2YU4A

Solution structure of the sp-ring domain in non-smc element 2 homolog (mms21, s. cerevisiae)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
94
Chain Sequence
GSSGSSGFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SP-RING domain in non-SMC element 2 homolog (MMS21, S. cerevisiae)
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords E3 SUMO-protein ligase NSE2
total genus 14
structure length 94
sequence length 94
ec nomenclature ec 6.-.-.-:
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yu4A00
2F6NA 5G05B 2CKLB 3U5PA 4MSXA 2YURA 4IC2A 1X4IA 3O7AA 2YQLA 2MUMA 5H1VA 4BHWA 4WZ2A 3ASLA 1LDJB 5LCWB 2ZETC 3U5NA 5LKUA 3HCUA 5FB1A 2VJFB 2JMIA 2MNZA 2KE1A 2C2VS 1JM7A 3KQIA 5FB0A 2CKLA 1WEPA 3ZYQA 2M1RA 3SHBA 2LGKA 4W4UA 5H1UA 2PUYA 2YSJA 2JMDA 2KWKA 4V3KC 4FJCA 4F52B 3GL6A 1WEWA 4BBQA 4L7XA 2NAAA 4TKPB 2E6SA 5LKZA 1WEEA 5LKXA 5H9MA 4YADA 2ECWA 4LKAA 2MNYA 2QJ0A 2LV9A 4O64A 4IC3A 2EGPA 1Z2QA 1VYXA 1FP0A 2VPDA 3M99A 2KWNA 4ZQLA 5FEYA 1CHCA 2LRIC 1WEUA 4B7YC 4YBMA 2IDAA 3IHPA 4NN2A 2LGGA 3ZPV1 4QF3A 2MT5A 3O37A 4YC9A 3N9NA 3KV5A 2XB1A 1WIMA 2EA6A 2I50A 2QIZA 3ZTGA 2H0DA 3KNVA 4R8PK 3MHHA 4I7BA 3O70A 3O35A 3PHDA 2VP7A 3M63A 3LQJA 2ECIA 2L75A 5KH9A 4AYCB 2L5UA 2LXPC 2VJFA 2LGVA 2YT5A 2M85A 3PUQA 4QF2A 1WEOA 5B76A 2KGIA 2KWOA 3C6WA 1ZBDB 4WA6A 5JG6A 3DPLR 2ECNA 4LK9A 1HYJA 1X4UA 4WZ3B 2MIQA 2C2LA 3RPGB 4YAXA 2RI7A 2CT2A 1HYIA 2F6JA 5B75A 1LDKC 4FIPA 5TBNA 2G6QA 5J3XA 4P5OB 4YATA 3LQHA 4LADB 3DQVR 3KV6A 2QICA 4C9ZA 5AITA 2LQ6A 2VPEA 5C13A 1FBVA 3I2DA 2G43A 1E4UA 2HDPA 2YU4A 2XEUA 2VJEA 2YW8A 4ZDTA 2CSZA 1VD4A 1X4JA 2K17A 1XWHA 2L80A 3V43A 1WEMA 3EB6A 4GB0A 2Y43A 4GNDA 3O36A 2ECJA 5EYAF 3LQIA 3LRQA 2L0BA 3RTRB 2K1JA 2AN6A 3O33A 3ZNIA 5G0FA 2KYUA 4I7DA 3NG2A 4PTBA 4AP4A 1WGMA 4I7CA 5TDRA 3PURA 4GNFA 2DX8A 1Z60A 3VK6A 3C5KA 2K4DA 3GV4A 4AUQB 5I3LA 4YABA 5G04B 2D8SA 2YUCA 2F42A 2L43A 2PNXA 1BORA 2RSDA 4ZUXU 1WENA 2KU3A 2VJEB 1DVPA 4MVTA 2G45A 3N9QA 5D1KB 5D1MB 3SOXA 3SOWA 4R7EA 2KFTA 1K2FA 5FERA 2VPBA 4XI1A 4AYCA 2FUUA 1WEVA 1Z6UA 2M3HA 4L58A 2BAYA 5D1LB 4FK5A 2MA6A 5B8DA 2H0DB 4GNGA 2Y1NA 3ZPVE 2YQMA 4R2YA 2YSMA 2FSAA 2LN0A 3ZVZB 1JOCA 2EODA 3T6RA 4CA1A 3ZVYA 1U6GB 1MM2A 5AIUA 4PPEA 2YHOA 1F62A 1WESA 3N9PA 4UP0A 3L1ZB 2MD7B 4UI9B 3N9LA 3L1XA 3HCSA 5TRBA 2YREA 1V87A 4Q6FA 4A4BA 1WEQA 2YHNA 4LLBA 3N9OA 2KR4A 2JRJA 3HTKC 1T1HA 1RMDA 2ECTA 2CSYA 1JM7B 2KIZA 4WZ0A 1WE9A 2LXHC 