2YU4A

Solution structure of the sp-ring domain in non-smc element 2 homolog (mms21, s. cerevisiae)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
94
Chain Sequence
b'GSSGSSGFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase NSE2
publication title Solution structure of the SP-RING domain in non-SMC element 2 homolog (MMS21, S. cerevisiae)
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 14
structure length 94
sequence length 94
ec nomenclature ec 6.-.-.-:
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yu4A00
5AITA 2YREA 2KGIA 3GL6A 1Z2QA 2ECNA 3HCTA 3LQIA 5LCWB 5G04B 2JMJA 3L11A 2Y1MA 1HYIA 2MA5A 1VYXA 2YW8A 1DVPA 2M85A 4A4BA 2L80A 2G43A 3O36A 1WEMA 2MD7B 5LKXA 4CCGX 2LDRA 5KH7A 2K16A 4BBQA 3M62A 2PNXA 4FK5A 3U5PA 2Y1NA 2F6JA 4WZ3B 3M63A 4I7CA 1MM2A 1E4UA 2L75A 2VJEA 3ZNIA 5KH9A 4B7YC 5G0FA 4CA1A 3VK6A 1WEVA 1HYJA 4A0CD 2Y43A 1F62A 5DINA 3ZVYA 4IC2A 2MUMA 2EA6A 3ASLA 3RTRB 3N9OA 3SOUA 5JG6A 3O35A 2G6QA 2MNYA 2ECGA 2F42A 2JMDA 2YURA 2KWOA 3C6WA 2K1JA 3RPGC 2C2VS 3PURA 3O33A 4A49A 5DKAA 5B76A 4YBMA 2YUCA 4F52B 5C11A 1WENA 2ECJA 1WFKA 2VPEA 1N87A 4MSXA 5B8DA 2YHNA 1VFYA 2CT2A 2HDPA 5TDRA 1K2FA 2C2LA 2XB1A 4O64A 5H1TA 4WZ2A 2VPBA 4LJNA 4ZQLA 3ZYQA 1RMDA 3HCUA 4MVTA 2YSJA 1XWHA 1WEPA 5H1UA 2FSAA 4PTBA 1X4UA 4A4CA 2G45A 4C9ZA 3O70A 3N9PA 4LK9A 3DPLR 2KIZA 2LXPC 3LRQA 1Z6UA 4LLBA 1WILA 4I7BA 5G05B 5B75A 4FIPA 2LRIC 4R7EA 2KREA 5LKTA 4AP4A 2KWJA 2RI7A 2MT5A 2VJEB 3N9MA 4R8PK 2QIZA 3O7AA 5D1LB 2LGVA 5D1KB 3KQIA 4ZUXU 4P5OB 5TDWA 3N9NA 2L5UA 4L7XA 2MD8C 1Z60A 4QF3A 3KV5A 5C13A 3LQJA 4YAXA 3SOXA 2ECIA 4N4FA 1JM7A 2EODA 2OXQC 2HYED 2KE1A 2MA6A 2KGGA 2YQLA 4W4UA 5B79A 2KYUA 3O37A 5LKZA 2AN6A 2LXHC 2H0DA 2QICA 5FEYA 3ZPVE 4FJCA 3LQHA 2F6NA 1WEWA 2LGLA 1WIMA 5B77A 3U5MA 2LGGA 4AUQB 2EGPA 3HTKC 3ZTGA 2NAAA 4GNEA 4YC9A 3KNVA 2YHOA 2I50A 4WA6A 3T6RA 2JMIA 4S3OB 1WESA 3L1ZB 2YSMA 4YATA 2XEUA 1CHCA 3MHHA 2M1RA 2K17A 3DQVR 3MHSA 3IHPA 4FO9A 4AYCA 4V3LC 2CKLA 1ZBDB 