2H0DA 2H0DB 1LDJB 4TKPB 2LQ6A 2F6JA 3V43A 2K16A 2FSAA 3N9QA 2I50A 1E4UA 2JMJA 3RTRB 3HCUA 1HYIA 2KWOA 4GNEA 1WEQA 2LXPC 2VPBA 3O33A 1WESA 1K2FA 1Z6UA 3L1XA 2RI7A 2VPDA 4LK9A 4I7DA 4AUQB 3LQIA 1WENA 4ZDTA 5I3LA 4UP0A 2YQLA 2PNXA 4LJNA 5J3XA 4FO9A 5B77A 1WEPA 2DX8A 3HCSA 3U5MA 2VPEA 4S3OC 3N9OA 5FB1A 1X4JA 4LKAA 2KE1A 4N3WA 1FBVA 2L0BA 1V87A 1T1HA 5G0FA 3ZVZB 4I7BA 4WZ2A 4I7CA 2ZETC 3KNVA 3M99A 5AITA 1VYXA 1WEOA 3SOXA 3N9LA 3VK6A 1JOCA 4B7YC 3GL6A 2HDPA 3M63A 1WILA 4FK5A 5B79A 3KV6A 2K4DA 2LGLA 3ZYQA 2YURA 2C2VS 3L1ZB 2KIZA 1U6GB 2JMDA 3RPGC 2MNZA 2KWNA 2IDAA 3PURA 3LQJA 3N9PA 2YUCA 4WA6A 4YATA 2MA5A 3O70A 4UP5A 5C13A 4A4BA 4IC3A 1ZBDB 4QF3A 4AYCA 3DQVR 4AVXA 5DKAA 2LXHC 2M1RA 2MUMA 4L7XA 2F42A 1BORA 2CKLA 1XWHA 2VJFA 2D8SA 3DPLR 3FL2A 2VJFB 4R8PK 2ECIA 4C9ZA 5LCWB 1X4IA 5D1KB 5G05B 1FP0A 1WEWA 2YT5A 2YYRA 5H1UA 4MSXA 2YU4A 4ZUXU 3KQIA 2VPGA 1IYMA 3MHSA 5FB0A 3O36A 3ZPVE 2HYED 4PTBA 3HCTA 2JMIA 3KV5A 4LADB 2EA6A 2G43A 4YABA 2ECVA 4A0CD 4R7EA 4O64A 5B75A 1MM2A 2ECNA 5TABA 2L80A 2NAAA 5H1VA 2ECWA 4YC9A 5FERA 1G25A 2VP7A 3U5NA 3QZVA 2LGKA 4P5OB 3NG2A 5B78A 2MIQA 1WGMA 2MD7B 4YADA 4CA1A 5JG6A 2YSMA 1WIMA 4A49A 4L58A 2YSJA 2ECGA 2XEUA 5H1TA 5C11A 2E6SA 4S3OB 3LRQA 2E6RA 2M6MA 2JRJA 4N4FA 2YREA 2G45A 2QIZA 4WZ0A 1WFKA 3GV4A 5LKUA 4PPEA 2OXQC 2AN6A 2ECJA 2EGPA 2KREA 5DINA 5KH3A 4V3LC 2M3HA 2XB1A 2FUIA 4YBTA 5AIUA 2EODA 2UZGA 4ZQLA 1WEVA 3I2DA 5TDWA 3M62A 3U5PA 3C5KA 2MD8C 3O7AA 2KU3A 2L75A 4GNGA 2RSDA 2CT2A 2KYUA 5LKTA 5KH9A 4GB0A 1DVPA 5D1MB 2L5UA 2KGGA 5TRBA 2KWKA 4NN2A 4UI9B 4X3GA 2PUYA 3T7LA 1HYJA 2L43A 3O37A 2K1JA 1WE9A 1RMDA 3ZNIA 3SOUA 2KFTA 4XI1A 4GNDA 5TDRA 5FEYA 4IC2A 5KH7A 3U5OA 2QICA 3LQHA 4LLBA 2VNFA 2BAYA 2Y1NA 2LDRA 4CCGX 2LGGA 3ZTGA 3EB6A 2YW8A 3C6WA 5D1LB 5LKZA 2QJ0A 2Y43A 4MVTA 3ZPV1 1JM7A 2M85A 2YHNA 1LDKC 3IHPA 1JM7B 4Q6FA 2KWJA 4R2YA
chains in the Genus database with same CATH superfamily
1WEMA 1CHCA 2KR4A 3MHHA 3PHDA 3N9NA 3RPGB 1X4UA 2LGVA 3O34A 5K3QA 3O47A 3HTKC 2LRIC 2YVRA 2EXUA 3LVQE 4B86C 5B8DA 2LV9A 4A4CA 2E61A 2MT5A 2VJEA 2MA6A 3LJUX 2VJEB 4W4UA 3N9MA 5EYAF 2P57A 2YQMA 5SVIA 5SVIB 4AP4A 1Z2QA 4YAXA 4V3KC 2K17A 4BBQA 2F6NA 2YHOA 3PUQA 5TBNA 2C2LA 3T6RA 2LAUA 5LKXA 1VD4A 3O35A 4WZ3B 2G6QA 3SOWA 3L11A 2FUUA 4BHWA 1F62A 5B76A 1Z60A 4AYCB 4QF2A 