2YU4A

Solution structure of the sp-ring domain in non-smc element 2 homolog (mms21, s. cerevisiae)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
94
Chain Sequence
GSSGSSGFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords E3 SUMO-protein ligase NSE2
publication title Solution structure of the SP-RING domain in non-SMC element 2 homolog (MMS21, S. cerevisiae)
rcsb
source organism Homo sapiens
total genus 14
structure length 94
sequence length 94
ec nomenclature ec 6.-.-.-:
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yu4A00
4P5OB 5FB1A 4LK9A 5D1KB 4FIPA 5B76A 4GNGA 1WE9A 1MM2A 2YSMA 4R2YA 2PUYA 3N9OA 2VJEB 2EODA 2H0DB 1HYJA 2M85A 1X4UA 4PPEA 1VYXA 4YABA 3HTKC 3MHSA 4NN2A 1X4IA 2LXHC 2L75A 3U5PA 2YHOA 3ZPVE 2JRJA 2Y43A 4ZQLA 3SOXA 3M62A 2CSYA 2MNZA 1X4JA 3LRQA 2VNFA 4B86C 4F52B 2KWKA 1WEOA 2I50A 3NG2A 4A49A 3FL2A 4YC9A 5AIUA 3LQJA 1JOCA 2BAYA 1FBVA 5LKTA 2LN0A 2VPDA 3M63A 2KWJA 4I7CA 4UI9B 4YAXA 2QIZA 3N9NA 1WEEA 3LQHA 5AITA 5H1VA 3MHHA 4O64A 3L1XA 4X3GA 3RPGB 3ZVYA 3O7AA 1WEUA 3L11A 2YU4A 2HYED 2XB1A 2L5UA 2H0DA 2KGIA 5LCWB 4AP4A 5B78A 1IYMA 2KGGA 5D1MB 4FO9A 4L7XA 5KH7A 3EB5A 4I7DA 3ZYQA 1E4UA 2KIZA 4V3KC 2YHNA 2ECJA 2ECTA 3HCSA 3V43A 5FERA 2RSDA 3RTRB 4ZUXU 1WIMA 4LLBA 3KV5A 1CHCA 2JMJA 4BHWA 3O37A 1DVPA 5TBNA 1ZBDB 2XEUA 5B79A 4UP0A 1WESA 3PHDA 1T1HA 2MT5A 1WEWA 3U5OA 3VK6A 3QZVA 4AUQB 2KU3A 2K1JA 2LDRA 3KNVA 5D1LB 4TKPB 3O33A 5G04B 3N9PA 1HYIA 3HCUA 4FJCA 5JG6A 2LXPC 3PURA 5H9MA 2VJFB 2L80A 3GL6A 2D8SA 5TRBA 5B8DA 2Y1NA 2ECNA 4L58A 3ASLA 2LQ6A 2JMIA 4LKAA 1WEPA 3N9QA 2VP7A 4WZ3B 3RPGC 1JM7B 2CT2A 4YBSA 2M6MA 4R7EA 2F6NA 4S3OB 5FB0A 1G25A 2YURA 4QF3A 2PNXA 2G43A 4YATA 2KWOA 4C9ZA 2CKLB 4AYCB 4R8PK 2FUIA 5C13A 2LGVA 5EYAF 4MVTA 4GB0A 5I3LA 2AN6A 2K4DA 4B7YC 2MD7B 2ECWA 5TABA 5B75A 3KQIA 2UZGA 3SOWA 4N4FA 1Z6UA 3GV4A 4WZ0A 2VJEA 2M3HA 2CSZA 5LKXA 3T7LA 2NAAA 2LV9A 3SHBA 4A4CA 3LQIA 5DINA 2KR4A 4PTBA 3N9LA 2LRIC 2YUCA 4XI1A 2KFTA 4LJNA 1F62A 2VPEA 2VJFA 2ZETC 2JMDA 4BBQA 2K16A 2Y1MA 2G45A 2YW8A 1LDJB 1VFYA 2MNYA 5TDWA 4YBTA 2DX8A 1JM7A 1WEMA 4GNFA 5LKZA 3U5MA 5KH9A 3ZTGA 4LADB 1MM3A 4CA1A 2LGLA 5KH3A 1BORA 3O70A 2YQLA 5G05B 3I2DA 2E6RA 4AYCA 2KREA 2KE1A 3ZNIA 2MD8C 2YSJA 1XWHA 2MUMA 3O34A 4S3OC 4MSXA 4FK5A 4V3LC 3HCTA 2G6QA 2IDAA 1U6GB 3IHPA 3L1ZB 4UP5A 2YQMA 2HDPA 2MA5A 4A4BA 1LDKC 3O36A 4W4UA 2E6SA 5J3XA 3DPLR 1WFKA 1V87A 2LGGA 5LKUA 2ECVA 2MIQA 5FEYA 3O35A 