2YU4A

Solution structure of the sp-ring domain in non-smc element 2 homolog (mms21, s. cerevisiae)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
94
Chain Sequence
GSSGSSGFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase NSE2
publication title Solution structure of the SP-RING domain in non-SMC element 2 homolog (MMS21, S. cerevisiae)
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 14
structure length 94
sequence length 94
ec nomenclature ec 6.-.-.-:
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yu4A00
3QZVA 1U6GB 4IC2A 4LLBA 2NAAA 3RPGB 1WENA 3U5PA 5LKXA 3M63A 2YT5A 3KQIA 2JRJA 3LQIA 2KYUA 3C6WA 4LJNA 1X4UA 1Z60A 2PUYA 2L5UA 2ZETC 4ZQLA 4YBSA 2C2LA 2KWKA 2YUCA 1V87A 3PUQA 4CA1A 2ECWA 3O34A 2VP7A 1MM3A 3RPGC 2YQLA 5TBNA 2K17A 2M6MA 2H0DA 5KH9A 5DKAA 1VFYA 5H1UA 4O64A 4YBMA 2LXPC 2VJEB 2Y1MA 3SOUA 1JM7B 5TDRA 4MVTA 2L0BA 4GNDA 5G04B 2F6NA 4R8PK 3LRQA 4YATA 4N4FA 2LGLA 4MSXA 4P5OB 2FSAA 4LADB 3ZPV1 4BHWA 2MNZA 3M99A 4WZ2A 4YBTA 1LDJB 2VPGA 1FBVA 3ASLA 4QF3A 2YURA 5C13A 2MD7B 4IC3A 2M3HA 5LKTA 2YYRA 5B79A 1WFKA 2MA6A 2LXHC 2YQMA 3SHBA 2LGVA 3N9LA 5G05B 1BORA 3EB6A 2FUUA 5AIUA 2KREA 5EYAF 4R2YA 5FB1A 3O7AA 4GNFA 2K1JA 1X4JA 1WEOA 2CSZA 3C5KA 2KGIA 4YC9A 4AVXA 1WGMA 5LKUA 1WEQA 4FO9A 2DX8A 3L11A 5KH3A 4AUQB 4PPEA 3PURA 3HTKC 3T7LA 3VK6A 2E6SA 4F52B 1HYJA 2G43A 5H9MA 4A4BA 2HDPA 3U5OA 2KWNA 2LQ6A 5LCWB 1WEMA 4AYCA 5KH7A 5B78A 2K4DA 2EA6A 2MT5A 3O70A 3GL6A 4UP5A 2H0DB 2RI7A 4C9ZA 2I50A 4BBQA 1WILA 2UZGA 2G6QA 3LQJA 3MHHA 1E4UA 4N3WA 4FIPA 2CKLA 3ZVYA 1WIMA 1G25A 2LGGA 1IYMA 2YW8A 3LQHA 2MUMA 4I7DA 4WZ0A 5B75A 5TRBA 4FK5A 2VPDA 3N9OA 2VJFA 5I3LA 2RSDA 4A4CA 2F6JA 3N9NA 1WEEA 2F42A 2IDAA 2JMIA 2Y43A 4YAXA 1Z2QA 3N9PA 3N9QA 4LK9A 3N9MA 2L80A 4V3LC 3PHDA 1VD4A 2AN6A 2KU3A 5C11A 3HCTA 2QIZA 4A0CD 4GNEA 4B7YC 4GNGA 2XB1A 3HCUA 4FJCA 2ECJA 2KWOA 3KNVA 2VJEA 2Y1NA 5B77A 1VYXA 4S3OB 2M1RA 3ZTGA 3FL2A 1JOCA 1HYIA 3SOWA 2PNXA 4LKAA 2VNFA 5FB0A 5FERA 5H1VA 3IHPA 2LGKA 3ZNIA 2VPEA 4YABA 3U5NA 4NN2A 1K2FA 1N87A 3DPLR 2CSYA 2LDRA 1WEVA 2YHOA 2QJ0A 4S3OC 2BAYA 4I7BA 3ZYQA 2MD8C 5J3XA 2L75A 3I2DA 3DQVR 1WEUA 4Q6FA 4AYCB 5G0FA 2D8SA 3GV4A 3MHSA 3KV5A 2LV9A 1RMDA 2LN0A 3RTRB 2MA5A 3NG2A 2CKLB 2YU4A 3U5MA 3M62A 2JMDA 2JMJA 2LRIC 2G45A 1FP0A 2K16A 2ECGA 5FEYA 4ZDTA 2VJFB 4GB0A 2KWJA 3T6RA 3V43A 2C2VS 1ZBDB 2KR4A 4TKPB 5D1KB 4XI1A 2YSJA 5LKZA 5H1TA 2EODA 1T1HA 4YADA 4L58A 2YSMA 