1WEUA 2RR4A 3Q1DA 3SHBA 4F52B 4YBSA 4FJCA 5G04B 2MNYA 1MM3A 3ZVYA 2KGIA 2CKLB 2FFWA 2LN0A 2CSZA 2ECTA 2KKXA 1WEEA 4FIPA 4Z0RA 3ASLA 4YBMA 1VFYA 4F1PA 4GNFA 2CSYA 1N87A 2DSMA 3EB5A 5H9MA 2Y1MA 3DDTA 2H0DA 2H0DB 4O62A 5SVYA 1LDJB 4TKPB 2LQ6A 2F6JA 3V43A 2K16A 2FSAA 3FJUB 2OWAA 3N9QA 2I50A 1E4UA 2JMJA 3RTRB 3HCUA 1HYIA 2KWOA 4GNEA 1WEQA 2LXPC 2VPBA 3O33A 1WESA 1K2FA 1Z6UA 3FM8C 2RI7A 2VPDA 4LK9A 3L1XA 4I7DA 4AUQB 3LQIA 1WENA 4ZDTA 3T9KA 5I3LA 4UP0A 2YQLA 3SUBA 2FD4A 2PNXA 2DJAA 4LJNA 5J3XA 4FO9A 5B77A 1WEPA 2DX8A 3HCSA 3U5MA 2VPEA 4S3OC 3N9OA 5FB1A 1X4JA 4LKAA 2KE1A 2CRWA 4N3WA 1FBVA 2L0BA 1V87A 1T1HA 5G0FA 3ZVZB 4I7BA 4WZ2A 4I7CA 2ZETC 5AITA 3KNVA 3M99A 1VYXA 1WEOA 3SOXA 3N9LA 3VK6A 1JOCA 4B7YC 3LVRE 3GL6A 3E2DA 2HDPA 3M63A 1WILA 2MKEA 4FK5A 5B79A 2XP0A 3KV6A 2K4DA 1MBMA 2LGLA 3ZYQA 2YURA 2C2VS 3L1ZB 2KIZA 5SVXA 1U6GB 2JMDA 3RPGC 2MNZA 2KWNA 2CRRA 2IDAA 3PURA 3LQJA 3N9PA 2YUCA 4WA6A 4YATA 2MA5A 3O70A 4UP5A 5C13A 4A4BA 4IC3A 1ZBDB 4QF3A 4AYCA 3DQVR 4AVXA 5DKAA 2LXHC 2M1RA 2MUMA 4L7XA 2F42A 4Z0OA 1BORA 2CKLA 4OGEA 1XWHA 2VJFA 2D8SA 3DPLR 3FL2A 2VJFB 4R8PK 2L7PA 2KKYA 2ECIA 4C9ZA 5LCWB 1X4IA 5D1KB 3DWDA 5G05B 2JM3A 1FP0A 2JUNA 4OGCA 1WEWA 2YT5A 2YYRA 5H1UA 4MSXA 2YU4A 4ZUXU 2EGMA 3KQIA 2VPGA 1IYMA 3MHSA 5FB0A 3O36A 3ZPVE 2HYED 4PTBA 3HCTA 2JMIA 3KV5A 4LADB 2EA6A 2G43A 3MDBC 4YABA 2ECVA 4A0CD 4R7EA 3H7HA 4O64A 2CONA 5B75A 1MM2A 2ECNA 5TABA 2L80A 2NAAA 5H1VA 2ECWA 4YC9A 5FERA 1G25A 2VP7A 3U5NA 3QZVA 2LGKA 4H9DA 4P5OB 3NG2A 5B78A 2MIQA 1WGMA 2MD7B 4YADA 4CA1A 2B0OE 5JG6A 2YSMA 3FAOA 1WIMA 4A49A 2IQJA 4L58A 2YSJA 2ECGA 2XEUA 5H1TA 5C11A 2E6SA 4S3OB 3LRQA 2E6RA 2M6MA 2JRJA 4N4FA 2YREA 2G45A 2XOYA 2QIZA 4WZ0A 1WFKA 3GV4A 3LDYA 5LKUA 4PPEA 2OXQC 2AN6A 2ECJA 2EGPA 2KREA 5DINA 5KH3A 4V3LC 2M3HA 2XB1A 2FUIA 2M13A 4YBTA 5AIUA 2EODA 2UZGA 4ZQLA 1WEVA 3I2DA 5TDWA 3M62A 3U5PA 3PLWA 3C5KA 2MD8C 2XOCA 3O7AA 2KU3A 2L75A 4GNGA 2RSDA 2CT2A 2KYUA 2CSVA 5LKTA 5KH9A 4GB0A 2XOZA 1DVPA 5D1MB 2L5UA 2KGGA 5TRBA 2KWKA 4NN2A 4UI9B 4X3GA 2PUYA 3T7LA 1HYJA 2L43A 3O37A 3KDEC 2K1JA 1WE9A 1RMDA 3ZNIA 3SOUA 3JUEA 2KFTA 4XI1A 4GNDA 5TDRA 4QQ4A 5FEYA 4IC2A 3FANA 3FEHA 5KH7A 3U5OA 2QICA 3LQHA 2D8UA 4LLBA 1DCQA 2VNFA 2BAYA 2Y1NA 2LDRA 4CCGX 2LGGA 3ZTGA 3EB6A 2YW8A 3C6WA 5D1LB 5LKZA 2QJ0A 2Y43A 4MVTA 3ZPV1 1JM7A 2M85A 2YHNA 1LDKC 3IHPA 1JM7B 4Q6FA 3M7KA 2KWJA 4R2YA