2QICA 5TDRA 4N3WA 5H1UA 1K2FA 3ZPV1 2KWNA 3C5KA 3C6WA 2M1RA 2FUUA 2EA6A 4QF2A 1WILA 4Q6FA 1WEVA 4IC2A 2ECGA 3ZVZB 2RI7A 2FSAA 1VD4A 2VPBA 5H1TA 5G0FA 3DQVR 2ECIA 5C11A 2F6JA 2YT5A 2MA6A 2EGPA 5DKAA 1WEQA 5B77A 2VPGA 4YBMA 2F42A 4AVXA 2L0BA 2LGKA 2QJ0A 3KV6A 4GNEA 3N9MA 1Z60A 3EB6A 4ZDTA 1Z2QA 4IC3A 2C2LA 4I7BA 1N87A 2YYRA 3U5NA 3M99A 4CCGX 2OXQC 4A0CD 2L43A 4WZ2A 3T6RA 2K17A 4GNDA 2C2VS 4YADA 2CKLA 1RMDA 1FP0A 3PUQA 4WA6A 1WGMA 3SOUA 2YREA 1WENA 2KYUA
chains in the Genus database with same CATH superfamily
4P5OB 5FB1A 2B0OE 4LK9A 5D1KB 4FIPA 3E2DA 5B76A 2XP0A 4GNGA 1WE9A 1MM2A 2YSMA 4R2YA 2PUYA 2XOCA 3N9OA 2VJEB 2EODA 2H0DB 1HYJA 2CONA 2M85A 1X4UA 4PPEA 1VYXA 4YABA 3HTKC 3MHSA 4NN2A 1X4IA 2LXHC 2L75A 3U5PA 2YHOA 3ZPVE 3JUEA 2D8UA 2JRJA 2Y43A 4ZQLA 3SOXA 3M62A 2CSYA 2MNZA 2MKEA 1X4JA 3LRQA 2VNFA 4B86C 4F52B 2KWKA 1WEOA 2I50A 3NG2A 4A49A 3FL2A 4YC9A 5AIUA 3LQJA 1JOCA 2BAYA 1FBVA 5LKTA 2LN0A 2VPDA 3MDBC 3FEHA 3M63A 4Z0OA 2KWJA 4I7CA 4UI9B 4YAXA 3T9KA 2QIZA 3N9NA 1WEEA 3LQHA 5AITA 5H1VA 3MHHA 3O47A 4O64A 3L1XA 4X3GA 3RPGB 3ZVYA 3O7AA 1WEUA 2E61A 3L11A 2YU4A 2HYED 2XB1A 2L5UA 2H0DA 2KGIA 5LCWB 4AP4A 5B78A 1IYMA 2XOZA 2KGGA 2IQJA 2P57A 5D1MB 4FO9A 4L7XA 5KH7A 2RR4A 3EB5A 4I7DA 3FM8C 4H9DA 3ZYQA 1E4UA 1DCQA 2KIZA 4V3KC 2YHNA 2ECJA 2ECTA 3HCSA 3V43A 5FERA 3KDEC 2OWAA 4O62A 2RSDA 3RTRB 2CSVA 4ZUXU 5K3QA 1WIMA 4LLBA 3KV5A 1CHCA 2JMJA 4BHWA 3O37A 1DVPA 5TBNA 2JUNA 1ZBDB 2XEUA 5B79A 4UP0A 1WESA 3PHDA 1T1HA 2MT5A 1WEWA 3U5OA 3VK6A 3QZVA 4AUQB 2KU3A 2K1JA 2LDRA 3KNVA 5D1LB 4TKPB 3O33A 5G04B 3N9PA 1HYIA 3HCUA 4FJCA 5JG6A 2LXPC 3PURA 5SVYA 5H9MA 2VJFB 2L80A 3GL6A 2D8SA 5TRBA 5B8DA 2Y1NA 2ECNA 4L58A 3ASLA 2LQ6A 2JMIA 4LKAA 1WEPA 3N9QA 2VP7A 3DWDA 4WZ3B 3RPGC 1JM7B 2CT2A 4YBSA 2M6MA 4R7EA 2F6NA 4S3OB 5FB0A 1G25A 2YURA 4QF3A 2PNXA 2G43A 4YATA 2KWOA 4C9ZA 2CKLB 4AYCB 4R8PK 2FUIA 5C13A 2LGVA 5EYAF 4MVTA 4Z0RA 3Q1DA 4GB0A 5I3LA 2AN6A 2K4DA 3SUBA 4B7YC 2FD4A 2MD7B 2ECWA 5TABA 5B75A 3KQIA 3LVRE 2UZGA 3SOWA 4N4FA 1Z6UA 3H7HA 3GV4A 4WZ0A 2VJEA 2M3HA 2CSZA 5LKXA 3T7LA 2KKXA 2NAAA 2LV9A 3SHBA 4A4CA 2LAUA 3LQIA 5DINA 3LDYA 2EXUA 2KR4A 4PTBA 3N9LA 2LRIC 5SVIB 2YUCA 4XI1A 2KFTA 4LJNA 1F62A 2VPEA 2VJFA 2ZETC 2JMDA 4BBQA 2K16A 2Y1MA 2G45A 2YW8A 1LDJB 1VFYA 2MNYA 5TDWA 3M7KA 4YBTA 2DX8A 1JM7A 1WEMA 4GNFA 5LKZA 3U5MA 5KH9A 1MBMA 3ZTGA 4LADB 1MM3A 2FFWA 2LGLA 4CA1A 5KH3A 1BORA 3O70A 2YQLA 5G05B 2YVRA 3I2DA 2E6RA 