2MNYA 4WZ3B 2ECNA 2KIZA 2KE1A 5D1LB 3ZPVE 3O37A 3O36A 4R7EA 2ECIA 2QICA 1JM7A 4QF2A 1WEPA 3EB5A 2VPBA 4ZUXU 5TDWA 2MIQA 3KV6A 1WE9A 3L1XA 4UI9B 1MM2A 2OXQC 4WA6A 2XEUA 4X3GA 4V3KC 2E6RA 3L1ZB 4PTBA 5AITA 2CT2A 2YREA 4UP0A 4CCGX 2KFTA 2KGGA 2YHNA 4A49A 3HCSA 4B86C 2HYED 5DINA 1Z6UA 4L7XA 1X4IA 1WEWA 4W4UA 1LDKC 3O33A 1F62A 2M85A 5JG6A 2ECTA 4AP4A 5TABA 2L43A 5B76A 1DVPA 2ECVA 5D1MB 1WESA 1XWHA 2EGPA 3SOXA 1CHCA 2FUIA 3ZVZB 3O35A 5B8DA 4I7CA
chains in the Genus database with same CATH superfamily
3QZVA 1U6GB 4IC2A 4LLBA 2NAAA 2KKXA 3RPGB 1WENA 3U5PA 5LKXA 3M63A 2YT5A 3KQIA 2JRJA 3LQIA 2KYUA 3C6WA 4LJNA 1X4UA 1Z60A 2PUYA 2XOCA 2L5UA 2ZETC 4ZQLA 4YBSA 2C2LA 2KWKA 2YUCA 1V87A 3PUQA 4CA1A 2ECWA 3O34A 2VP7A 1MM3A 3RPGC 2YQLA 5TBNA 2K17A 2M6MA 3FANA 2H0DA 3O47A 5KH9A 5DKAA 1VFYA 5H1UA 4O64A 4YBMA 2LXPC 2VJEB 2Y1MA 3E2DA 3SOUA 1JM7B 5TDRA 4MVTA 2L0BA 2M13A 4GNDA 5G04B 2F6NA 4R8PK 3LRQA 3H7HA 4YATA 4N4FA 2EGMA 2LGLA 4MSXA 4P5OB 2FSAA 4LADB 3ZPV1 4BHWA 2MNZA 2B0OE 3M99A 4WZ2A 3T9KA 4YBTA 1LDJB 2VPGA 1FBVA 3FJUB 3ASLA 4QF3A 3M7KA 2YURA 5C13A 2MD7B 4IC3A 2M3HA 5LKTA 2YYRA 5B79A 1WFKA 2MA6A 2LXHC 2YQMA 2E61A 3SHBA 2LGVA 3N9LA 5G05B 3FAOA 1BORA 3LVRE 3EB6A 2FUUA 5SVIB 5AIUA 2KREA 5EYAF 4R2YA 5FB1A 2KKYA 2CRRA 2XOZA 2CRWA 3O7AA 4GNFA 2K1JA 1X4JA 1WEOA 2CSZA 3C5KA 2KGIA 2JM3A 4YC9A 4AVXA 1WGMA 5LKUA 1WEQA 4FO9A 2DX8A 3L11A 5KH3A 4AUQB 2P57A 4PPEA 3PURA 2XP0A 3HTKC 3T7LA 3JUEA 3VK6A 2E6SA 4F52B 1HYJA 2G43A 5H9MA 4H9DA 4A4BA 2HDPA 3U5OA 2KWNA 2LQ6A 5LCWB 1WEMA 4AYCA 5KH7A 5B78A 2K4DA 2EA6A 2MT5A 4QQ4A 2FD4A 3O70A 3GL6A 4UP5A 2H0DB 2RI7A 4O62A 4C9ZA 2I50A 3SUBA 4F1PA 4BBQA 1WILA 2UZGA 3MHHA 2G6QA 3LQJA 1E4UA 4Z0RA 4N3WA 4FIPA 2CKLA 3ZVYA 1WIMA 1G25A 2LGGA 1IYMA 2YW8A 3LQHA 2MUMA 4I7DA 4WZ0A 5B75A 5TRBA 4FK5A 2CSVA 2VPDA 3N9OA 2VJFA 5I3LA 2RSDA 5K3QA 4A4CA 2F6JA 3LVQE 3N9NA 1WEEA 5SVYA 2F42A 2IDAA 2JMIA 2Y43A 4YAXA 1Z2QA 3FEHA 3N9PA 3N9QA 4LK9A 3N9MA 2L80A 4V3LC 3PHDA 2MKEA 1MBMA 1VD4A 2AN6A 2RR4A 2KU3A 5C11A 3HCTA 2QIZA 4A0CD 4GNEA 4B7YC 4GNGA 2XB1A 3HCUA 4FJCA 2ECJA 2KWOA 3KNVA 2VJEA 2Y1NA 5B77A 1VYXA 4S3OB 2M1RA 3ZTGA 3FL2A 1JOCA 1HYIA 3SOWA 2PNXA 4LKAA 2VNFA 5FB0A 5FERA 5H1VA 3IHPA 2LGKA 3ZNIA 2L7PA 2VPEA 4YABA 3LDYA 3DDTA 3U5NA 4NN2A 2FFWA 3KDEC 1K2FA 1N87A 3LJUX 3DPLR 2IQJA 2CSYA 2LDRA 1WEVA 2YHOA 2QJ0A 4S3OC 4OGEA 2BAYA 4I7BA 2D8UA 3ZYQA 2MD8C 5J3XA 2L75A 2JUNA 3I2DA 3DQVR 1WEUA 4Q6FA 4AYCB 