1MM3A 2M6MA 4LKAA 2LV9A 3PHDA 2PUYA 4YBTA 4GNFA 2MIQA 2KWNA 5B78A 3L1XA 2M3HA 2E6RA 2QJ0A 3I2DA 1WEQA 3QZVA 4YABA 2L43A 2LGKA 3ZPV1 1FBVA 1JM7B 2ZETC 4S3OC 4V3KC 2D8SA 3NG2A 3U5OA 2VJFB 2H0DB 3EB5A 2KFTA 4PPEA 1BORA 5KH3A 3O34A 4X3GA 4XI1A 3RPGB 1X4JA 3C5KA 2ECWA 4LADB 2LN0A 2VPDA 2YU4A 2FUIA 2VJFA 4IC3A 2KR4A 1WEUA 5J3XA 1WEEA 3HCSA 2DX8A 1FP0A 3T7LA 4QF2A 2VPGA 5H9MA 5EYAF 3N9QA 1U6GB 2KU3A 4BHWA 5FERA 1IYMA 1LDJB 4YBSA 3SOWA 4ZDTA 2YQMA 3KV6A 2FUUA 1X4IA 1G25A 3N9LA 1WEOA 2L0BA 1VD4A 4AYCB 2KWKA 2CKLB 5TABA 4N3WA 3FL2A 2JRJA 1WGMA 4UP0A 1JOCA 2YYRA 4I7DA 4GNDA 3SHBA 4NN2A 5TRBA 4TKPB 5AIUA 2RSDA 5LKUA 4R2YA 4UP5A 3PUQA 4AVXA 2IDAA 5TBNA 3M99A 1T1HA 4B86C 4GB0A 2CSYA 5D1MB 4YADA 1V87A 2BAYA 2ECVA 3EB6A 4WZ0A 1LDKC 2K4DA 2VP7A 2CSZA 2LQ6A 5I3LA 2ECTA 5FB1A 2VNFA 5FB0A 2MNZA 4Q6FA 2E6SA 3GV4A 4UI9B 3U5NA 4GNGA 3ZVZB 5H1VA 3V43A 1WE9A 4L58A 2YT5A 2UZGA
chains in the Genus database with same CATH superfamily
5AITA 2YREA 2KGIA 3GL6A 1Z2QA 2ECNA 3HCTA 3LQIA 5LCWB 5G04B 2JMJA 3L11A 2Y1MA 1HYIA 2MA5A 1VYXA 2YW8A 1DVPA 2M85A 4A4BA 2L80A 2G43A 3O36A 1WEMA 2MD7B 5LKXA 4CCGX 3DWDA 2JUNA 3FANA 2LDRA 2YVRA 5KH7A 2K16A 4BBQA 2MKEA 2PNXA 3M62A 4FK5A 3U5PA 3KDEC 2Y1NA 2F6JA 4WZ3B 3M63A 2XOYA 4I7CA 1MM2A 4OGCA 1E4UA 2L75A 2VJEA 1DCQA 3ZNIA 5KH9A 4B7YC 5G0FA 4CA1A 3VK6A 1WEVA 1HYJA 4A0CD 4QQ4A 2Y43A 1F62A 5DINA 3ZVYA 4IC2A 2MUMA 2EA6A 3ASLA 3RTRB 2LAUA 3N9OA 3SOUA 5JG6A 3O35A 3LDYA 2G6QA 2JM3A 2MNYA 2ECGA 2F42A 2JMDA 2YURA 3SUBA 2KWOA 3C6WA 2K1JA 3RPGC 2C2VS 2CRWA 3PURA 3FJUB 3O33A 4A49A 5DKAA 2D8UA 5B76A 2XP0A 4YBMA 2YUCA 2EGMA 4F52B 5C11A 1WENA 2ECJA 1WFKA 2VPEA 1N87A 4MSXA 5SVYA 5B8DA 2YHNA 1VFYA 2CT2A 2HDPA 3E2DA 5TDRA 4O62A 1K2FA 2C2LA 2XB1A 4O64A 5H1TA 2FFWA 3PLWA 4WZ2A 2VPBA 4LJNA 4ZQLA 3ZYQA 1RMDA 3HCUA 4MVTA 2CRRA 2IQJA 2YSJA 1XWHA 1WEPA 5H1UA 2FSAA 4PTBA 1X4UA 4A4CA 2G45A 4C9ZA 3O70A 3N9PA 4LK9A 3DPLR 2KIZA 4Z0OA 2LXPC 3LRQA 2M13A 1Z6UA 4LLBA 1WILA 4I7BA 5G05B 5K3QA 5B75A 