4AYCA 2KREA 2KE1A 3ZNIA 2DJAA 2YSJA 2MD8C 1XWHA 2MUMA 4QQ4A 3O34A 4S3OC 4MSXA 4FK5A 4V3LC 3HCTA 2G6QA 2IDAA 3FJUB 1U6GB 3IHPA 3L1ZB 2M13A 4UP5A 3FANA 2YQMA 2HDPA 2MA5A 4A4BA 1LDKC 3O36A 4W4UA 3FAOA 2E6SA 5J3XA 3DPLR 1WFKA 1V87A 2LGGA 5LKUA 2ECVA 2MIQA 5FEYA 4OGEA 3O35A 5SVIA 2QICA 5TDRA 4N3WA 5H1UA 1K2FA 3ZPV1 2KWNA 2L7PA 3C5KA 3C6WA 2M1RA 2FUUA 2JM3A 2EA6A 4QF2A 1WILA 4Q6FA 3PLWA 3LVQE 3LJUX 1WEVA 4IC2A 2ECGA 3ZVZB 2RI7A 2FSAA 1VD4A 2VPBA 5H1TA 5G0FA 3DQVR 2EGMA 2ECIA 5C11A 2F6JA 2YT5A 2MA6A 2EGPA 5DKAA 1WEQA 5B77A 2VPGA 4YBMA 2F42A 2XOYA 2L0BA 4AVXA 2LGKA 2CRWA 2QJ0A 3KV6A 4GNEA 3N9MA 1Z60A 3EB6A 4OGCA 4ZDTA 1Z2QA 4IC3A 2C2LA 4F1PA 4I7BA 1N87A 2YYRA 3U5NA 3M99A 2DSMA 2KKYA 4CCGX 5SVXA 2OXQC 4A0CD 2L43A 4WZ2A 3T6RA 2K17A 4GNDA 3DDTA 2CRRA 2C2VS 4YADA 2CKLA 1RMDA 1FP0A 3PUQA 4WA6A 1WGMA 3SOUA 2YREA 1WENA 2KYUA
chains in the Genus database with same CATH topology
4P5OB 5FB1A 4LK9A 5D1KB 4FIPA 5B76A 4GNGA 1WE9A 1MM2A 2YSMA 4R2YA 2PUYA 3N9OA 2VJEB 2EODA 2H0DB 1HYJA 2M85A 1X4UA 4PPEA 1VYXA 4YABA 3HTKC 3MHSA 4NN2A 1X4IA 2LXHC 2L75A 3U5PA 2YHOA 3ZPVE 2JRJA 2Y43A 4ZQLA 3SOXA 3M62A 2CSYA 2MNZA 1X4JA 3LRQA 2VNFA 4B86C 4F52B 2KWKA 1WEOA 2I50A 3NG2A 4A49A 3FL2A 4YC9A 5AIUA 3LQJA 1JOCA 2BAYA 1FBVA 5LKTA 2LN0A 2VPDA 3M63A 2KWJA 4I7CA 4UI9B 4YAXA 2QIZA 3N9NA 1WEEA 3LQHA 5AITA 5H1VA 3MHHA 4O64A 3L1XA 4X3GA 3RPGB 3ZVYA 3O7AA 1WEUA 3L11A 2YU4A 2HYED 2XB1A 2L5UA 2H0DA 2KGIA 5LCWB 4AP4A 5B78A 1IYMA 2KGGA 5D1MB 4FO9A 4L7XA 5KH7A 3EB5A 4I7DA 3ZYQA 1E4UA 2KIZA 4V3KC 2YHNA 2ECJA 2ECTA 3HCSA 3V43A 5FERA 2RSDA 3RTRB 4ZUXU 1WIMA 4LLBA 3KV5A 1CHCA 2JMJA 4BHWA 3O37A 1DVPA 5TBNA 1ZBDB 2XEUA 5B79A 4UP0A 1WESA 3PHDA 1T1HA 2MT5A 1WEWA 3U5OA 3VK6A 3QZVA 4AUQB 2KU3A 2K1JA 2LDRA 3KNVA 5D1LB 4TKPB 3O33A 5G04B 3N9PA 1HYIA 3HCUA 4FJCA 5JG6A 2LXPC 3PURA 5H9MA 2VJFB 2L80A 3GL6A 2D8SA 5TRBA 5B8DA 2Y1NA 2ECNA 4L58A 3ASLA 2LQ6A 2JMIA 4LKAA 1WEPA 3N9QA 2VP7A 4WZ3B 3RPGC 1JM7B 2CT2A 4YBSA 2M6MA 4R7EA 2F6NA 4S3OB 5FB0A 1G25A 2YURA 4QF3A 2PNXA 2G43A 4YATA 2KWOA 4C9ZA 2CKLB 4AYCB 4R8PK 2FUIA 5C13A 2LGVA 5EYAF 4MVTA 4GB0A 5I3LA 2AN6A 2K4DA 4B7YC 2MD7B 2ECWA 5TABA 5B75A 3KQIA 2UZGA 3SOWA 4N4FA 1Z6UA 3GV4A 4WZ0A 2VJEA 2M3HA 2CSZA 5LKXA 3T7LA 2NAAA 2LV9A 3SHBA 4A4CA 3LQIA 5DINA 2KR4A 4PTBA 3N9LA 2LRIC 2YUCA 4XI1A 2KFTA 4LJNA 1F62A 2VPEA 2VJFA 2ZETC 2JMDA 4BBQA 2K16A 2Y1MA 2G45A 2YW8A 1LDJB 1VFYA 2MNYA 5TDWA 4YBTA 2DX8A 1JM7A 1WEMA 