chains in the Genus database with same CATH topology
1WEMA 1CHCA 2KR4A 3MHHA 3PHDA 3N9NA 3RPGB 1X4UA 2LGVA 3O34A 3HTKC 2LRIC 4B86C 5B8DA 2LV9A 4A4CA 2MT5A 2VJEA 2MA6A 2VJEB 4W4UA 3N9MA 5EYAF 2YQMA 4AP4A 1Z2QA 4YAXA 4V3KC 2K17A 4BBQA 2F6NA 2YHOA 3PUQA 5TBNA 2C2LA 3T6RA 5LKXA 1VD4A 3O35A 4WZ3B 2G6QA 3SOWA 3L11A 2FUUA 4BHWA 1F62A 5B76A 1Z60A 4AYCB 4QF2A 1WEUA 3SHBA 4F52B 4YBSA 4FJCA 5G04B 2MNYA 1MM3A 3ZVYA 2KGIA 2CKLB 2LN0A 2CSZA 2ECTA 1WEEA 4FIPA 3ASLA 4YBMA 1VFYA 4GNFA 2CSYA 1N87A 3EB5A 5H9MA 2Y1MA 2H0DA 2H0DB 1LDJB 4TKPB 2LQ6A 2F6JA 3V43A 2K16A 2FSAA 3N9QA 2I50A 1E4UA 2JMJA 3RTRB 3HCUA 1HYIA 2KWOA 4GNEA 1WEQA 2LXPC 2VPBA 3O33A 1WESA 1K2FA 1Z6UA 3L1XA 2RI7A 2VPDA 4LK9A 4I7DA 4AUQB 3LQIA 1WENA 4ZDTA 5I3LA 4UP0A 2YQLA 2PNXA 4LJNA 5J3XA 4FO9A 5B77A 1WEPA 2DX8A 3HCSA 3U5MA 2VPEA 4S3OC 3N9OA 5FB1A 1X4JA 4LKAA 2KE1A 4N3WA 1FBVA 2L0BA 1V87A 1T1HA 5G0FA 3ZVZB 4I7BA 4WZ2A 4I7CA 2ZETC 3KNVA 3M99A 5AITA 1VYXA 1WEOA 3SOXA 3N9LA 3VK6A 1JOCA 4B7YC 3GL6A 2HDPA 3M63A 1WILA 4FK5A 5B79A 3KV6A 2K4DA 2LGLA 3ZYQA 2YURA 2C2VS 3L1ZB 2KIZA 1U6GB 2JMDA 3RPGC 2MNZA 2KWNA 2IDAA 3PURA 3LQJA 3N9PA 2YUCA 4WA6A 4YATA 2MA5A 3O70A 4UP5A 5C13A 4A4BA 4IC3A 1ZBDB 4QF3A 4AYCA 3DQVR 4AVXA 5DKAA 2LXHC 2M1RA 2MUMA 4L7XA 2F42A 1BORA 2CKLA 1XWHA 2VJFA 2D8SA 3DPLR 3FL2A 2VJFB 4R8PK 2ECIA 4C9ZA 5LCWB 1X4IA 5D1KB 5G05B 1FP0A 1WEWA 2YT5A 2YYRA 5H1UA 4MSXA 2YU4A 4ZUXU 3KQIA 2VPGA 1IYMA 3MHSA 5FB0A 3O36A 3ZPVE 2HYED 4PTBA 3HCTA 2JMIA 3KV5A 4LADB 2EA6A 2G43A 4YABA 2ECVA 4A0CD 4R7EA 4O64A 5B75A 1MM2A 2ECNA 5TABA 2L80A 2NAAA 5H1VA 2ECWA 4YC9A 5FERA 1G25A 2VP7A 3U5NA 3QZVA 2LGKA 4P5OB 3NG2A 5B78A 2MIQA 1WGMA 2MD7B 4YADA 4CA1A 5JG6A 2YSMA 1WIMA 4A49A 4L58A 2YSJA 2ECGA 2XEUA 5H1TA 5C11A 2E6SA 4S3OB 3LRQA 2E6RA 2M6MA 2JRJA 4N4FA 2YREA 2G45A 2QIZA 4WZ0A 1WFKA 3GV4A 5LKUA 4PPEA 2OXQC 2AN6A 2ECJA 2EGPA 2KREA 5DINA 5KH3A 4V3LC 2M3HA 2XB1A 2FUIA 4YBTA 5AIUA 2EODA 2UZGA 4ZQLA 1WEVA 3I2DA 5TDWA 3M62A 3U5PA 3C5KA 2MD8C 3O7AA 2KU3A 2L75A 4GNGA 2RSDA 2CT2A 2KYUA 5LKTA 5KH9A 4GB0A 1DVPA 5D1MB 2L5UA 2KGGA 5TRBA 2KWKA 4NN2A 4UI9B 4X3GA 2PUYA 3T7LA 1HYJA 2L43A 3O37A 2K1JA 1WE9A 1RMDA 3ZNIA 3SOUA 2KFTA 4XI1A 4GNDA 5TDRA 5FEYA 4IC2A 5KH7A 3U5OA 2QICA 3LQHA 4LLBA 