2M6MA 3M62A 4A4CA 3RPGC 4B86C 2HYED 4S3OB 3HCTA 3EB5A 2E6RA 3U5MA 2KGGA 2ECVA 3L11A 1G25A 1IYMA 4A0CD 5DINA 2VPGA 2OXQC 3T7LA 4UP5A 4CCGX 4YBTA 2KWJA 5TDWA 4X3GA 4S3OC 5KH3A 2UZGA 2MA5A 5H1TA 2FUIA 4FO9A 3QZVA 4LJNA 3U5OA 2LDRA 2K16A 4N4FA 2YYRA 3FL2A 2MD8C 5B78A 1WFKA 4N3WA 5DKAA 5B79A 1WILA 4A49A 5LKTA 2JMJA 3SOUA 5KH7A 2VNFA 1N87A 3MHSA 4AVXA 3N9MA 5TABA 2Y1MA 4GNEA 2ECGA 1VFYA 3O34A 1MM3A 4V3LC 5C11A 2KREA 4YBSA 5B77A 2LGLA
chains in the Genus database with same CATH superfamily
2F6NA 2CRWA 5G05B 2CKLB 3U5PA 3FAOA 4MSXA 2RR4A 3KDEC 2YURA 4IC2A 4OGCA 1X4IA 2FFWA 3O7AA 2MKEA 2YQLA 2MUMA 5H1VA 4BHWA 4WZ2A 3ASLA 1LDJB 5LCWB 3M7KA 2ZETC 3U5NA 5LKUA 2XOYA 3HCUA 5FB1A 2VJFB 3FJUB 2JMIA 2MNZA 2KE1A 2C2VS 2JUNA 1JM7A 3KQIA 5FB0A 2CKLA 1WEPA 3ZYQA 2M1RA 3SHBA 2LGKA 4W4UA 2CRRA 5H1UA 2PUYA 2YSJA 2JMDA 3O47A 2KWKA 4V3KC 4FJCA 2XP0A 4F52B 3GL6A 1WEWA 4BBQA 4L7XA 2NAAA 4TKPB 2E6SA 5LKZA 1WEEA 5LKXA 5H9MA 4YADA 2ECWA 4LKAA 2MNYA 2QJ0A 2LV9A 4O64A 5K3QA 4IC3A 2EGPA 1Z2QA 1VYXA 1FP0A 2VPDA 3M99A 2KWNA 4ZQLA 5FEYA 1CHCA 2LRIC 1WEUA 4B7YC 4YBMA 2IDAA 3IHPA 4NN2A 2LGGA 3ZPV1 4QQ4A 4QF3A 2MT5A 3O37A 4YC9A 3N9NA 3KV5A 2XB1A 1WIMA 2EA6A 2I50A 2QIZA 3ZTGA 2H0DA 3KNVA 2CONA 4R8PK 3MHHA 4I7BA 3O70A 3O35A 3PHDA 2VP7A 2B0OE 3M63A 3LQJA 2ECIA 2L75A 5KH9A 4AYCB 2L5UA 2LXPC 2OWAA 2VJFA 2LGVA 3LJUX 2YT5A 2M85A 3PUQA 4QF2A 2IQJA 1WEOA 5B76A 2KGIA 2KWOA 3C6WA 1ZBDB 4WA6A 5JG6A 3DPLR 2ECNA 4LK9A 1HYJA 1X4UA 4WZ3B 2MIQA 2C2LA 2P57A 3RPGB 4YAXA 2RI7A 2CT2A 1HYIA 2F6JA 5B75A 1LDKC 4FIPA 5TBNA 2G6QA 4P5OB 5J3XA 4YATA 3LQHA 4LADB 3DQVR 2DJAA 2M13A 5SVIB 3KV6A 2QICA 5AITA 2LQ6A 4C9ZA 2VPEA 5C13A 1FBVA 3I2DA 2G43A 1E4UA 2HDPA 2YVRA 2YU4A 2XEUA 2VJEA 2YW8A 4ZDTA 2CSZA 2JM3A 1VD4A 1X4JA 2K17A 1XWHA 2L80A 3V43A 3FANA 1WEMA 3EB6A 4GB0A 2Y43A 4GNDA 3O36A 2ECJA 5EYAF 3LQIA 3LRQA 2L0BA 3SUBA 3RTRB 2K1JA 2AN6A 3O33A 5G0FA 3ZNIA 2KYUA 4I7DA 3NG2A 4PTBA 4AP4A 1WGMA 4I7CA 5TDRA 3PURA 4GNFA 2DX8A 1Z60A 3VK6A 3C5KA 2K4DA 3GV4A 4AUQB 5I3LA 3LVRE 4YABA 5G04B 2D8SA 2YUCA 2F42A 4O62A 2L43A 4OGEA 2PNXA 1BORA 5SVYA 2RSDA 4ZUXU 1WENA 2KU3A 2KKYA 2CSVA 2VJEB 1DVPA 4MVTA 2G45A 3N9QA 5D1KB 5D1MB 3SOXA 3SOWA 4R7EA 2KFTA 1K2FA 5FERA 2VPBA 4XI1A 4AYCA 2FUUA 1WEVA 1Z6UA 2M3HA 4L58A 2BAYA 5D1LB 4FK5A 2MA6A 5B8DA 2H0DB 4GNGA 3DDTA 2Y1NA 3ZPVE 2YQMA 4R2YA 2YSMA 2FSAA 4Z0OA 2LN0A 4Z0RA 3ZVZB 1JOCA 3FEHA 2LAUA 2EODA 3T6RA 4CA1A 3DWDA 3ZVYA 1U6GB 