5G0FA 2D8SA 3GV4A 3MHSA 3KV5A 2LV9A 1RMDA 2LN0A 2LAUA 3RTRB 2MA5A 3NG2A 2CKLB 2YU4A 3U5MA 3M62A 2JMDA 2DSMA 2JMJA 2LRIC 5SVXA 2G45A 1FP0A 3PLWA 2K16A 2DJAA 3FM8C 2ECGA 5FEYA 4ZDTA 2VJFB 4GB0A 2KWJA 3T6RA 2XOYA 3V43A 2YVRA 2C2VS 1ZBDB 2KR4A 4TKPB 5D1KB 4XI1A 2YSJA 5LKZA 5H1TA 2EODA 1T1HA 4YADA 4L58A 2YSMA 2MNYA 4WZ3B 2ECNA 2KIZA 2KE1A 5D1LB 3MDBC 3ZPVE 3O37A 3O36A 4R7EA 2ECIA 2QICA 2OWAA 1JM7A 4QF2A 1WEPA 3EB5A 2VPBA 4ZUXU 5TDWA 2MIQA 3KV6A 1WE9A 3L1XA 4UI9B 1MM2A 2OXQC 4WA6A 2XEUA 3DWDA 4X3GA 4V3KC 2E6RA 3L1ZB 4PTBA 3Q1DA 5AITA 2CT2A 2YREA 4UP0A 4CCGX 2KFTA 2KGGA 2YHNA 4A49A 3HCSA 4OGCA 4B86C 2HYED 5DINA 1DCQA 1Z6UA 4L7XA 1X4IA 1WEWA 4W4UA 1LDKC 3O33A 1F62A 2M85A 5JG6A 2ECTA 4AP4A 2CONA 5TABA 2L43A 5B76A 5SVIA 1DVPA 2ECVA 5D1MB 1WESA 1XWHA 2EGPA 3SOXA 1CHCA 4Z0OA 2FUIA 3ZVZB 2EXUA 3O35A 5B8DA 4I7CA
chains in the Genus database with same CATH topology
3QZVA 1U6GB 4IC2A 4LLBA 2NAAA 3RPGB 1WENA 3U5PA 5LKXA 3M63A 2YT5A 3KQIA 2JRJA 3LQIA 2KYUA 3C6WA 4LJNA 1X4UA 1Z60A 2PUYA 2L5UA 2ZETC 4ZQLA 4YBSA 2C2LA 2KWKA 2YUCA 1V87A 3PUQA 4CA1A 2ECWA 3O34A 2VP7A 1MM3A 3RPGC 2YQLA 5TBNA 2K17A 2M6MA 2H0DA 5KH9A 5DKAA 1VFYA 5H1UA 4O64A 4YBMA 2LXPC 2VJEB 2Y1MA 3SOUA 1JM7B 5TDRA 4MVTA 2L0BA 4GNDA 5G04B 2F6NA 4R8PK 3LRQA 4YATA 4N4FA 2LGLA 4MSXA 4P5OB 2FSAA 4LADB 3ZPV1 4BHWA 2MNZA 3M99A 4WZ2A 4YBTA 1LDJB 2VPGA 1FBVA 3ASLA 4QF3A 2YURA 5C13A 2MD7B 4IC3A 2M3HA 5LKTA 2YYRA 5B79A 1WFKA 2MA6A 2LXHC 2YQMA 3SHBA 2LGVA 3N9LA 5G05B 1BORA 3EB6A 2FUUA 5AIUA 2KREA 5EYAF 4R2YA 5FB1A 3O7AA 4GNFA 2K1JA 1X4JA 1WEOA 2CSZA 3C5KA 2KGIA 4YC9A 4AVXA 1WGMA 5LKUA 1WEQA 4FO9A 2DX8A 3L11A 5KH3A 4AUQB 4PPEA 3PURA 3HTKC 3T7LA 3VK6A 2E6SA 4F52B 1HYJA 2G43A 5H9MA 4A4BA 2HDPA 3U5OA 2KWNA 2LQ6A 5LCWB 1WEMA 4AYCA 5KH7A 5B78A 2K4DA 2EA6A 2MT5A 3O70A 3GL6A 4UP5A 2H0DB 2RI7A 4C9ZA 2I50A 4BBQA 1WILA 2UZGA 2G6QA 3LQJA 3MHHA 1E4UA 4N3WA 4FIPA 2CKLA 3ZVYA 1WIMA 1G25A 2LGGA 1IYMA 2YW8A 3LQHA 2MUMA 4I7DA 4WZ0A 5B75A 5TRBA 4FK5A 2VPDA 3N9OA 2VJFA 5I3LA 2RSDA 4A4CA 2F6JA 3N9NA 1WEEA 2F42A 2IDAA 2JMIA 2Y43A 4YAXA 1Z2QA 3N9PA 3N9QA 4LK9A 3N9MA 2L80A 4V3LC 3PHDA 1VD4A 2AN6A 2KU3A 5C11A 3HCTA 2QIZA 4A0CD 4GNEA 4B7YC 4GNGA 2XB1A 3HCUA 4FJCA 2ECJA 2KWOA 3KNVA 2VJEA 2Y1NA 5B77A 1VYXA 4S3OB 2M1RA 3ZTGA 3FL2A 1JOCA 1HYIA 3SOWA 2PNXA 4LKAA 2VNFA 5FB0A 5FERA 5H1VA 3IHPA 2LGKA 3ZNIA 2VPEA 4YABA 3U5NA 4NN2A 1K2FA 1N87A 3DPLR 2CSYA 2LDRA 1WEVA 2YHOA 2QJ0A 4S3OC 