2VNFA 2BAYA 2Y1NA 2LDRA 4CCGX 2LGGA 3ZTGA 3EB6A 2YW8A 3C6WA 5D1LB 5LKZA 2QJ0A 2Y43A 4MVTA 3ZPV1 1JM7A 2M85A 2YHNA 1LDKC 3IHPA 1JM7B 4Q6FA 2KWJA 4R2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEM A;  1CHC A;  2KR4 A;  3MHH A;  3PHD A;  3N9N A;  3RPG B;  1X4U A;  2LGV A;  3O34 A;  3HTK C;  2LRI C;  4B86 C;  5B8D A;  2LV9 A;  4A4C A;  2MT5 A;  2VJE A;  2MA6 A;  2VJE B;  4W4U A;  3N9M A;  5EYA F;  2YQM A;  4AP4 A;  1Z2Q A;  4YAX A;  4V3K C;  2K17 A;  4BBQ A;  2F6N A;  2YHO A;  3PUQ A;  5TBN A;  2C2L A;  3T6R A;  5LKX A;  1VD4 A;  3O35 A;  4WZ3 B;  2G6Q A;  3SOW A;  3L11 A;  2FUU A;  4BHW A;  1F62 A;  5B76 A;  1Z60 A;  4AYC B;  4QF2 A;  1WEU A;  3SHB A;  4F52 B;  4YBS A;  4FJC A;  5G04 B;  2MNY A;  1MM3 A;  3ZVY A;  2KGI A;  2CKL B;  2LN0 A;  2CSZ A;  2ECT A;  1WEE A;  4FIP A;  3ASL A;  4YBM A;  1VFY A;  4GNF A;  2CSY A;  1N87 A;  3EB5 A;  5H9M A;  2Y1M A;  2H0D A;  2H0D B;  1LDJ B;  4TKP B;  2LQ6 A;  2F6J A;  3V43 A;  2K16 A;  2FSA A;  3N9Q A;  2I50 A;  1E4U A;  2JMJ A;  3RTR B;  3HCU A;  1HYI A;  2KWO A;  4GNE A;  1WEQ A;  2LXP C;  2VPB A;  3O33 A;  1WES A;  1K2F A;  1Z6U A;  3L1X A;  2RI7 A;  2VPD A;  4LK9 A;  4I7D A;  4AUQ B;  3LQI A;  1WEN A;  4ZDT A;  5I3L A;  4UP0 A;  2YQL A;  2PNX A;  4LJN A;  5J3X A;  4FO9 A;  5B77 A;  1WEP A;  2DX8 A;  3HCS A;  3U5M A;  2VPE A;  4S3O C;  3N9O A;  5FB1 A;  1X4J A;  4LKA A;  2KE1 A;  4N3W A;  1FBV A;  2L0B A;  1V87 A;  1T1H A;  5G0F A;  3ZVZ B;  4I7B A;  4WZ2 A;  4I7C A;  2ZET C;  3KNV A;  3M99 A;  5AIT A;  1VYX A;  1WEO A;  3SOX A;  3N9L A;  3VK6 A;  1JOC A;  4B7Y C;  3GL6 A;  2HDP A;  3M63 A;  1WIL A;  4FK5 A;  5B79 A;  3KV6 A;  2K4D A;  2LGL A;  3ZYQ A;  2YUR A;  2C2V S;  3L1Z B;  2KIZ A;  1U6G B;  2JMD A;  3RPG C;  2MNZ A;  2KWN A;  2IDA A;  3PUR A;  3LQJ A;  3N9P A;  2YUC A;  4WA6 A;  4YAT A;  2MA5 A;  3O70 A;  4UP5 A;  5C13 A;  4A4B A;  4IC3 A;  1ZBD B;  4QF3 A;  4AYC A;  3DQV R;  4AVX A;  5DKA A;  2LXH C;  2M1R A;  2MUM A;  4L7X A;  2F42 A;  1BOR A;  2CKL A;  1XWH A;  2VJF A;  2D8S A;  3DPL R;  3FL2 A;  2VJF B;  4R8P K;  2ECI A;  4C9Z A;  5LCW B;  1X4I A;  5D1K B;  5G05 B;  1FP0 A;  1WEW A;  2YT5 A;  2YYR A;  5H1U A;  4MSX A;  2YU4 A;  4ZUX U;  3KQI A;  2VPG A;  1IYM A;  3MHS A;  5FB0 A;  3O36 A;  3ZPV E;  