1MM2A 5AIUA 4PPEA 2YHOA 1F62A 1WESA 2EXUA 3N9PA 4UP0A 3L1ZB 2MD7B 4UI9B 3T9KA 3N9LA 3L1XA 2FD4A 3HCSA 3JUEA 5TRBA 4F1PA 2YREA 1V87A 4Q6FA 4A4BA 1WEQA 2YHNA 4LLBA 3N9OA 2KR4A 2JRJA 3HTKC 1T1HA 1RMDA 2ECTA 2CSYA 2D8UA 5SVXA 1JM7B 3FM8C 2KIZA 2DSMA 4WZ0A 1WE9A 2LXHC 3E2DA 2M6MA 3M62A 4A4CA 3RPGC 4B86C 2HYED 4S3OB 3HCTA 3EB5A 2E6RA 1DCQA 3U5MA 2KGGA 2ECVA 3L11A 1G25A 1IYMA 4A0CD 5DINA 2VPGA 2OXQC 3T7LA 4UP5A 2L7PA 4CCGX 4YBTA 2KWJA 5TDWA 4X3GA 2XOCA 4S3OC 5KH3A 2UZGA 2XOZA 2MA5A 5H1TA 2FUIA 4FO9A 3QZVA 1MBMA 4LJNA 2EGMA 3U5OA 2LDRA 2K16A 5SVIA 4N4FA 3PLWA 2YYRA 3Q1DA 3FL2A 2MD8C 5B78A 1WFKA 4N3WA 5DKAA 5B79A 3MDBC 1WILA 4A49A 5LKTA 2JMJA 3SOUA 2KKXA 5KH7A 2VNFA 1N87A 2E61A 3MHSA 3LDYA 3H7HA 4AVXA 3N9MA 5TABA 2Y1MA 4GNEA 2ECGA 4H9DA 1VFYA 3O34A 1MM3A 4V3LC 3LVQE 5C11A 2KREA 4YBSA 5B77A 2LGLA
chains in the Genus database with same CATH topology
2F6NA 5G05B 2CKLB 3U5PA 4MSXA 2YURA 4IC2A 1X4IA 3O7AA 2YQLA 2MUMA 5H1VA 4BHWA 4WZ2A 3ASLA 1LDJB 5LCWB 2ZETC 3U5NA 5LKUA 3HCUA 5FB1A 2VJFB 2JMIA 2MNZA 2KE1A 2C2VS 1JM7A 3KQIA 5FB0A 2CKLA 1WEPA 3ZYQA 2M1RA 3SHBA 2LGKA 4W4UA 5H1UA 2PUYA 2YSJA 2JMDA 2KWKA 4V3KC 4FJCA 4F52B 3GL6A 1WEWA 4BBQA 4L7XA 2NAAA 4TKPB 2E6SA 5LKZA 1WEEA 5LKXA 5H9MA 4YADA 2ECWA 4LKAA 2MNYA 2QJ0A 2LV9A 4O64A 4IC3A 2EGPA 1Z2QA 1VYXA 1FP0A 2VPDA 3M99A 2KWNA 4ZQLA 5FEYA 1CHCA 2LRIC 1WEUA 4B7YC 4YBMA 2IDAA 3IHPA 4NN2A 2LGGA 3ZPV1 4QF3A 2MT5A 3O37A 4YC9A 3N9NA 3KV5A 2XB1A 1WIMA 2EA6A 2I50A 2QIZA 3ZTGA 2H0DA 3KNVA 4R8PK 3MHHA 4I7BA 3O70A 3O35A 3PHDA 2VP7A 3M63A 3LQJA 2ECIA 2L75A 5KH9A 4AYCB 2L5UA 2LXPC 2VJFA 2LGVA 2YT5A 2M85A 3PUQA 4QF2A 1WEOA 5B76A 2KGIA 2KWOA 3C6WA 1ZBDB 4WA6A 5JG6A 3DPLR 2ECNA 4LK9A 1HYJA 1X4UA 4WZ3B 2MIQA 2C2LA 3RPGB 4YAXA 2RI7A 2CT2A 1HYIA 2F6JA 5B75A 1LDKC 4FIPA 5TBNA 2G6QA 5J3XA 4P5OB 4YATA 3LQHA 4LADB 3DQVR 3KV6A 2QICA 4C9ZA 5AITA 2LQ6A 2VPEA 5C13A 1FBVA 3I2DA 2G43A 1E4UA 2HDPA 2YU4A 2XEUA 2VJEA 2YW8A 4ZDTA 2CSZA 1VD4A 1X4JA 2K17A 1XWHA 2L80A 3V43A 1WEMA 3EB6A 4GB0A 2Y43A 4GNDA 3O36A 2ECJA 5EYAF 3LQIA 3LRQA 2L0BA 3RTRB 2K1JA 2AN6A 3O33A 3ZNIA 5G0FA 2KYUA 4I7DA 3NG2A 4PTBA 4AP4A 1WGMA 4I7CA 5TDRA 3PURA 4GNFA 2DX8A 1Z60A 3VK6A 3C5KA 2K4DA 3GV4A 4AUQB 5I3LA 4YABA 5G04B 2D8SA 2YUCA 2F42A 2L43A 2PNXA 1BORA 2RSDA 4ZUXU 1WENA 2KU3A 2VJEB 1DVPA 4MVTA 2G45A 3N9QA 5D1KB 5D1MB 3SOXA 3SOWA 4R7EA 2KFTA 1K2FA 5FERA 2VPBA 4XI1A 4AYCA 2FUUA 1WEVA 1Z6UA 2M3HA 4L58A 2BAYA 