2BAYA 4I7BA 3ZYQA 2MD8C 5J3XA 2L75A 3I2DA 3DQVR 1WEUA 4Q6FA 4AYCB 5G0FA 2D8SA 3GV4A 3MHSA 3KV5A 2LV9A 1RMDA 2LN0A 3RTRB 2MA5A 3NG2A 2CKLB 2YU4A 3U5MA 3M62A 2JMDA 2JMJA 2LRIC 2G45A 1FP0A 2K16A 2ECGA 5FEYA 4ZDTA 2VJFB 4GB0A 2KWJA 3T6RA 3V43A 2C2VS 1ZBDB 2KR4A 4TKPB 5D1KB 4XI1A 2YSJA 5LKZA 5H1TA 2EODA 1T1HA 4YADA 4L58A 2YSMA 2MNYA 4WZ3B 2ECNA 2KIZA 2KE1A 5D1LB 3ZPVE 3O37A 3O36A 4R7EA 2ECIA 2QICA 1JM7A 4QF2A 1WEPA 3EB5A 2VPBA 4ZUXU 5TDWA 2MIQA 3KV6A 1WE9A 3L1XA 4UI9B 1MM2A 2OXQC 4WA6A 2XEUA 4X3GA 4V3KC 2E6RA 3L1ZB 4PTBA 5AITA 2CT2A 2YREA 4UP0A 4CCGX 2KFTA 2KGGA 2YHNA 4A49A 3HCSA 4B86C 2HYED 5DINA 1Z6UA 4L7XA 1X4IA 1WEWA 4W4UA 1LDKC 3O33A 1F62A 2M85A 5JG6A 2ECTA 4AP4A 5TABA 2L43A 5B76A 1DVPA 2ECVA 5D1MB 1WESA 1XWHA 2EGPA 3SOXA 1CHCA 2FUIA 3ZVZB 3O35A 5B8DA 4I7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZV A;  1U6G B;  4IC2 A;  4LLB A;  2NAA A;  3RPG B;  1WEN A;  3U5P A;  5LKX A;  3M63 A;  2YT5 A;  3KQI A;  2JRJ A;  3LQI A;  2KYU A;  3C6W A;  4LJN A;  1X4U A;  1Z60 A;  2PUY A;  2L5U A;  2ZET C;  4ZQL A;  4YBS A;  2C2L A;  2KWK A;  2YUC A;  1V87 A;  3PUQ A;  4CA1 A;  2ECW A;  3O34 A;  2VP7 A;  1MM3 A;  3RPG C;  2YQL A;  5TBN A;  2K17 A;  2M6M A;  2H0D A;  5KH9 A;  5DKA A;  1VFY A;  5H1U A;  4O64 A;  4YBM A;  2LXP C;  2VJE B;  2Y1M A;  3SOU A;  1JM7 B;  5TDR A;  4MVT A;  2L0B A;  4GND A;  5G04 B;  2F6N A;  4R8P K;  3LRQ A;  4YAT A;  4N4F A;  2LGL A;  4MSX A;  4P5O B;  2FSA A;  4LAD B;  3ZPV 1;  4BHW A;  2MNZ A;  3M99 A;  4WZ2 A;  4YBT A;  1LDJ B;  2VPG A;  1FBV A;  3ASL A;  4QF3 A;  2YUR A;  5C13 A;  2MD7 B;  4IC3 A;  2M3H A;  5LKT A;  2YYR A;  5B79 A;  1WFK A;  2MA6 A;  2LXH C;  2YQM A;  3SHB A;  2LGV A;  3N9L A;  5G05 B;  1BOR A;  3EB6 A;  2FUU A;  5AIU A;  2KRE A;  5EYA F;  4R2Y A;  5FB1 A;  3O7A A;  4GNF A;  2K1J A;  1X4J A;  1WEO A;  2CSZ A;  3C5K A;  2KGI A;  4YC9 A;  4AVX A;  1WGM A;  5LKU A;  1WEQ A;  4FO9 A;  2DX8 A;  3L11 A;  5KH3 A;  4AUQ B;  4PPE A;  3PUR A;  3HTK C;  3T7L A;  3VK6 A;  2E6S A;  4F52 B;  1HYJ A;  2G43 A;  5H9M A;  4A4B A;  2HDP A;  3U5O A;  2KWN A;  2LQ6 A;  5LCW B;  1WEM A;  4AYC A;  5KH7 A;  5B78 A;  2K4D A;  2EA6 A;  2MT5 A;  3O70 A;  3GL6 A;  4UP5 A;  2H0D B;  2RI7 A;  4C9Z A;  2I50 A;  4BBQ A;  1WIL A;  2UZG A;  2G6Q A;  3LQJ A;  3MHH A;  1E4U A;  4N3W A;  4FIP A;  2CKL A;  3ZVY A;  1WIM A;  1G25 A;  2LGG A;  1IYM A;  2YW8 A;  3LQH A;  2MUM A;  