2HYE D;  4PTB A;  3HCT A;  2JMI A;  3KV5 A;  4LAD B;  2EA6 A;  2G43 A;  4YAB A;  2ECV A;  4A0C D;  4R7E A;  4O64 A;  5B75 A;  1MM2 A;  2ECN A;  5TAB A;  2L80 A;  2NAA A;  5H1V A;  2ECW A;  4YC9 A;  5FER A;  1G25 A;  2VP7 A;  3U5N A;  3QZV A;  2LGK A;  4P5O B;  3NG2 A;  5B78 A;  2MIQ A;  1WGM A;  2MD7 B;  4YAD A;  4CA1 A;  5JG6 A;  2YSM A;  1WIM A;  4A49 A;  4L58 A;  2YSJ A;  2ECG A;  2XEU A;  5H1T A;  5C11 A;  2E6S A;  4S3O B;  3LRQ A;  2E6R A;  2M6M A;  2JRJ A;  4N4F A;  2YRE A;  2G45 A;  2QIZ A;  4WZ0 A;  1WFK A;  3GV4 A;  5LKU A;  4PPE A;  2OXQ C;  2AN6 A;  2ECJ A;  2EGP A;  2KRE A;  5DIN A;  5KH3 A;  4V3L C;  2M3H A;  2XB1 A;  2FUI A;  4YBT A;  5AIU A;  2EOD A;  2UZG A;  4ZQL A;  1WEV A;  3I2D A;  5TDW A;  3M62 A;  3U5P A;  3C5K A;  2MD8 C;  3O7A A;  2KU3 A;  2L75 A;  4GNG A;  2RSD A;  2CT2 A;  2KYU A;  5LKT A;  5KH9 A;  4GB0 A;  1DVP A;  5D1M B;  2L5U A;  2KGG A;  5TRB A;  2KWK A;  4NN2 A;  4UI9 B;  4X3G A;  2PUY A;  3T7L A;  1HYJ A;  2L43 A;  3O37 A;  2K1J A;  1WE9 A;  1RMD A;  3ZNI A;  3SOU A;  2KFT A;  4XI1 A;  4GND A;  5TDR A;  5FEY A;  4IC2 A;  5KH7 A;  3U5O A;  2QIC A;  3LQH A;  4LLB A;  2VNF A;  2BAY A;  2Y1N A;  2LDR A;  4CCG X;  2LGG A;  3ZTG A;  3EB6 A;  2YW8 A;  3C6W A;  5D1L B;  5LKZ A;  2QJ0 A;  2Y43 A;  4MVT A;  3ZPV 1;  1JM7 A;  2M85 A;  2YHN A;  1LDK C;  3IHP A;  1JM7 B;  4Q6F A;  2KWJ A;  4R2Y A; 
#chains in the Genus database with same CATH topology
 1WEM A;  1CHC A;  2KR4 A;  3MHH A;  3PHD A;  3N9N A;  3RPG B;  1X4U A;  2LGV A;  3O34 A;  5K3Q A;  3O47 A;  3HTK C;  2LRI C;  2YVR A;  2EXU A;  3LVQ E;  4B86 C;  5B8D A;  2LV9 A;  4A4C A;  2E61 A;  2MT5 A;  2VJE A;  2MA6 A;  3LJU X;  2VJE B;  4W4U A;  3N9M A;  5EYA F;  2P57 A;  2YQM A;  5SVI A;  5SVI B;  4AP4 A;  1Z2Q A;  4YAX A;  4V3K C;  2K17 A;  4BBQ A;  2F6N A;  2YHO A;  3PUQ A;  5TBN A;  2C2L A;  3T6R A;  2LAU A;  5LKX A;  1VD4 A;  3O35 A;  4WZ3 B;  2G6Q A;  3SOW A;  3L11 A;  2FUU A;  4BHW A;  1F62 A;  5B76 A;  1Z60 A;  4AYC B;  4QF2 A;  1WEU A;  2RR4 A;  3Q1D A;  3SHB A;  4F52 B;  4YBS A;  4FJC A;  5G04 B;  2MNY A;  1MM3 A;  3ZVY A;  2KGI A;  2CKL B;  2FFW A;  2LN0 A;  2CSZ A;  2ECT A;  2KKX A;  1WEE A;  4FIP A;  4Z0R A;  3ASL A;  4YBM A;  1VFY A;  4F1P A;  4GNF A;  2CSY A;  1N87 