5D1LB 4FK5A 2MA6A 5B8DA 2H0DB 4GNGA 2Y1NA 3ZPVE 2YQMA 4R2YA 2YSMA 2FSAA 2LN0A 3ZVZB 1JOCA 2EODA 3T6RA 4CA1A 3ZVYA 1U6GB 1MM2A 5AIUA 4PPEA 2YHOA 1F62A 1WESA 3N9PA 4UP0A 3L1ZB 2MD7B 4UI9B 3N9LA 3L1XA 3HCSA 5TRBA 2YREA 1V87A 4Q6FA 4A4BA 1WEQA 2YHNA 4LLBA 3N9OA 2KR4A 2JRJA 3HTKC 1T1HA 1RMDA 2ECTA 2CSYA 1JM7B 2KIZA 4WZ0A 1WE9A 2LXHC 2M6MA 3M62A 4A4CA 3RPGC 4B86C 2HYED 4S3OB 3HCTA 3EB5A 2E6RA 3U5MA 2KGGA 2ECVA 3L11A 1G25A 1IYMA 4A0CD 5DINA 2VPGA 2OXQC 3T7LA 4UP5A 4CCGX 4YBTA 2KWJA 5TDWA 4X3GA 4S3OC 5KH3A 2UZGA 2MA5A 5H1TA 2FUIA 4FO9A 3QZVA 4LJNA 3U5OA 2LDRA 2K16A 4N4FA 2YYRA 3FL2A 2MD8C 5B78A 1WFKA 4N3WA 5DKAA 5B79A 1WILA 4A49A 5LKTA 2JMJA 3SOUA 5KH7A 2VNFA 1N87A 3MHSA 4AVXA 3N9MA 5TABA 2Y1MA 4GNEA 2ECGA 1VFYA 3O34A 1MM3A 4V3LC 5C11A 2KREA 4YBSA 5B77A 2LGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F6N A;  5G05 B;  2CKL B;  3U5P A;  4MSX A;  2YUR A;  4IC2 A;  1X4I A;  3O7A A;  2YQL A;  2MUM A;  5H1V A;  4BHW A;  4WZ2 A;  3ASL A;  1LDJ B;  5LCW B;  2ZET C;  3U5N A;  5LKU A;  3HCU A;  5FB1 A;  2VJF B;  2JMI A;  2MNZ A;  2KE1 A;  2C2V S;  1JM7 A;  3KQI A;  5FB0 A;  2CKL A;  1WEP A;  3ZYQ A;  2M1R A;  3SHB A;  2LGK A;  4W4U A;  5H1U A;  2PUY A;  2YSJ A;  2JMD A;  2KWK A;  4V3K C;  4FJC A;  4F52 B;  3GL6 A;  1WEW A;  4BBQ A;  4L7X A;  2NAA A;  4TKP B;  2E6S A;  5LKZ A;  1WEE A;  5LKX A;  5H9M A;  4YAD A;  2ECW A;  4LKA A;  2MNY A;  2QJ0 A;  2LV9 A;  4O64 A;  4IC3 A;  2EGP A;  1Z2Q A;  1VYX A;  1FP0 A;  2VPD A;  3M99 A;  2KWN A;  4ZQL A;  5FEY A;  1CHC A;  2LRI C;  1WEU A;  4B7Y C;  4YBM A;  2IDA A;  3IHP A;  4NN2 A;  2LGG A;  3ZPV 1;  4QF3 A;  2MT5 A;  3O37 A;  4YC9 A;  3N9N A;  3KV5 A;  2XB1 A;  1WIM A;  2EA6 A;  2I50 A;  2QIZ A;  3ZTG A;  2H0D A;  3KNV A;  4R8P K;  3MHH A;  4I7B A;  3O70 A;  3O35 A;  3PHD A;  2VP7 A;  3M63 A;  3LQJ A;  2ECI A;  2L75 A;  5KH9 A;  4AYC B;  2L5U A;  2LXP C;  2VJF A;  2LGV A;  2YT5 A;  2M85 A;  3PUQ A;  4QF2 A;  1WEO A;  5B76 A;  2KGI A;  2KWO A;  3C6W A;  1ZBD B;  4WA6 A;  5JG6 A;  3DPL R;  2ECN A;  4LK9 A;  1HYJ A;  1X4U A;  4WZ3 B;  2MIQ A;  2C2L A;  3RPG B;  4YAX A;  2RI7 A;  2CT2 A;  1HYI A;  2F6J A;  5B75 A;  1LDK C;  4FIP A;  5TBN A;  2G6Q A;  5J3X A;  4P5O B;  4YAT A;  3LQH A;  4LAD B;  3DQV R;  3KV6 A;  2QIC A;  4C9Z A;  5AIT A;  2LQ6 A;  2VPE A;  5C13 A;  1FBV A;  3I2D A;  2G43 A;  1E4U A;  2HDP A;  2YU4 A;  2XEU A;  2VJE A;  2YW8 A;  4ZDT