4GNFA 5LKZA 3U5MA 5KH9A 3ZTGA 4LADB 1MM3A 4CA1A 2LGLA 5KH3A 1BORA 3O70A 2YQLA 5G05B 3I2DA 2E6RA 4AYCA 2KREA 2KE1A 3ZNIA 2MD8C 2YSJA 1XWHA 2MUMA 3O34A 4S3OC 4MSXA 4FK5A 4V3LC 3HCTA 2G6QA 2IDAA 1U6GB 3IHPA 3L1ZB 4UP5A 2YQMA 2HDPA 2MA5A 4A4BA 1LDKC 3O36A 4W4UA 2E6SA 5J3XA 3DPLR 1WFKA 1V87A 2LGGA 5LKUA 2ECVA 2MIQA 5FEYA 3O35A 2QICA 5TDRA 4N3WA 5H1UA 1K2FA 3ZPV1 2KWNA 3C5KA 3C6WA 2M1RA 2FUUA 2EA6A 4QF2A 1WILA 4Q6FA 1WEVA 4IC2A 2ECGA 3ZVZB 2RI7A 2FSAA 1VD4A 2VPBA 5H1TA 5G0FA 3DQVR 2ECIA 5C11A 2F6JA 2YT5A 2MA6A 2EGPA 5DKAA 1WEQA 5B77A 2VPGA 4YBMA 2F42A 4AVXA 2L0BA 2LGKA 2QJ0A 3KV6A 4GNEA 3N9MA 1Z60A 3EB6A 4ZDTA 1Z2QA 4IC3A 2C2LA 4I7BA 1N87A 2YYRA 3U5NA 3M99A 4CCGX 2OXQC 4A0CD 2L43A 4WZ2A 3T6RA 2K17A 4GNDA 2C2VS 4YADA 2CKLA 1RMDA 1FP0A 3PUQA 4WA6A 1WGMA 3SOUA 2YREA 1WENA 2KYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5O B;  5FB1 A;  4LK9 A;  5D1K B;  4FIP A;  5B76 A;  4GNG A;  1WE9 A;  1MM2 A;  2YSM A;  4R2Y A;  2PUY A;  3N9O A;  2VJE B;  2EOD A;  2H0D B;  1HYJ A;  2M85 A;  1X4U A;  4PPE A;  1VYX A;  4YAB A;  3HTK C;  3MHS A;  4NN2 A;  1X4I A;  2LXH C;  2L75 A;  3U5P A;  2YHO A;  3ZPV E;  2JRJ A;  2Y43 A;  4ZQL A;  3SOX A;  3M62 A;  2CSY A;  2MNZ A;  1X4J A;  3LRQ A;  2VNF A;  4B86 C;  4F52 B;  2KWK A;  1WEO A;  2I50 A;  3NG2 A;  4A49 A;  3FL2 A;  4YC9 A;  5AIU A;  3LQJ A;  1JOC A;  2BAY A;  1FBV A;  5LKT A;  2LN0 A;  2VPD A;  3M63 A;  2KWJ A;  4I7C A;  4UI9 B;  4YAX A;  2QIZ A;  3N9N A;  1WEE A;  3LQH A;  5AIT A;  5H1V A;  3MHH A;  4O64 A;  3L1X A;  4X3G A;  3RPG B;  3ZVY A;  3O7A A;  1WEU A;  3L11 A;  2YU4 A;  2HYE D;  2XB1 A;  2L5U A;  2H0D A;  2KGI A;  5LCW B;  4AP4 A;  5B78 A;  1IYM A;  2KGG A;  5D1M B;  4FO9 A;  4L7X A;  5KH7 A;  3EB5 A;  4I7D A;  3ZYQ A;  1E4U A;  2KIZ A;  4V3K C;  2YHN A;  2ECJ A;  2ECT A;  3HCS A;  3V43 A;  5FER A;  2RSD A;  3RTR B;  4ZUX U;  1WIM A;  4LLB A;  3KV5 A;  1CHC A;  2JMJ A;  4BHW A;  3O37 A;  1DVP A;  5TBN A;  1ZBD B;  2XEU A;  5B79 A;  4UP0 A;  1WES A;  3PHD A;  1T1H A;  2MT5 A;  1WEW A;  3U5O A;  3VK6 A;  3QZV A;  4AUQ B;  2KU3 A;  2K1J A;  2LDR A;  3KNV A;  5D1L B;  4TKP B;  3O33 A;  5G04 B;  3N9P A;  1HYI A;  3HCU A;  4FJC A;  5JG6 A;  2LXP C;  3PUR A;  5H9M A;  2VJF B;  2L80 A;  3GL6 A;  2D8S A;  5TRB A;  5B8D A;  2Y1N A;  2ECN A;  4L58 A;  3ASL A;  2LQ6 A;  2JMI A;  4LKA A;  1WEP A;  3N9Q A;  2VP7 A;  4WZ3 B;  3RPG C;  1JM7 B;  2CT2 A;  