4FIPA 2LRIC 4R7EA 2KREA 5LKTA 4AP4A 3FM8C 2KWJA 2RI7A 2MT5A 2VJEB 3N9MA 4R8PK 2QIZA 3Q1DA 3O7AA 5D1LB 2LGVA 5D1KB 3KQIA 4ZUXU 2FD4A 4P5OB 5TDWA 3N9NA 2L5UA 4L7XA 2MD8C 1Z60A 3M7KA 4QF3A 3KV5A 5C13A 3LQJA 4YAXA 3SOXA 2ECIA 4N4FA 1JM7A 2EODA 2OXQC 2HYED 2KE1A 2MA6A 2KGGA 2YQLA 4W4UA 5B79A 2KYUA 3O37A 5LKZA 2AN6A 2KKYA 2LXHC 2H0DA 2QICA 5FEYA 2DJAA 3ZPVE 4FJCA 3LQHA 2E61A 2F6NA 4F1PA 1WEWA 2LGLA 3H7HA 1WIMA 3FEHA 5B77A 2L7PA 2CSVA 2P57A 3U5MA 2LGGA 4AUQB 2EGPA 3HTKC 3ZTGA 2NAAA 4GNEA 4H9DA 4YC9A 3KNVA 2XOCA 2YHOA 2I50A 4WA6A 3T6RA 2JMIA 2OWAA 4S3OB 1WESA 3L1ZB 2YSMA 4YATA 2XEUA 1CHCA 3MHHA 2M1RA 2K17A 3DQVR 5SVXA 3MHSA 3IHPA 4FO9A 4AYCA 2EXUA 4V3LC 2CKLA 1ZBDB 1MM3A 2M6MA 4LKAA 2LV9A 3PHDA 2PUYA 4YBTA 4GNFA 2MIQA 2KWNA 5B78A 3L1XA 2B0OE 2M3HA 2E6RA 2QJ0A 3I2DA 1WEQA 3QZVA 4YABA 2L43A 2LGKA 3ZPV1 1FBVA 1JM7B 2KKXA 2ZETC 4S3OC 4V3KC 2D8SA 2RR4A 4L58A 3NG2A 3U5OA 2VJFB 3JUEA 3FAOA 2H0DB 3EB5A 2KFTA 3DDTA 4PPEA 1BORA 5KH3A 3O34A 4X3GA 4XI1A 2XOZA 3RPGB 1X4JA 3C5KA 2ECWA 4LADB 2LN0A 2VPDA 2YU4A 2FUIA 2VJFA 4IC3A 2KR4A 1WEUA 5J3XA 1WEEA 3LVRE 3HCSA 2DX8A 1FP0A 3T7LA 3LJUX 4QF2A 2VPGA 5H9MA 5EYAF 3N9QA 1U6GB 2KU3A 4BHWA 5FERA 1IYMA 1LDJB 4YBSA 3SOWA 4ZDTA 2YQMA 3KV6A 2FUUA 5SVIB 1X4IA 4OGEA 1G25A 3N9LA 1WEOA 2L0BA 1VD4A 4AYCB 2KWKA 2DSMA 2CKLB 5TABA 4N3WA 3FL2A 2JRJA 1WGMA 4UP0A 1JOCA 2CONA 2YYRA 4I7DA 4GNDA 4Z0RA 3SHBA 4NN2A 5TRBA 5SVIA 4TKPB 5AIUA 2RSDA 5LKUA 4R2YA 4UP5A 3PUQA 4AVXA 2IDAA 5TBNA 3M99A 1T1HA 4B86C 4GB0A 2CSYA 5D1MB 4YADA 1V87A 2BAYA 2ECVA 3MDBC 3EB6A 3LVQE 3T9KA 4WZ0A 1LDKC 2K4DA 2VP7A 2CSZA 2LQ6A 5I3LA 2ECTA 5FB1A 2VNFA 3O47A 5FB0A 2MNZA 4Q6FA 2E6SA 3GV4A 4UI9B 3U5NA 4GNGA 3ZVZB 5H1VA 3V43A 1WE9A 1MBMA 2YT5A 2UZGA
chains in the Genus database with same CATH topology