A;  2CSZ A;  1VD4 A;  1X4J A;  2K17 A;  1XWH A;  2L80 A;  3V43 A;  1WEM A;  3EB6 A;  4GB0 A;  2Y43 A;  4GND A;  3O36 A;  2ECJ A;  5EYA F;  3LQI A;  3LRQ A;  2L0B A;  3RTR B;  2K1J A;  2AN6 A;  3O33 A;  3ZNI A;  5G0F A;  2KYU A;  4I7D A;  3NG2 A;  4PTB A;  4AP4 A;  1WGM A;  4I7C A;  5TDR A;  3PUR A;  4GNF A;  2DX8 A;  1Z60 A;  3VK6 A;  3C5K A;  2K4D A;  3GV4 A;  4AUQ B;  5I3L A;  4YAB A;  5G04 B;  2D8S A;  2YUC A;  2F42 A;  2L43 A;  2PNX A;  1BOR A;  2RSD A;  4ZUX U;  1WEN A;  2KU3 A;  2VJE B;  1DVP A;  4MVT A;  2G45 A;  3N9Q A;  5D1K B;  5D1M B;  3SOX A;  3SOW A;  4R7E A;  2KFT A;  1K2F A;  5FER A;  2VPB A;  4XI1 A;  4AYC A;  2FUU A;  1WEV A;  1Z6U A;  2M3H A;  4L58 A;  2BAY A;  5D1L B;  4FK5 A;  2MA6 A;  5B8D A;  2H0D B;  4GNG A;  2Y1N A;  3ZPV E;  2YQM A;  4R2Y A;  2YSM A;  2FSA A;  2LN0 A;  3ZVZ B;  1JOC A;  2EOD A;  3T6R A;  4CA1 A;  3ZVY A;  1U6G B;  1MM2 A;  5AIU A;  4PPE A;  2YHO A;  1F62 A;  1WES A;  3N9P A;  4UP0 A;  3L1Z B;  2MD7 B;  4UI9 B;  3N9L A;  3L1X A;  3HCS A;  5TRB A;  2YRE A;  1V87 A;  4Q6F A;  4A4B A;  1WEQ A;  2YHN A;  4LLB A;  3N9O A;  2KR4 A;  2JRJ A;  3HTK C;  1T1H A;  1RMD A;  2ECT A;  2CSY A;  1JM7 B;  2KIZ A;  4WZ0 A;  1WE9 A;  2LXH C;  2M6M A;  3M62 A;  4A4C A;  3RPG C;  4B86 C;  2HYE D;  4S3O B;  3HCT A;  3EB5 A;  2E6R A;  3U5M A;  2KGG A;  2ECV A;  3L11 A;  1G25 A;  1IYM A;  4A0C D;  5DIN A;  2VPG A;  2OXQ C;  3T7L A;  4UP5 A;  4CCG X;  4YBT A;  2KWJ A;  5TDW A;  4X3G A;  4S3O C;  5KH3 A;  2UZG A;  2MA5 A;  5H1T A;  2FUI A;  4FO9 A;  3QZV A;  4LJN A;  3U5O A;  2LDR A;  2K16 A;  4N4F A;  2YYR A;  3FL2 A;  2MD8 C;  5B78 A;  1WFK A;  4N3W A;  5DKA A;  5B79 A;  1WIL A;  4A49 A;  5LKT A;  2JMJ A;  3SOU A;  5KH7 A;  2VNF A;  1N87 A;  3MHS A;  4AVX A;  3N9M A;  5TAB A;  2Y1M A;  4GNE A;  2ECG A;  1VFY A;  3O34 A;  1MM3 A;  4V3L C;  5C11 A;  2KRE A;  4YBS A;  5B77 A;  2LGL A; 
#chains in the Genus database with same CATH topology
 2F6N A;  2CRW A;  5G05 B;  2CKL B;  3U5P A;  3FAO A;  4MSX A;  2RR4 A;  3KDE C;  2YUR A;  4IC2 A;  4OGC A;  1X4I A;  2FFW A;  3O7A A;  2MKE A;  2YQL A;  2MUM A;  5H1V A;  4BHW A;  4WZ2 A;  3ASL A;  1LDJ B;  5LCW B;  3M7K A;  2ZET C;  3U5N A;  5LKU A;  2XOY A;  3HCU A;  5FB1 A;  2VJF B;  3FJU B;  2JMI A;  2MNZ A;  2KE1 A;  2C2V S;  2JUN A;  1JM7 A;  3KQI A;  5FB0 A;  2CKL A;  1WEP A;  3ZYQ A;  2M1R A;  3SHB A;  2LGK A;  4W4U A;  