4YBS A;  2M6M A;  4R7E A;  2F6N A;  4S3O B;  5FB0 A;  1G25 A;  2YUR A;  4QF3 A;  2PNX A;  2G43 A;  4YAT A;  2KWO A;  4C9Z A;  2CKL B;  4AYC B;  4R8P K;  2FUI A;  5C13 A;  2LGV A;  5EYA F;  4MVT A;  4GB0 A;  5I3L A;  2AN6 A;  2K4D A;  4B7Y C;  2MD7 B;  2ECW A;  5TAB A;  5B75 A;  3KQI A;  2UZG A;  3SOW A;  4N4F A;  1Z6U A;  3GV4 A;  4WZ0 A;  2VJE A;  2M3H A;  2CSZ A;  5LKX A;  3T7L A;  2NAA A;  2LV9 A;  3SHB A;  4A4C A;  3LQI A;  5DIN A;  2KR4 A;  4PTB A;  3N9L A;  2LRI C;  2YUC A;  4XI1 A;  2KFT A;  4LJN A;  1F62 A;  2VPE A;  2VJF A;  2ZET C;  2JMD A;  4BBQ A;  2K16 A;  2Y1M A;  2G45 A;  2YW8 A;  1LDJ B;  1VFY A;  2MNY A;  5TDW A;  4YBT A;  2DX8 A;  1JM7 A;  1WEM A;  4GNF A;  5LKZ A;  3U5M A;  5KH9 A;  3ZTG A;  4LAD B;  1MM3 A;  4CA1 A;  2LGL A;  5KH3 A;  1BOR A;  3O70 A;  2YQL A;  5G05 B;  3I2D A;  2E6R A;  4AYC A;  2KRE A;  2KE1 A;  3ZNI A;  2MD8 C;  2YSJ A;  1XWH A;  2MUM A;  3O34 A;  4S3O C;  4MSX A;  4FK5 A;  4V3L C;  3HCT A;  2G6Q A;  2IDA A;  1U6G B;  3IHP A;  3L1Z B;  4UP5 A;  2YQM A;  2HDP A;  2MA5 A;  4A4B A;  1LDK C;  3O36 A;  4W4U A;  2E6S A;  5J3X A;  3DPL R;  1WFK A;  1V87 A;  2LGG A;  5LKU A;  2ECV A;  2MIQ A;  5FEY A;  3O35 A;  2QIC A;  5TDR A;  4N3W A;  5H1U A;  1K2F A;  3ZPV 1;  2KWN A;  3C5K A;  3C6W A;  2M1R A;  2FUU A;  2EA6 A;  4QF2 A;  1WIL A;  4Q6F A;  1WEV A;  4IC2 A;  2ECG A;  3ZVZ B;  2RI7 A;  2FSA A;  1VD4 A;  2VPB A;  5H1T A;  5G0F A;  3DQV R;  2ECI A;  5C11 A;  2F6J A;  2YT5 A;  2MA6 A;  2EGP A;  5DKA A;  1WEQ A;  5B77 A;  2VPG A;  4YBM A;  2F42 A;  4AVX A;  2L0B A;  2LGK A;  2QJ0 A;  3KV6 A;  4GNE A;  3N9M A;  1Z60 A;  3EB6 A;  4ZDT A;  1Z2Q A;  4IC3 A;  2C2L A;  4I7B A;  1N87 A;  2YYR A;  3U5N A;  3M99 A;  4CCG X;  2OXQ C;  4A0C D;  2L43 A;  4WZ2 A;  3T6R A;  2K17 A;  4GND A;  2C2V S;  4YAD A;  2CKL A;  1RMD A;  1FP0 A;  3PUQ A;  4WA6 A;  1WGM A;  3SOU A;  2YRE A;  1WEN A;  2KYU A; 
#chains in the Genus database with same CATH topology
 4P5O B;  5FB1 A;  2B0O E;  4LK9 A;  5D1K B;  4FIP A;  3E2D A;  5B76 A;  2XP0 A;  4GNG A;  1WE9 A;  1MM2 A;  2YSM A;  4R2Y A;  2PUY A;  2XOC A;  3N9O A;  2VJE B;  2EOD A;  2H0D B;  1HYJ A;  2CON A;  2M85 A;  1X4U A;  4PPE A;  1VYX A;  4YAB A;  3HTK C;  3MHS A;  4NN2 A;  1X4I A;  2LXH C;  2L75 A;  3U5P A;  2YHO A;  3ZPV E;  3JUE A;  2D8U A;  2JRJ A;  2Y43 A;  4ZQL A;  3SOX A;  3M62 A;  2CSY A;  2MNZ A;  2MKE A;  1X4J A;  