5AITA 2YREA 2KGIA 3GL6A 1Z2QA 2ECNA 3HCTA 3LQIA 5LCWB 5G04B 2JMJA 3L11A 2Y1MA 1HYIA 2MA5A 1VYXA 2YW8A 1DVPA 2M85A 4A4BA 2L80A 2G43A 3O36A 1WEMA 2MD7B 5LKXA 4CCGX 2LDRA 5KH7A 2K16A 4BBQA 3M62A 2PNXA 4FK5A 3U5PA 2Y1NA 2F6JA 4WZ3B 3M63A 4I7CA 1MM2A 1E4UA 2L75A 2VJEA 3ZNIA 5KH9A 4B7YC 5G0FA 4CA1A 3VK6A 1WEVA 1HYJA 4A0CD 2Y43A 1F62A 5DINA 3ZVYA 4IC2A 2MUMA 2EA6A 3ASLA 3RTRB 3N9OA 3SOUA 5JG6A 3O35A 2G6QA 2MNYA 2ECGA 2F42A 2JMDA 2YURA 2KWOA 3C6WA 2K1JA 3RPGC 2C2VS 3PURA 3O33A 4A49A 5DKAA 5B76A 4YBMA 2YUCA 4F52B 5C11A 1WENA 2ECJA 1WFKA 2VPEA 1N87A 4MSXA 5B8DA 2YHNA 1VFYA 2CT2A 2HDPA 5TDRA 1K2FA 2C2LA 2XB1A 4O64A 5H1TA 4WZ2A 2VPBA 4LJNA 4ZQLA 3ZYQA 1RMDA 3HCUA 4MVTA 2YSJA 1XWHA 1WEPA 5H1UA 2FSAA 4PTBA 1X4UA 4A4CA 2G45A 4C9ZA 3O70A 3N9PA 4LK9A 3DPLR 2KIZA 2LXPC 3LRQA 1Z6UA 4LLBA 1WILA 4I7BA 5G05B 5B75A 4FIPA 2LRIC 4R7EA 2KREA 5LKTA 4AP4A 2KWJA 2RI7A 2MT5A 2VJEB 3N9MA 4R8PK 2QIZA 3O7AA 5D1LB 2LGVA 5D1KB 3KQIA 4ZUXU 4P5OB 5TDWA 3N9NA 2L5UA 4L7XA 2MD8C 1Z60A 4QF3A 3KV5A 5C13A 3LQJA 4YAXA 3SOXA 2ECIA 4N4FA 1JM7A 2EODA 2OXQC 2HYED 2KE1A 2MA6A 2KGGA 2YQLA 4W4UA 5B79A 2KYUA 3O37A 5LKZA 2AN6A 2LXHC 2H0DA 2QICA 5FEYA 3ZPVE 4FJCA 3LQHA 2F6NA 1WEWA 2LGLA 1WIMA 5B77A 3U5MA 2LGGA 4AUQB 2EGPA 3HTKC 3ZTGA 2NAAA 4GNEA 4YC9A 3KNVA 2YHOA 2I50A 4WA6A 3T6RA 2JMIA 4S3OB 1WESA 3L1ZB 2YSMA 4YATA 2XEUA 1CHCA 3MHHA 2M1RA 2K17A 3DQVR 3MHSA 3IHPA 4FO9A 4AYCA 4V3LC 2CKLA 1ZBDB 1MM3A 2M6MA 4LKAA 2LV9A 3PHDA 2PUYA 4YBTA 4GNFA 2MIQA 2KWNA 5B78A 3L1XA 2M3HA 2E6RA 2QJ0A 3I2DA 1WEQA 3QZVA 4YABA 2L43A 2LGKA 3ZPV1 1FBVA 1JM7B 2ZETC 4S3OC 4V3KC 2D8SA 3NG2A 3U5OA 2VJFB 2H0DB 3EB5A 2KFTA 4PPEA 1BORA 5KH3A 3O34A 4X3GA 4XI1A 3RPGB 1X4JA 3C5KA 2ECWA 4LADB 2LN0A 2VPDA 2YU4A 2FUIA 2VJFA 4IC3A 2KR4A 1WEUA 5J3XA 1WEEA 3HCSA 2DX8A 1FP0A 3T7LA 4QF2A 2VPGA 5H9MA 5EYAF 3N9QA 1U6GB 2KU3A 4BHWA 5FERA 1IYMA 1LDJB 4YBSA 3SOWA 4ZDTA 2YQMA 3KV6A 2FUUA 1X4IA 1G25A 3N9LA 1WEOA 2L0BA 1VD4A 4AYCB 2KWKA 2CKLB 5TABA 4N3WA 3FL2A 2JRJA 1WGMA 4UP0A 1JOCA 2YYRA 4I7DA 4GNDA 3SHBA 4NN2A 5TRBA 4TKPB 5AIUA 2RSDA 5LKUA 4R2YA 4UP5A 3PUQA 4AVXA 2IDAA 5TBNA 3M99A 1T1HA 4B86C 4GB0A 2CSYA 5D1MB 4YADA 1V87A 2BAYA 2ECVA 3EB6A 4WZ0A 1LDKC 2K4DA 2VP7A 