2CRR A;  5H1U A;  2PUY A;  2YSJ A;  2JMD A;  3O47 A;  2KWK A;  4V3K C;  4FJC A;  2XP0 A;  4F52 B;  3GL6 A;  1WEW A;  4BBQ A;  4L7X A;  2NAA A;  4TKP B;  2E6S A;  5LKZ A;  1WEE A;  5LKX A;  5H9M A;  4YAD A;  2ECW A;  4LKA A;  2MNY A;  2QJ0 A;  2LV9 A;  4O64 A;  5K3Q A;  4IC3 A;  2EGP A;  1Z2Q A;  1VYX A;  1FP0 A;  2VPD A;  3M99 A;  2KWN A;  4ZQL A;  5FEY A;  1CHC A;  2LRI C;  1WEU A;  4B7Y C;  4YBM A;  2IDA A;  3IHP A;  4NN2 A;  2LGG A;  3ZPV 1;  4QQ4 A;  4QF3 A;  2MT5 A;  3O37 A;  4YC9 A;  3N9N A;  3KV5 A;  2XB1 A;  1WIM A;  2EA6 A;  2I50 A;  2QIZ A;  3ZTG A;  2H0D A;  3KNV A;  2CON A;  4R8P K;  3MHH A;  4I7B A;  3O70 A;  3O35 A;  3PHD A;  2VP7 A;  2B0O E;  3M63 A;  3LQJ A;  2ECI A;  2L75 A;  5KH9 A;  4AYC B;  2L5U A;  2LXP C;  2OWA A;  2VJF A;  2LGV A;  3LJU X;  2YT5 A;  2M85 A;  3PUQ A;  4QF2 A;  2IQJ A;  1WEO A;  5B76 A;  2KGI A;  2KWO A;  3C6W A;  1ZBD B;  4WA6 A;  5JG6 A;  3DPL R;  2ECN A;  4LK9 A;  1HYJ A;  1X4U A;  4WZ3 B;  2MIQ A;  2C2L A;  2P57 A;  3RPG B;  4YAX A;  2RI7 A;  2CT2 A;  1HYI A;  2F6J A;  5B75 A;  1LDK C;  4FIP A;  5TBN A;  2G6Q A;  4P5O B;  5J3X A;  4YAT A;  3LQH A;  4LAD B;  3DQV R;  2DJA A;  2M13 A;  5SVI B;  3KV6 A;  2QIC A;  5AIT A;  2LQ6 A;  4C9Z A;  2VPE A;  5C13 A;  1FBV A;  3I2D A;  2G43 A;  1E4U A;  2HDP A;  2YVR A;  2YU4 A;  2XEU A;  2VJE A;  2YW8 A;  4ZDT A;  2CSZ A;  2JM3 A;  1VD4 A;  1X4J A;  2K17 A;  1XWH A;  2L80 A;  3V43 A;  3FAN A;  1WEM A;  3EB6 A;  4GB0 A;  2Y43 A;  4GND A;  3O36 A;  2ECJ A;  5EYA F;  3LQI A;  3LRQ A;  2L0B A;  3SUB A;  3RTR B;  2K1J A;  2AN6 A;  3O33 A;  5G0F A;  3ZNI A;  2KYU A;  4I7D A;  3NG2 A;  4PTB A;  4AP4 A;  1WGM A;  4I7C A;  5TDR A;  3PUR A;  4GNF A;  2DX8 A;  1Z60 A;  3VK6 A;  3C5K A;  2K4D A;  3GV4 A;  4AUQ B;  5I3L A;  3LVR E;  4YAB A;  5G04 B;  2D8S A;  2YUC A;  2F42 A;  4O62 A;  2L43 A;  4OGE A;  2PNX A;  1BOR A;  5SVY A;  2RSD A;  4ZUX U;  1WEN A;  2KU3 A;  2KKY A;  2CSV A;  2VJE B;  1DVP A;  4MVT A;  2G45 A;  3N9Q A;  5D1K B;  5D1M B;  3SOX A;  3SOW A;  4R7E A;  2KFT A;  1K2F A;  5FER A;  2VPB A;  4XI1 A;  4AYC A;  2FUU A;  1WEV A;  1Z6U A;  2M3H A;  4L58 A;  2BAY A;  5D1L B;  4FK5 A;  2MA6 A;  5B8D A;  2H0D B;  4GNG A;  3DDT A;  2Y1N A;  3ZPV E;  2YQM A;  4R2Y A;  2YSM A;  2FSA A;  4Z0O A;  2LN0 A;  4Z0R A;  3ZVZ B;  1JOC A;  3FEH A;  2LAU A;  2EOD A;  3T6R A;  4CA1 A;  3DWD A;  3ZVY A;  1U6G B;  1MM2 