A;  2DSM A;  3EB5 A;  5H9M A;  2Y1M A;  3DDT A;  2H0D A;  2H0D B;  4O62 A;  5SVY A;  1LDJ B;  4TKP B;  2LQ6 A;  2F6J A;  3V43 A;  2K16 A;  2FSA A;  3FJU B;  2OWA A;  3N9Q A;  2I50 A;  1E4U A;  2JMJ A;  3RTR B;  3HCU A;  1HYI A;  2KWO A;  4GNE A;  1WEQ A;  2LXP C;  2VPB A;  3O33 A;  1WES A;  1K2F A;  1Z6U A;  3FM8 C;  2RI7 A;  2VPD A;  4LK9 A;  3L1X A;  4I7D A;  4AUQ B;  3LQI A;  1WEN A;  4ZDT A;  3T9K A;  5I3L A;  4UP0 A;  2YQL A;  3SUB A;  2FD4 A;  2PNX A;  2DJA A;  4LJN A;  5J3X A;  4FO9 A;  5B77 A;  1WEP A;  2DX8 A;  3HCS A;  3U5M A;  2VPE A;  4S3O C;  3N9O A;  5FB1 A;  1X4J A;  4LKA A;  2KE1 A;  2CRW A;  4N3W A;  1FBV A;  2L0B A;  1V87 A;  1T1H A;  5G0F A;  3ZVZ B;  4I7B A;  4WZ2 A;  4I7C A;  2ZET C;  5AIT A;  3KNV A;  3M99 A;  1VYX A;  1WEO A;  3SOX A;  3N9L A;  3VK6 A;  1JOC A;  4B7Y C;  3LVR E;  3GL6 A;  3E2D A;  2HDP A;  3M63 A;  1WIL A;  2MKE A;  4FK5 A;  5B79 A;  2XP0 A;  3KV6 A;  2K4D A;  1MBM A;  2LGL A;  3ZYQ A;  2YUR A;  2C2V S;  3L1Z B;  2KIZ A;  5SVX A;  1U6G B;  2JMD A;  3RPG C;  2MNZ A;  2KWN A;  2CRR A;  2IDA A;  3PUR A;  3LQJ A;  3N9P A;  2YUC A;  4WA6 A;  4YAT A;  2MA5 A;  3O70 A;  4UP5 A;  5C13 A;  4A4B A;  4IC3 A;  1ZBD B;  4QF3 A;  4AYC A;  3DQV R;  4AVX A;  5DKA A;  2LXH C;  2M1R A;  2MUM A;  4L7X A;  2F42 A;  4Z0O A;  1BOR A;  2CKL A;  4OGE A;  1XWH A;  2VJF A;  2D8S A;  3DPL R;  3FL2 A;  2VJF B;  4R8P K;  2L7P A;  2KKY A;  2ECI A;  4C9Z A;  5LCW B;  1X4I A;  5D1K B;  3DWD A;  5G05 B;  2JM3 A;  1FP0 A;  2JUN A;  4OGC A;  1WEW A;  2YT5 A;  2YYR A;  5H1U A;  4MSX A;  2YU4 A;  4ZUX U;  2EGM A;  3KQI A;  2VPG A;  1IYM A;  3MHS A;  5FB0 A;  3O36 A;  3ZPV E;  2HYE D;  4PTB A;  3HCT A;  2JMI A;  3KV5 A;  4LAD B;  2EA6 A;  2G43 A;  3MDB C;  4YAB A;  2ECV A;  4A0C D;  4R7E A;  3H7H A;  4O64 A;  2CON A;  5B75 A;  1MM2 A;  2ECN A;  5TAB A;  2L80 A;  2NAA A;  5H1V A;  2ECW A;  4YC9 A;  5FER A;  1G25 A;  2VP7 A;  3U5N A;  3QZV A;  2LGK A;  4H9D A;  4P5O B;  3NG2 A;  5B78 A;  2MIQ A;  1WGM A;  2MD7 B;  4YAD A;  4CA1 A;  2B0O E;  5JG6 A;  2YSM A;  3FAO A;  1WIM A;  4A49 A;  2IQJ A;  4L58 A;  2YSJ A;  2ECG A;  2XEU A;  5H1T A;  5C11 A;  2E6S A;  4S3O B;  3LRQ A;  2E6R A;  2M6M A;  2JRJ A;  4N4F A;  2YRE A;  2G45 A;  2XOY A;  2QIZ A;  4WZ0 A;  1WFK