3LRQ A;  2VNF A;  4B86 C;  4F52 B;  2KWK A;  1WEO A;  2I50 A;  3NG2 A;  4A49 A;  3FL2 A;  4YC9 A;  5AIU A;  3LQJ A;  1JOC A;  2BAY A;  1FBV A;  5LKT A;  2LN0 A;  2VPD A;  3MDB C;  3FEH A;  3M63 A;  4Z0O A;  2KWJ A;  4I7C A;  4UI9 B;  4YAX A;  3T9K A;  2QIZ A;  3N9N A;  1WEE A;  3LQH A;  5AIT A;  5H1V A;  3MHH A;  3O47 A;  4O64 A;  3L1X A;  4X3G A;  3RPG B;  3ZVY A;  3O7A A;  1WEU A;  2E61 A;  3L11 A;  2YU4 A;  2HYE D;  2XB1 A;  2L5U A;  2H0D A;  2KGI A;  5LCW B;  4AP4 A;  5B78 A;  1IYM A;  2XOZ A;  2KGG A;  2IQJ A;  2P57 A;  5D1M B;  4FO9 A;  4L7X A;  5KH7 A;  2RR4 A;  3EB5 A;  4I7D A;  3FM8 C;  4H9D A;  3ZYQ A;  1E4U A;  1DCQ A;  2KIZ A;  4V3K C;  2YHN A;  2ECJ A;  2ECT A;  3HCS A;  3V43 A;  5FER A;  3KDE C;  2OWA A;  4O62 A;  2RSD A;  3RTR B;  2CSV A;  4ZUX U;  5K3Q A;  1WIM A;  4LLB A;  3KV5 A;  1CHC A;  2JMJ A;  4BHW A;  3O37 A;  1DVP A;  5TBN A;  2JUN A;  1ZBD B;  2XEU A;  5B79 A;  4UP0 A;  1WES A;  3PHD A;  1T1H A;  2MT5 A;  1WEW A;  3U5O A;  3VK6 A;  3QZV A;  4AUQ B;  2KU3 A;  2K1J A;  2LDR A;  3KNV A;  5D1L B;  4TKP B;  3O33 A;  5G04 B;  3N9P A;  1HYI A;  3HCU A;  4FJC A;  5JG6 A;  2LXP C;  3PUR A;  5SVY A;  5H9M A;  2VJF B;  2L80 A;  3GL6 A;  2D8S A;  5TRB A;  5B8D A;  2Y1N A;  2ECN A;  4L58 A;  3ASL A;  2LQ6 A;  2JMI A;  4LKA A;  1WEP A;  3N9Q A;  2VP7 A;  3DWD A;  4WZ3 B;  3RPG C;  1JM7 B;  2CT2 A;  4YBS A;  2M6M A;  4R7E A;  2F6N A;  4S3O B;  5FB0 A;  1G25 A;  2YUR A;  4QF3 A;  2PNX A;  2G43 A;  4YAT A;  2KWO A;  4C9Z A;  2CKL B;  4AYC B;  4R8P K;  2FUI A;  5C13 A;  2LGV A;  5EYA F;  4MVT A;  4Z0R A;  3Q1D A;  4GB0 A;  5I3L A;  2AN6 A;  2K4D A;  3SUB A;  4B7Y C;  2FD4 A;  2MD7 B;  2ECW A;  5TAB A;  5B75 A;  3KQI A;  3LVR E;  2UZG A;  3SOW A;  4N4F A;  1Z6U A;  3H7H A;  3GV4 A;  4WZ0 A;  2VJE A;  2M3H A;  2CSZ A;  5LKX A;  3T7L A;  2KKX A;  2NAA A;  2LV9 A;  3SHB A;  4A4C A;  2LAU A;  3LQI A;  5DIN A;  3LDY A;  2EXU A;  2KR4 A;  4PTB A;  3N9L A;  2LRI C;  5SVI B;  2YUC A;  4XI1 A;  2KFT A;  4LJN A;  1F62 A;  2VPE A;  2VJF A;  2ZET C;  2JMD A;  4BBQ A;  2K16 A;  2Y1M A;  2G45 A;  2YW8 A;  1LDJ B;  1VFY A;  2MNY A;  5TDW A;  3M7K A;  4YBT A;  2DX8 A;  1JM7 A;  1WEM A;  4GNF A;  5LKZ A;  3U5M A;  5KH9 A;  1MBM A;  3ZTG A;  4LAD B;  1MM3 A;  2FFW A;  2LGL A;  4CA1 A;  5KH3 A;  1BOR A;  3O70 A;  2YQL A;  5G05 B;  2YVR A;  3I2D A;  2E6R A;  4AYC A;  2KRE A;  2KE1 A;  3ZNI A;  