4I7D A;  4WZ0 A;  5B75 A;  5TRB A;  4FK5 A;  2VPD A;  3N9O A;  2VJF A;  5I3L A;  2RSD A;  4A4C A;  2F6J A;  3N9N A;  1WEE A;  2F42 A;  2IDA A;  2JMI A;  2Y43 A;  4YAX A;  1Z2Q A;  3N9P A;  3N9Q A;  4LK9 A;  3N9M A;  2L80 A;  4V3L C;  3PHD A;  1VD4 A;  2AN6 A;  2KU3 A;  5C11 A;  3HCT A;  2QIZ A;  4A0C D;  4GNE A;  4B7Y C;  4GNG A;  2XB1 A;  3HCU A;  4FJC A;  2ECJ A;  2KWO A;  3KNV A;  2VJE A;  2Y1N A;  5B77 A;  1VYX A;  4S3O B;  2M1R A;  3ZTG A;  3FL2 A;  1JOC A;  1HYI A;  3SOW A;  2PNX A;  4LKA A;  2VNF A;  5FB0 A;  5FER A;  5H1V A;  3IHP A;  2LGK A;  3ZNI A;  2VPE A;  4YAB A;  3U5N A;  4NN2 A;  1K2F A;  1N87 A;  3DPL R;  2CSY A;  2LDR A;  1WEV A;  2YHO A;  2QJ0 A;  4S3O C;  2BAY A;  4I7B A;  3ZYQ A;  2MD8 C;  5J3X A;  2L75 A;  3I2D A;  3DQV R;  1WEU A;  4Q6F A;  4AYC B;  5G0F A;  2D8S A;  3GV4 A;  3MHS A;  3KV5 A;  2LV9 A;  1RMD A;  2LN0 A;  3RTR B;  2MA5 A;  3NG2 A;  2CKL B;  2YU4 A;  3U5M A;  3M62 A;  2JMD A;  2JMJ A;  2LRI C;  2G45 A;  1FP0 A;  2K16 A;  2ECG A;  5FEY A;  4ZDT A;  2VJF B;  4GB0 A;  2KWJ A;  3T6R A;  3V43 A;  2C2V S;  1ZBD B;  2KR4 A;  4TKP B;  5D1K B;  4XI1 A;  2YSJ A;  5LKZ A;  5H1T A;  2EOD A;  1T1H A;  4YAD A;  4L58 A;  2YSM A;  2MNY A;  4WZ3 B;  2ECN A;  2KIZ A;  2KE1 A;  5D1L B;  3ZPV E;  3O37 A;  3O36 A;  4R7E A;  2ECI A;  2QIC A;  1JM7 A;  4QF2 A;  1WEP A;  3EB5 A;  2VPB A;  4ZUX U;  5TDW A;  2MIQ A;  3KV6 A;  1WE9 A;  3L1X A;  4UI9 B;  1MM2 A;  2OXQ C;  4WA6 A;  2XEU A;  4X3G A;  4V3K C;  2E6R A;  3L1Z B;  4PTB A;  5AIT A;  2CT2 A;  2YRE A;  4UP0 A;  4CCG X;  2KFT A;  2KGG A;  2YHN A;  4A49 A;  3HCS A;  4B86 C;  2HYE D;  5DIN A;  1Z6U A;  4L7X A;  1X4I A;  1WEW A;  4W4U A;  1LDK C;  3O33 A;  1F62 A;  2M85 A;  5JG6 A;  2ECT A;  4AP4 A;  5TAB A;  2L43 A;  5B76 A;  1DVP A;  2ECV A;  5D1M B;  1WES A;  1XWH A;  2EGP A;  3SOX A;  1CHC A;  2FUI A;  3ZVZ B;  3O35 A;  5B8D A;  4I7C A; 
#chains in the Genus database with same CATH topology
 3QZV A;  1U6G B;  4IC2 A;  4LLB A;  2NAA A;  2KKX A;  3RPG B;  1WEN A;  3U5P A;  5LKX A;  3M63 A;  2YT5 A;  3KQI A;  2JRJ A;  3LQI A;  2KYU A;  3C6W A;  4LJN A;  1X4U A;  1Z60 A;  2PUY A;  2XOC A;  2L5U A;  2ZET C;  4ZQL A;  4YBS A;  2C2L A;  2KWK A;  2YUC A;  1V87 A;  3PUQ A;  4CA1 A;  2ECW A;  3O34 A;  2VP7 A;  1MM3 A;  3RPG C;  2YQL A;  5TBN A;  2K17 A;  2M6M A;  3FAN A;  2H0D A;  3O47 A;  5KH9 A;  5DKA A;  1VFY A;  5H1U