A;  3GV4 A;  3LDY A;  5LKU A;  4PPE A;  2OXQ C;  2AN6 A;  2ECJ A;  2EGP A;  2KRE A;  5DIN A;  5KH3 A;  4V3L C;  2M3H A;  2XB1 A;  2FUI A;  2M13 A;  4YBT A;  5AIU A;  2EOD A;  2UZG A;  4ZQL A;  1WEV A;  3I2D A;  5TDW A;  3M62 A;  3U5P A;  3PLW A;  3C5K A;  2MD8 C;  2XOC A;  3O7A A;  2KU3 A;  2L75 A;  4GNG A;  2RSD A;  2CT2 A;  2KYU A;  2CSV A;  5LKT A;  5KH9 A;  4GB0 A;  2XOZ A;  1DVP A;  5D1M B;  2L5U A;  2KGG A;  5TRB A;  2KWK A;  4NN2 A;  4UI9 B;  4X3G A;  2PUY A;  3T7L A;  1HYJ A;  2L43 A;  3O37 A;  3KDE C;  2K1J A;  1WE9 A;  1RMD A;  3ZNI A;  3SOU A;  3JUE A;  2KFT A;  4XI1 A;  4GND A;  5TDR A;  4QQ4 A;  5FEY A;  4IC2 A;  3FAN A;  3FEH A;  5KH7 A;  3U5O A;  2QIC A;  3LQH A;  2D8U A;  4LLB A;  1DCQ A;  2VNF A;  2BAY A;  2Y1N A;  2LDR A;  4CCG X;  2LGG A;  3ZTG A;  3EB6 A;  2YW8 A;  3C6W A;  5D1L B;  5LKZ A;  2QJ0 A;  2Y43 A;  4MVT A;  3ZPV 1;  1JM7 A;  2M85 A;  2YHN A;  1LDK C;  3IHP A;  1JM7 B;  4Q6F A;  3M7K A;  2KWJ A;  4R2Y A; 
#chains in the Genus database with same CATH homology
 1WEM A;  1CHC A;  2KR4 A;  3MHH A;  3PHD A;  3N9N A;  3RPG B;  1X4U A;  2LGV A;  3O34 A;  3HTK C;  2LRI C;  4B86 C;  5B8D A;  2LV9 A;  4A4C A;  2MT5 A;  2VJE A;  2MA6 A;  2VJE B;  4W4U A;  3N9M A;  5EYA F;  2YQM A;  4AP4 A;  1Z2Q A;  4YAX A;  4V3K C;  2K17 A;  4BBQ A;  2F6N A;  2YHO A;  3PUQ A;  5TBN A;  2C2L A;  3T6R A;  5LKX A;  1VD4 A;  3O35 A;  4WZ3 B;  2G6Q A;  3SOW A;  3L11 A;  2FUU A;  4BHW A;  1F62 A;  5B76 A;  1Z60 A;  4AYC B;  4QF2 A;  1WEU A;  3SHB A;  4F52 B;  4YBS A;  4FJC A;  5G04 B;  2MNY A;  1MM3 A;  3ZVY A;  2KGI A;  2CKL B;  2LN0 A;  2CSZ A;  2ECT A;  1WEE A;  4FIP A;  3ASL A;  4YBM A;  1VFY A;  4GNF A;  2CSY A;  1N87 A;  3EB5 A;  5H9M A;  2Y1M A;  2H0D A;  2H0D B;  1LDJ B;  4TKP B;  2LQ6 A;  2F6J A;  3V43 A;  2K16 A;  2FSA A;  3N9Q A;  2I50 A;  1E4U A;  2JMJ A;  3RTR B;  3HCU A;  1HYI A;  2KWO A;  4GNE A;  1WEQ A;  2LXP C;  2VPB A;  3O33 A;  1WES A;  1K2F A;  1Z6U A;  3L1X A;  2RI7 A;  2VPD A;  4LK9 A;  4I7D A;  4AUQ B;  3LQI A;  1WEN A;  4ZDT A;  5I3L A;  4UP0 A;  2YQL A;  2PNX A;  4LJN A;  5J3X A;  4FO9 A;  5B77 A;  1WEP A;  2DX8 A;  3HCS A;  3U5M A;  2VPE A;  4S3O C;  3N9O A;  5FB1 A;  1X4J A;  4LKA A;  2KE1 A;  4N3W A;  1FBV A;  2L0B A;  1V87 A;  1T1H