2DJA A;  2YSJ A;  2MD8 C;  1XWH A;  2MUM A;  4QQ4 A;  3O34 A;  4S3O C;  4MSX A;  4FK5 A;  4V3L C;  3HCT A;  2G6Q A;  2IDA A;  3FJU B;  1U6G B;  3IHP A;  3L1Z B;  2M13 A;  4UP5 A;  3FAN A;  2YQM A;  2HDP A;  2MA5 A;  4A4B A;  1LDK C;  3O36 A;  4W4U A;  3FAO A;  2E6S A;  5J3X A;  3DPL R;  1WFK A;  1V87 A;  2LGG A;  5LKU A;  2ECV A;  2MIQ A;  5FEY A;  4OGE A;  3O35 A;  5SVI A;  2QIC A;  5TDR A;  4N3W A;  5H1U A;  1K2F A;  3ZPV 1;  2KWN A;  2L7P A;  3C5K A;  3C6W A;  2M1R A;  2FUU A;  2JM3 A;  2EA6 A;  4QF2 A;  1WIL A;  4Q6F A;  3PLW A;  3LVQ E;  3LJU X;  1WEV A;  4IC2 A;  2ECG A;  3ZVZ B;  2RI7 A;  2FSA A;  1VD4 A;  2VPB A;  5H1T A;  5G0F A;  3DQV R;  2EGM A;  2ECI A;  5C11 A;  2F6J A;  2YT5 A;  2MA6 A;  2EGP A;  5DKA A;  1WEQ A;  5B77 A;  2VPG A;  4YBM A;  2F42 A;  2XOY A;  2L0B A;  4AVX A;  2LGK A;  2CRW A;  2QJ0 A;  3KV6 A;  4GNE A;  3N9M A;  1Z60 A;  3EB6 A;  4OGC A;  4ZDT A;  1Z2Q A;  4IC3 A;  2C2L A;  4F1P A;  4I7B A;  1N87 A;  2YYR A;  3U5N A;  3M99 A;  2DSM A;  2KKY A;  4CCG X;  5SVX A;  2OXQ C;  4A0C D;  2L43 A;  4WZ2 A;  3T6R A;  2K17 A;  4GND A;  3DDT A;  2CRR A;  2C2V S;  4YAD A;  2CKL A;  1RMD A;  1FP0 A;  3PUQ A;  4WA6 A;  1WGM A;  3SOU A;  2YRE A;  1WEN A;  2KYU A; 
#chains in the Genus database with same CATH homology
 4P5O B;  5FB1 A;  4LK9 A;  5D1K B;  4FIP A;  5B76 A;  4GNG A;  1WE9 A;  1MM2 A;  2YSM A;  4R2Y A;  2PUY A;  3N9O A;  2VJE B;  2EOD A;  2H0D B;  1HYJ A;  2M85 A;  1X4U A;  4PPE A;  1VYX A;  4YAB A;  3HTK C;  3MHS A;  4NN2 A;  1X4I A;  2LXH C;  2L75 A;  3U5P A;  2YHO A;  3ZPV E;  2JRJ A;  2Y43 A;  4ZQL A;  3SOX A;  3M62 A;  2CSY A;  2MNZ A;  1X4J A;  3LRQ A;  2VNF A;  4B86 C;  4F52 B;  2KWK A;  1WEO A;  2I50 A;  3NG2 A;  4A49 A;  3FL2 A;  4YC9 A;  5AIU A;  3LQJ A;  1JOC A;  2BAY A;  1FBV A;  5LKT A;  2LN0 A;  2VPD A;  3M63 A;  2KWJ A;  4I7C A;  4UI9 B;  4YAX A;  2QIZ A;  3N9N A;  1WEE A;  3LQH A;  5AIT A;  5H1V A;  3MHH A;  4O64 A;  3L1X A;  4X3G A;  3RPG B;  3ZVY A;  3O7A A;  1WEU A;  3L11 A;  2YU4 A;  2HYE D;  2XB1 A;  2L5U A;  2H0D A;  2KGI A;  5LCW B;  4AP4 A;  5B78 A;  1IYM A;  2KGG A;  5D1M B;  4FO9 A;  4L7X A;  5KH7 A;  3EB5 A;  4I7D A;  3ZYQ A;  1E4U A;  2KIZ A;  4V3K C;  2YHN A;  2ECJ A;  2ECT A;  3HCS A;  3V43 A;  5FER A;  2RSD A;  3RTR B;  4ZUX U;  1WIM A;  4LLB A;  3KV5 A;  1CHC A;  2JMJ A;  4BHW A;  3O37 A;  1DVP A;  5TBN A;  1ZBD B;  2XEU