A;  5AIU A;  4PPE A;  2YHO A;  1F62 A;  1WES A;  2EXU A;  3N9P A;  4UP0 A;  3L1Z B;  2MD7 B;  4UI9 B;  3T9K A;  3N9L A;  3L1X A;  2FD4 A;  3HCS A;  3JUE A;  5TRB A;  4F1P A;  2YRE A;  1V87 A;  4Q6F A;  4A4B A;  1WEQ A;  2YHN A;  4LLB A;  3N9O A;  2KR4 A;  2JRJ A;  3HTK C;  1T1H A;  1RMD A;  2ECT A;  2CSY A;  2D8U A;  5SVX A;  1JM7 B;  3FM8 C;  2KIZ A;  2DSM A;  4WZ0 A;  1WE9 A;  2LXH C;  3E2D A;  2M6M A;  3M62 A;  4A4C A;  3RPG C;  4B86 C;  2HYE D;  4S3O B;  3HCT A;  3EB5 A;  2E6R A;  1DCQ A;  3U5M A;  2KGG A;  2ECV A;  3L11 A;  1G25 A;  1IYM A;  4A0C D;  5DIN A;  2VPG A;  2OXQ C;  3T7L A;  4UP5 A;  2L7P A;  4CCG X;  4YBT A;  2KWJ A;  5TDW A;  4X3G A;  2XOC A;  4S3O C;  5KH3 A;  2UZG A;  2XOZ A;  2MA5 A;  5H1T A;  2FUI A;  4FO9 A;  3QZV A;  1MBM A;  4LJN A;  2EGM A;  3U5O A;  2LDR A;  2K16 A;  5SVI A;  4N4F A;  3PLW A;  2YYR A;  3Q1D A;  3FL2 A;  2MD8 C;  5B78 A;  1WFK A;  4N3W A;  5DKA A;  5B79 A;  3MDB C;  1WIL A;  4A49 A;  5LKT A;  2JMJ A;  3SOU A;  2KKX A;  5KH7 A;  2VNF A;  1N87 A;  2E61 A;  3MHS A;  3LDY A;  3H7H A;  4AVX A;  3N9M A;  5TAB A;  2Y1M A;  4GNE A;  2ECG A;  4H9D A;  1VFY A;  3O34 A;  1MM3 A;  4V3L C;  3LVQ E;  5C11 A;  2KRE A;  4YBS A;  5B77 A;  2LGL A; 
#chains in the Genus database with same CATH homology
 2F6N A;  5G05 B;  2CKL B;  3U5P A;  4MSX A;  2YUR A;  4IC2 A;  1X4I A;  3O7A A;  2YQL A;  2MUM A;  5H1V A;  4BHW A;  4WZ2 A;  3ASL A;  1LDJ B;  5LCW B;  2ZET C;  3U5N A;  5LKU A;  3HCU A;  5FB1 A;  2VJF B;  2JMI A;  2MNZ A;  2KE1 A;  2C2V S;  1JM7 A;  3KQI A;  5FB0 A;  2CKL A;  1WEP A;  3ZYQ A;  2M1R A;  3SHB A;  2LGK A;  4W4U A;  5H1U A;  2PUY A;  2YSJ A;  2JMD A;  2KWK A;  4V3K C;  4FJC A;  4F52 B;  3GL6 A;  1WEW A;  4BBQ A;  4L7X A;  2NAA A;  4TKP B;  2E6S A;  5LKZ A;  1WEE A;  5LKX A;  5H9M A;  4YAD A;  2ECW A;  4LKA A;  2MNY A;  2QJ0 A;  2LV9 A;  4O64 A;  4IC3 A;  2EGP A;  1Z2Q A;  1VYX A;  1FP0 A;  2VPD A;  3M99 A;  2KWN A;  4ZQL A;  5FEY A;  1CHC A;  2LRI C;  1WEU A;  4B7Y C;  4YBM A;  2IDA A;  3IHP A;  4NN2 A;  2LGG A;  3ZPV 1;  4QF3 A;  2MT5 A;  3O37 A;  4YC9 A;  3N9N A;  3KV5 A;  2XB1 A;  1WIM A;  2EA6 A;  2I50 A;  2QIZ A;  3ZTG A;  2H0D A;  3KNV A;  4R8P K;  3MHH A;  4I7B A;  3O70 A;  3O35 A;  3PHD A;  2VP7 A;  3M63 A;  3LQJ A;  2ECI A;  2L75 A;  5KH9 A;  4AYC B;  2L5U A;  2LXP C;  2VJF A;  2LGV A;  2YT5 A;  2M85 A;  3PUQ A;  4QF2 A;  1WEO A;  