A;  5G0F A;  3ZVZ B;  4I7B A;  4WZ2 A;  4I7C A;  2ZET C;  3KNV A;  3M99 A;  5AIT A;  1VYX A;  1WEO A;  3SOX A;  3N9L A;  3VK6 A;  1JOC A;  4B7Y C;  3GL6 A;  2HDP A;  3M63 A;  1WIL A;  4FK5 A;  5B79 A;  3KV6 A;  2K4D A;  2LGL A;  3ZYQ A;  2YUR A;  2C2V S;  3L1Z B;  2KIZ A;  1U6G B;  2JMD A;  3RPG C;  2MNZ A;  2KWN A;  2IDA A;  3PUR A;  3LQJ A;  3N9P A;  2YUC A;  4WA6 A;  4YAT A;  2MA5 A;  3O70 A;  4UP5 A;  5C13 A;  4A4B A;  4IC3 A;  1ZBD B;  4QF3 A;  4AYC A;  3DQV R;  4AVX A;  5DKA A;  2LXH C;  2M1R A;  2MUM A;  4L7X A;  2F42 A;  1BOR A;  2CKL A;  1XWH A;  2VJF A;  2D8S A;  3DPL R;  3FL2 A;  2VJF B;  4R8P K;  2ECI A;  4C9Z A;  5LCW B;  1X4I A;  5D1K B;  5G05 B;  1FP0 A;  1WEW A;  2YT5 A;  2YYR A;  5H1U A;  4MSX A;  2YU4 A;  4ZUX U;  3KQI A;  2VPG A;  1IYM A;  3MHS A;  5FB0 A;  3O36 A;  3ZPV E;  2HYE D;  4PTB A;  3HCT A;  2JMI A;  3KV5 A;  4LAD B;  2EA6 A;  2G43 A;  4YAB A;  2ECV A;  4A0C D;  4R7E A;  4O64 A;  5B75 A;  1MM2 A;  2ECN A;  5TAB A;  2L80 A;  2NAA A;  5H1V A;  2ECW A;  4YC9 A;  5FER A;  1G25 A;  2VP7 A;  3U5N A;  3QZV A;  2LGK A;  4P5O B;  3NG2 A;  5B78 A;  2MIQ A;  1WGM A;  2MD7 B;  4YAD A;  4CA1 A;  5JG6 A;  2YSM A;  1WIM A;  4A49 A;  4L58 A;  2YSJ A;  2ECG A;  2XEU A;  5H1T A;  5C11 A;  2E6S A;  4S3O B;  3LRQ A;  2E6R A;  2M6M A;  2JRJ A;  4N4F A;  2YRE A;  2G45 A;  2QIZ A;  4WZ0 A;  1WFK A;  3GV4 A;  5LKU A;  4PPE A;  2OXQ C;  2AN6 A;  2ECJ A;  2EGP A;  2KRE A;  5DIN A;  5KH3 A;  4V3L C;  2M3H A;  2XB1 A;  2FUI A;  4YBT A;  5AIU A;  2EOD A;  2UZG A;  4ZQL A;  1WEV A;  3I2D A;  5TDW A;  3M62 A;  3U5P A;  3C5K A;  2MD8 C;  3O7A A;  2KU3 A;  2L75 A;  4GNG A;  2RSD A;  2CT2 A;  2KYU A;  5LKT A;  5KH9 A;  4GB0 A;  1DVP A;  5D1M B;  2L5U A;  2KGG A;  5TRB A;  2KWK A;  4NN2 A;  4UI9 B;  4X3G A;  2PUY A;  3T7L A;  1HYJ A;  2L43 A;  3O37 A;  2K1J A;  1WE9 A;  1RMD A;  3ZNI A;  3SOU A;  2KFT A;  4XI1 A;  4GND A;  5TDR A;  5FEY A;  4IC2 A;  5KH7 A;  3U5O A;  2QIC A;  3LQH A;  4LLB A;  2VNF A;  2BAY A;  2Y1N A;  2LDR A;  4CCG X;  2LGG A;  3ZTG A;  3EB6 A;  2YW8 A;  3C6W A;  5D1L B;  5LKZ A;  2QJ0 A;  2Y43 A;  4MVT A;  3ZPV 1;  1JM7 A;  2M85 A;  2YHN A;  1LDK C;  3IHP A;  1JM7 B;  4Q6F A;  2KWJ A;  4R2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...