2CSZA 2LQ6A 5I3LA 2ECTA 5FB1A 2VNFA 5FB0A 2MNZA 4Q6FA 2E6SA 3GV4A 4UI9B 3U5NA 4GNGA 3ZVZB 5H1VA 3V43A 1WE9A 4L58A 2YT5A 2UZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIT A;  2YRE A;  2KGI A;  3GL6 A;  1Z2Q A;  2ECN A;  3HCT A;  3LQI A;  5LCW B;  5G04 B;  2JMJ A;  3L11 A;  2Y1M A;  1HYI A;  2MA5 A;  1VYX A;  2YW8 A;  1DVP A;  2M85 A;  4A4B A;  2L80 A;  2G43 A;  3O36 A;  1WEM A;  2MD7 B;  5LKX A;  4CCG X;  2LDR A;  5KH7 A;  2K16 A;  4BBQ A;  3M62 A;  2PNX A;  4FK5 A;  3U5P A;  2Y1N A;  2F6J A;  4WZ3 B;  3M63 A;  4I7C A;  1MM2 A;  1E4U A;  2L75 A;  2VJE A;  3ZNI A;  5KH9 A;  4B7Y C;  5G0F A;  4CA1 A;  3VK6 A;  1WEV A;  1HYJ A;  4A0C D;  2Y43 A;  1F62 A;  5DIN A;  3ZVY A;  4IC2 A;  2MUM A;  2EA6 A;  3ASL A;  3RTR B;  3N9O A;  3SOU A;  5JG6 A;  3O35 A;  2G6Q A;  2MNY A;  2ECG A;  2F42 A;  2JMD A;  2YUR A;  2KWO A;  3C6W A;  2K1J A;  3RPG C;  2C2V S;  3PUR A;  3O33 A;  4A49 A;  5DKA A;  5B76 A;  4YBM A;  2YUC A;  4F52 B;  5C11 A;  1WEN A;  2ECJ A;  1WFK A;  2VPE A;  1N87 A;  4MSX A;  5B8D A;  2YHN A;  1VFY A;  2CT2 A;  2HDP A;  5TDR A;  1K2F A;  2C2L A;  2XB1 A;  4O64 A;  5H1T A;  4WZ2 A;  2VPB A;  4LJN A;  4ZQL A;  3ZYQ A;  1RMD A;  3HCU A;  4MVT A;  2YSJ A;  1XWH A;  1WEP A;  5H1U A;  2FSA A;  4PTB A;  1X4U A;  4A4C A;  2G45 A;  4C9Z A;  3O70 A;  3N9P A;  4LK9 A;  3DPL R;  2KIZ A;  2LXP C;  3LRQ A;  1Z6U A;  4LLB A;  1WIL A;  4I7B A;  5G05 B;  5B75 A;  4FIP A;  2LRI C;  4R7E A;  2KRE A;  5LKT A;  4AP4 A;  2KWJ A;  2RI7 A;  2MT5 A;  2VJE B;  3N9M A;  4R8P K;  2QIZ A;  3O7A A;  5D1L B;  2LGV A;  5D1K B;  3KQI A;  4ZUX U;  4P5O B;  5TDW A;  3N9N A;  2L5U A;  4L7X A;  2MD8 C;  1Z60 A;  4QF3 A;  3KV5 A;  5C13 A;  3LQJ A;  4YAX A;  3SOX A;  2ECI A;  4N4F A;  1JM7 A;  2EOD A;  2OXQ C;  2HYE D;  2KE1 A;  2MA6 A;  2KGG A;  2YQL A;  4W4U A;  5B79 A;  2KYU A;  3O37 A;  5LKZ A;  2AN6 A;  2LXH C;  2H0D A;  2QIC A;  5FEY A;  3ZPV E;  4FJC A;  3LQH A;  2F6N A;  1WEW A;  2LGL