A;  4O64 A;  4YBM A;  2LXP C;  2VJE B;  2Y1M A;  3E2D A;  3SOU A;  1JM7 B;  5TDR A;  4MVT A;  2L0B A;  2M13 A;  4GND A;  5G04 B;  2F6N A;  4R8P K;  3LRQ A;  3H7H A;  4YAT A;  4N4F A;  2EGM A;  2LGL A;  4MSX A;  4P5O B;  2FSA A;  4LAD B;  3ZPV 1;  4BHW A;  2MNZ A;  2B0O E;  3M99 A;  4WZ2 A;  3T9K A;  4YBT A;  1LDJ B;  2VPG A;  1FBV A;  3FJU B;  3ASL A;  4QF3 A;  3M7K A;  2YUR A;  5C13 A;  2MD7 B;  4IC3 A;  2M3H A;  5LKT A;  2YYR A;  5B79 A;  1WFK A;  2MA6 A;  2LXH C;  2YQM A;  2E61 A;  3SHB A;  2LGV A;  3N9L A;  5G05 B;  3FAO A;  1BOR A;  3LVR E;  3EB6 A;  2FUU A;  5SVI B;  5AIU A;  2KRE A;  5EYA F;  4R2Y A;  5FB1 A;  2KKY A;  2CRR A;  2XOZ A;  2CRW A;  3O7A A;  4GNF A;  2K1J A;  1X4J A;  1WEO A;  2CSZ A;  3C5K A;  2KGI A;  2JM3 A;  4YC9 A;  4AVX A;  1WGM A;  5LKU A;  1WEQ A;  4FO9 A;  2DX8 A;  3L11 A;  5KH3 A;  4AUQ B;  2P57 A;  4PPE A;  3PUR A;  2XP0 A;  3HTK C;  3T7L A;  3JUE A;  3VK6 A;  2E6S A;  4F52 B;  1HYJ A;  2G43 A;  5H9M A;  4H9D A;  4A4B A;  2HDP A;  3U5O A;  2KWN A;  2LQ6 A;  5LCW B;  1WEM A;  4AYC A;  5KH7 A;  5B78 A;  2K4D A;  2EA6 A;  2MT5 A;  4QQ4 A;  2FD4 A;  3O70 A;  3GL6 A;  4UP5 A;  2H0D B;  2RI7 A;  4O62 A;  4C9Z A;  2I50 A;  3SUB A;  4F1P A;  4BBQ A;  1WIL A;  2UZG A;  3MHH A;  2G6Q A;  3LQJ A;  1E4U A;  4Z0R A;  4N3W A;  4FIP A;  2CKL A;  3ZVY A;  1WIM A;  1G25 A;  2LGG A;  1IYM A;  2YW8 A;  3LQH A;  2MUM A;  4I7D A;  4WZ0 A;  5B75 A;  5TRB A;  4FK5 A;  2CSV A;  2VPD A;  3N9O A;  2VJF A;  5I3L A;  2RSD A;  5K3Q A;  4A4C A;  2F6J A;  3LVQ E;  3N9N A;  1WEE A;  5SVY A;  2F42 A;  2IDA A;  2JMI A;  2Y43 A;  4YAX A;  1Z2Q A;  3FEH A;  3N9P A;  3N9Q A;  4LK9 A;  3N9M A;  2L80 A;  4V3L C;  3PHD A;  2MKE A;  1MBM A;  1VD4 A;  2AN6 A;  2RR4 A;  2KU3 A;  5C11 A;  3HCT A;  2QIZ A;  4A0C D;  4GNE A;  4B7Y C;  4GNG A;  2XB1 A;  3HCU A;  4FJC A;  2ECJ A;  2KWO A;  3KNV A;  2VJE A;  2Y1N A;  5B77 A;  1VYX A;  4S3O B;  2M1R A;  3ZTG A;  3FL2 A;  1JOC A;  1HYI A;  3SOW A;  2PNX A;  4LKA A;  2VNF A;  5FB0 A;  5FER A;  5H1V A;  3IHP A;  2LGK A;  3ZNI A;  2L7P A;  2VPE A;  4YAB A;  3LDY A;  3DDT A;  3U5N A;  4NN2 A;  2FFW A;  3KDE C;  1K2F A;  1N87 A;  3LJU X;  3DPL R;  2IQJ A;  2CSY A;  2LDR A;  1WEV A;  2YHO A;  2QJ0 A;  4S3O C;  4OGE A;  2BAY A;  4I7B A;  2D8U A;  3ZYQ A;  2MD8 C;  5J3X A;  2L75 A;  2JUN A;  3I2D A;  3DQV R;  1WEU A;  4Q6F A;  4AYC B;  5G0F A;  2D8S A;  3GV4 