A;  5B79 A;  4UP0 A;  1WES A;  3PHD A;  1T1H A;  2MT5 A;  1WEW A;  3U5O A;  3VK6 A;  3QZV A;  4AUQ B;  2KU3 A;  2K1J A;  2LDR A;  3KNV A;  5D1L B;  4TKP B;  3O33 A;  5G04 B;  3N9P A;  1HYI A;  3HCU A;  4FJC A;  5JG6 A;  2LXP C;  3PUR A;  5H9M A;  2VJF B;  2L80 A;  3GL6 A;  2D8S A;  5TRB A;  5B8D A;  2Y1N A;  2ECN A;  4L58 A;  3ASL A;  2LQ6 A;  2JMI A;  4LKA A;  1WEP A;  3N9Q A;  2VP7 A;  4WZ3 B;  3RPG C;  1JM7 B;  2CT2 A;  4YBS A;  2M6M A;  4R7E A;  2F6N A;  4S3O B;  5FB0 A;  1G25 A;  2YUR A;  4QF3 A;  2PNX A;  2G43 A;  4YAT A;  2KWO A;  4C9Z A;  2CKL B;  4AYC B;  4R8P K;  2FUI A;  5C13 A;  2LGV A;  5EYA F;  4MVT A;  4GB0 A;  5I3L A;  2AN6 A;  2K4D A;  4B7Y C;  2MD7 B;  2ECW A;  5TAB A;  5B75 A;  3KQI A;  2UZG A;  3SOW A;  4N4F A;  1Z6U A;  3GV4 A;  4WZ0 A;  2VJE A;  2M3H A;  2CSZ A;  5LKX A;  3T7L A;  2NAA A;  2LV9 A;  3SHB A;  4A4C A;  3LQI A;  5DIN A;  2KR4 A;  4PTB A;  3N9L A;  2LRI C;  2YUC A;  4XI1 A;  2KFT A;  4LJN A;  1F62 A;  2VPE A;  2VJF A;  2ZET C;  2JMD A;  4BBQ A;  2K16 A;  2Y1M A;  2G45 A;  2YW8 A;  1LDJ B;  1VFY A;  2MNY A;  5TDW A;  4YBT A;  2DX8 A;  1JM7 A;  1WEM A;  4GNF A;  5LKZ A;  3U5M A;  5KH9 A;  3ZTG A;  4LAD B;  1MM3 A;  4CA1 A;  2LGL A;  5KH3 A;  1BOR A;  3O70 A;  2YQL A;  5G05 B;  3I2D A;  2E6R A;  4AYC A;  2KRE A;  2KE1 A;  3ZNI A;  2MD8 C;  2YSJ A;  1XWH A;  2MUM A;  3O34 A;  4S3O C;  4MSX A;  4FK5 A;  4V3L C;  3HCT A;  2G6Q A;  2IDA A;  1U6G B;  3IHP A;  3L1Z B;  4UP5 A;  2YQM A;  2HDP A;  2MA5 A;  4A4B A;  1LDK C;  3O36 A;  4W4U A;  2E6S A;  5J3X A;  3DPL R;  1WFK A;  1V87 A;  2LGG A;  5LKU A;  2ECV A;  2MIQ A;  5FEY A;  3O35 A;  2QIC A;  5TDR A;  4N3W A;  5H1U A;  1K2F A;  3ZPV 1;  2KWN A;  3C5K A;  3C6W A;  2M1R A;  2FUU A;  2EA6 A;  4QF2 A;  1WIL A;  4Q6F A;  1WEV A;  4IC2 A;  2ECG A;  3ZVZ B;  2RI7 A;  2FSA A;  1VD4 A;  2VPB A;  5H1T A;  5G0F A;  3DQV R;  2ECI A;  5C11 A;  2F6J A;  2YT5 A;  2MA6 A;  2EGP A;  5DKA A;  1WEQ A;  5B77 A;  2VPG A;  4YBM A;  2F42 A;  4AVX A;  2L0B A;  2LGK A;  2QJ0 A;  3KV6 A;  4GNE A;  3N9M A;  1Z60 A;  3EB6 A;  4ZDT A;  1Z2Q A;  4IC3 A;  2C2L A;  4I7B A;  1N87 A;  2YYR A;  3U5N A;  3M99 A;  4CCG X;  2OXQ C;  4A0C D;  2L43 A;  4WZ2 A;  3T6R A;  2K17 A;  4GND A;  2C2V S;  4YAD A;  2CKL A;  1RMD A;  1FP0 A;  3PUQ A;  4WA6 A;  1WGM A;  3SOU A;  2YRE A;  1WEN A;  2KYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...