5B76 A;  2KGI A;  2KWO A;  3C6W A;  1ZBD B;  4WA6 A;  5JG6 A;  3DPL R;  2ECN A;  4LK9 A;  1HYJ A;  1X4U A;  4WZ3 B;  2MIQ A;  2C2L A;  3RPG B;  4YAX A;  2RI7 A;  2CT2 A;  1HYI A;  2F6J A;  5B75 A;  1LDK C;  4FIP A;  5TBN A;  2G6Q A;  5J3X A;  4P5O B;  4YAT A;  3LQH A;  4LAD B;  3DQV R;  3KV6 A;  2QIC A;  4C9Z A;  5AIT A;  2LQ6 A;  2VPE A;  5C13 A;  1FBV A;  3I2D A;  2G43 A;  1E4U A;  2HDP A;  2YU4 A;  2XEU A;  2VJE A;  2YW8 A;  4ZDT A;  2CSZ A;  1VD4 A;  1X4J A;  2K17 A;  1XWH A;  2L80 A;  3V43 A;  1WEM A;  3EB6 A;  4GB0 A;  2Y43 A;  4GND A;  3O36 A;  2ECJ A;  5EYA F;  3LQI A;  3LRQ A;  2L0B A;  3RTR B;  2K1J A;  2AN6 A;  3O33 A;  3ZNI A;  5G0F A;  2KYU A;  4I7D A;  3NG2 A;  4PTB A;  4AP4 A;  1WGM A;  4I7C A;  5TDR A;  3PUR A;  4GNF A;  2DX8 A;  1Z60 A;  3VK6 A;  3C5K A;  2K4D A;  3GV4 A;  4AUQ B;  5I3L A;  4YAB A;  5G04 B;  2D8S A;  2YUC A;  2F42 A;  2L43 A;  2PNX A;  1BOR A;  2RSD A;  4ZUX U;  1WEN A;  2KU3 A;  2VJE B;  1DVP A;  4MVT A;  2G45 A;  3N9Q A;  5D1K B;  5D1M B;  3SOX A;  3SOW A;  4R7E A;  2KFT A;  1K2F A;  5FER A;  2VPB A;  4XI1 A;  4AYC A;  2FUU A;  1WEV A;  1Z6U A;  2M3H A;  4L58 A;  2BAY A;  5D1L B;  4FK5 A;  2MA6 A;  5B8D A;  2H0D B;  4GNG A;  2Y1N A;  3ZPV E;  2YQM A;  4R2Y A;  2YSM A;  2FSA A;  2LN0 A;  3ZVZ B;  1JOC A;  2EOD A;  3T6R A;  4CA1 A;  3ZVY A;  1U6G B;  1MM2 A;  5AIU A;  4PPE A;  2YHO A;  1F62 A;  1WES A;  3N9P A;  4UP0 A;  3L1Z B;  2MD7 B;  4UI9 B;  3N9L A;  3L1X A;  3HCS A;  5TRB A;  2YRE A;  1V87 A;  4Q6F A;  4A4B A;  1WEQ A;  2YHN A;  4LLB A;  3N9O A;  2KR4 A;  2JRJ A;  3HTK C;  1T1H A;  1RMD A;  2ECT A;  2CSY A;  1JM7 B;  2KIZ A;  4WZ0 A;  1WE9 A;  2LXH C;  2M6M A;  3M62 A;  4A4C A;  3RPG C;  4B86 C;  2HYE D;  4S3O B;  3HCT A;  3EB5 A;  2E6R A;  3U5M A;  2KGG A;  2ECV A;  3L11 A;  1G25 A;  1IYM A;  4A0C D;  5DIN A;  2VPG A;  2OXQ C;  3T7L A;  4UP5 A;  4CCG X;  4YBT A;  2KWJ A;  5TDW A;  4X3G A;  4S3O C;  5KH3 A;  2UZG A;  2MA5 A;  5H1T A;  2FUI A;  4FO9 A;  3QZV A;  4LJN A;  3U5O A;  2LDR A;  2K16 A;  4N4F A;  2YYR A;  3FL2 A;  2MD8 C;  5B78 A;  1WFK A;  4N3W A;  5DKA A;  5B79 A;  1WIL A;  4A49 A;  5LKT A;  2JMJ A;  3SOU A;  5KH7 A;  2VNF A;  1N87 A;  3MHS A;  4AVX A;  3N9M A;  5TAB A;  2Y1M A;  4GNE A;  2ECG A;  1VFY A;  3O34 A;  1MM3 A;  4V3L C;  5C11 A;  2KRE A;  4YBS A;  5B77 A;  2LGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...