A;  3MHS A;  3KV5 A;  2LV9 A;  1RMD A;  2LN0 A;  2LAU A;  3RTR B;  2MA5 A;  3NG2 A;  2CKL B;  2YU4 A;  3U5M A;  3M62 A;  2JMD A;  2DSM A;  2JMJ A;  2LRI C;  5SVX A;  2G45 A;  1FP0 A;  3PLW A;  2K16 A;  2DJA A;  3FM8 C;  2ECG A;  5FEY A;  4ZDT A;  2VJF B;  4GB0 A;  2KWJ A;  3T6R A;  2XOY A;  3V43 A;  2YVR A;  2C2V S;  1ZBD B;  2KR4 A;  4TKP B;  5D1K B;  4XI1 A;  2YSJ A;  5LKZ A;  5H1T A;  2EOD A;  1T1H A;  4YAD A;  4L58 A;  2YSM A;  2MNY A;  4WZ3 B;  2ECN A;  2KIZ A;  2KE1 A;  5D1L B;  3MDB C;  3ZPV E;  3O37 A;  3O36 A;  4R7E A;  2ECI A;  2QIC A;  2OWA A;  1JM7 A;  4QF2 A;  1WEP A;  3EB5 A;  2VPB A;  4ZUX U;  5TDW A;  2MIQ A;  3KV6 A;  1WE9 A;  3L1X A;  4UI9 B;  1MM2 A;  2OXQ C;  4WA6 A;  2XEU A;  3DWD A;  4X3G A;  4V3K C;  2E6R A;  3L1Z B;  4PTB A;  3Q1D A;  5AIT A;  2CT2 A;  2YRE A;  4UP0 A;  4CCG X;  2KFT A;  2KGG A;  2YHN A;  4A49 A;  3HCS A;  4OGC A;  4B86 C;  2HYE D;  5DIN A;  1DCQ A;  1Z6U A;  4L7X A;  1X4I A;  1WEW A;  4W4U A;  1LDK C;  3O33 A;  1F62 A;  2M85 A;  5JG6 A;  2ECT A;  4AP4 A;  2CON A;  5TAB A;  2L43 A;  5B76 A;  5SVI A;  1DVP A;  2ECV A;  5D1M B;  1WES A;  1XWH A;  2EGP A;  3SOX A;  1CHC A;  4Z0O A;  2FUI A;  3ZVZ B;  2EXU A;  3O35 A;  5B8D A;  4I7C A; 
#chains in the Genus database with same CATH homology
 3QZV A;  1U6G B;  4IC2 A;  4LLB A;  2NAA A;  3RPG B;  1WEN A;  3U5P A;  5LKX A;  3M63 A;  2YT5 A;  3KQI A;  2JRJ A;  3LQI A;  2KYU A;  3C6W A;  4LJN A;  1X4U A;  1Z60 A;  2PUY A;  2L5U A;  2ZET C;  4ZQL A;  4YBS A;  2C2L A;  2KWK A;  2YUC A;  1V87 A;  3PUQ A;  4CA1 A;  2ECW A;  3O34 A;  2VP7 A;  1MM3 A;  3RPG C;  2YQL A;  5TBN A;  2K17 A;  2M6M A;  2H0D A;  5KH9 A;  5DKA A;  1VFY A;  5H1U A;  4O64 A;  4YBM A;  2LXP C;  2VJE B;  2Y1M A;  3SOU A;  1JM7 B;  5TDR A;  4MVT A;  2L0B A;  4GND A;  5G04 B;  2F6N A;  4R8P K;  3LRQ A;  4YAT A;  4N4F A;  2LGL A;  4MSX A;  4P5O B;  2FSA A;  4LAD B;  3ZPV 1;  4BHW A;  2MNZ A;  3M99 A;  4WZ2 A;  4YBT A;  1LDJ B;  2VPG A;  1FBV A;  3ASL A;  4QF3 A;  2YUR A;  5C13 A;  2MD7 B;  4IC3 A;  2M3H A;  5LKT A;  2YYR A;  5B79 A;  1WFK A;  2MA6 A;  2LXH C;  2YQM A;  3SHB A;  2LGV A;  3N9L A;  5G05 B;  1BOR A;  3EB6 A;  2FUU A;  5AIU A;  2KRE A;  5EYA F;  4R2Y A;  5FB1 A;  3O7A A;  4GNF A;  2K1J A;  1X4J A;  1WEO A;  2CSZ A;  3C5K A;  2KGI A;  4YC9 A;  4AVX A;  1WGM A;  5LKU A;  1WEQ A;  4FO9 A;  2DX8 A;  3L11 A;  5KH3 A;  4AUQ B;  4PPE A;  3PUR A;  3HTK C;  3T7L A;  3VK6 A;  2E6S A;  4F52 B;  1HYJ A;  2G43 A;  5H9M A;  4A4B A;  2HDP A;  3U5O A;  2KWN A;  2LQ6 A;  5LCW B;  1WEM A;  4AYC A;  5KH7 A;  5B78 A;  2K4D A;  2EA6 A;  2MT5 A;  3O70 A;  3GL6 A;  4UP5 A;  2H0D B;  2RI7 A;  4C9Z A;  2I50 A;  4BBQ A;  1WIL A;  2UZG A;  2G6Q A;  3LQJ A;  3MHH A;  1E4U A;  4N3W A;  4FIP A;  2CKL A;  3ZVY A;  1WIM A;  1G25 A;  2LGG A;  1IYM A;  2YW8 A;  3LQH A;  2MUM A;  4I7D A;  4WZ0 A;  5B75 A;  5TRB A;  4FK5 A;  2VPD A;  3N9O A;  2VJF A;  5I3L A;  2RSD A;  4A4C A;  2F6J A;  3N9N A;  1WEE A;  2F42 A;  2IDA A;  2JMI A;  2Y43 A;  4YAX A;  1Z2Q A;  3N9P A;  3N9Q A;  4LK9 A;  3N9M A;  2L80 A;  4V3L C;  3PHD A;  1VD4 A;  2AN6 A;  2KU3 A;  5C11 A;  3HCT A;  2QIZ A;  4A0C D;  4GNE A;  4B7Y C;  4GNG A;  2XB1 A;  3HCU A;  4FJC A;  2ECJ A;  2KWO A;  3KNV A;  2VJE A;  2Y1N A;  5B77 A;  1VYX A;  4S3O B;  2M1R A;  3ZTG A;  3FL2 A;  1JOC A;  1HYI A;  3SOW A;  2PNX A;  4LKA A;  2VNF A;  5FB0 A;  5FER A;  5H1V A;  3IHP A;  2LGK A;  3ZNI A;  2VPE A;  4YAB A;  3U5N A;  4NN2 A;  1K2F A;  1N87 A;  3DPL R;  2CSY A;  2LDR A;  1WEV A;  2YHO A;  2QJ0 A;  4S3O C;  2BAY A;  4I7B A;  3ZYQ A;  2MD8 C;  5J3X A;  2L75 A;  3I2D A;  3DQV R;  1WEU A;  4Q6F A;  4AYC B;  5G0F A;  2D8S A;  3GV4 A;  3MHS A;  3KV5 A;  2LV9 A;  1RMD A;  2LN0 A;  3RTR B;  2MA5 A;  3NG2 A;  2CKL B;  2YU4 A;  3U5M A;  3M62 A;  2JMD A;  2JMJ A;  2LRI C;  2G45 A;  1FP0 A;  2K16 A;  2ECG A;  5FEY A;  4ZDT A;  2VJF B;  4GB0 A;  2KWJ A;  3T6R A;  3V43 A;  2C2V S;  1ZBD B;  2KR4 A;  4TKP B;  5D1K B;  4XI1 A;  2YSJ A;  5LKZ A;  5H1T A;  2EOD A;  1T1H A;  4YAD A;  4L58 A;  2YSM A;  2MNY A;  4WZ3 B;  2ECN A;  2KIZ A;  2KE1 A;  5D1L B;  3ZPV E;  3O37 A;  3O36 A;  4R7E A;  2ECI A;  2QIC A;  1JM7 A;  4QF2 A;  1WEP A;  3EB5 A;  2VPB A;  4ZUX U;  5TDW A;  2MIQ A;  3KV6 A;  1WE9 A;  3L1X A;  4UI9 B;  1MM2 A;  2OXQ C;  4WA6 A;  2XEU A;  4X3G A;  4V3K C;  2E6R A;  3L1Z B;  4PTB A;  5AIT A;  2CT2 A;  2YRE A;  4UP0 A;  4CCG X;  2KFT A;  2KGG A;  2YHN A;  4A49 A;  3HCS A;  4B86 C;  2HYE D;  5DIN A;  1Z6U A;  4L7X A;  1X4I A;  1WEW A;  4W4U A;  1LDK C;  3O33 A;  1F62 A;  2M85 A;  5JG6 A;  2ECT A;  4AP4 A;  5TAB A;  2L43 A;  5B76 A;  1DVP A;  2ECV A;  5D1M B;  1WES A;  1XWH A;  2EGP A;  3SOX A;  1CHC A;  2FUI A;  3ZVZ B;  3O35 A;  5B8D A;  4I7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...