A;  1WIM A;  5B77 A;  3U5M A;  2LGG A;  4AUQ B;  2EGP A;  3HTK C;  3ZTG A;  2NAA A;  4GNE A;  4YC9 A;  3KNV A;  2YHO A;  2I50 A;  4WA6 A;  3T6R A;  2JMI A;  4S3O B;  1WES A;  3L1Z B;  2YSM A;  4YAT A;  2XEU A;  1CHC A;  3MHH A;  2M1R A;  2K17 A;  3DQV R;  3MHS A;  3IHP A;  4FO9 A;  4AYC A;  4V3L C;  2CKL A;  1ZBD B;  1MM3 A;  2M6M A;  4LKA A;  2LV9 A;  3PHD A;  2PUY A;  4YBT A;  4GNF A;  2MIQ A;  2KWN A;  5B78 A;  3L1X A;  2M3H A;  2E6R A;  2QJ0 A;  3I2D A;  1WEQ A;  3QZV A;  4YAB A;  2L43 A;  2LGK A;  3ZPV 1;  1FBV A;  1JM7 B;  2ZET C;  4S3O C;  4V3K C;  2D8S A;  3NG2 A;  3U5O A;  2VJF B;  2H0D B;  3EB5 A;  2KFT A;  4PPE A;  1BOR A;  5KH3 A;  3O34 A;  4X3G A;  4XI1 A;  3RPG B;  1X4J A;  3C5K A;  2ECW A;  4LAD B;  2LN0 A;  2VPD A;  2YU4 A;  2FUI A;  2VJF A;  4IC3 A;  2KR4 A;  1WEU A;  5J3X A;  1WEE A;  3HCS A;  2DX8 A;  1FP0 A;  3T7L A;  4QF2 A;  2VPG A;  5H9M A;  5EYA F;  3N9Q A;  1U6G B;  2KU3 A;  4BHW A;  5FER A;  1IYM A;  1LDJ B;  4YBS A;  3SOW A;  4ZDT A;  2YQM A;  3KV6 A;  2FUU A;  1X4I A;  1G25 A;  3N9L A;  1WEO A;  2L0B A;  1VD4 A;  4AYC B;  2KWK A;  2CKL B;  5TAB A;  4N3W A;  3FL2 A;  2JRJ A;  1WGM A;  4UP0 A;  1JOC A;  2YYR A;  4I7D A;  4GND A;  3SHB A;  4NN2 A;  5TRB A;  4TKP B;  5AIU A;  2RSD A;  5LKU A;  4R2Y A;  4UP5 A;  3PUQ A;  4AVX A;  2IDA A;  5TBN A;  3M99 A;  1T1H A;  4B86 C;  4GB0 A;  2CSY A;  5D1M B;  4YAD A;  1V87 A;  2BAY A;  2ECV A;  3EB6 A;  4WZ0 A;  1LDK C;  2K4D A;  2VP7 A;  2CSZ A;  2LQ6 A;  5I3L A;  2ECT A;  5FB1 A;  2VNF A;  5FB0 A;  2MNZ A;  4Q6F A;  2E6S A;  3GV4 A;  4UI9 B;  3U5N A;  4GNG A;  3ZVZ B;  5H1V A;  3V43 A;  1WE9 A;  4L58 A;  2YT5 A;  2UZG A; 
#chains in the Genus database with same CATH topology
 5AIT A;  2YRE A;  2KGI A;  3GL6 A;  1Z2Q A;  2ECN A;  3HCT A;  3LQI A;  5LCW B;  5G04 B;  2JMJ A;  3L11 A;  2Y1M A;  1HYI A;  2MA5 A;  1VYX A;  2YW8 A;  1DVP A;  2M85 A;  4A4B A;  2L80 A;  2G43 A;  3O36 A;  1WEM A;  2MD7 B;  5LKX A;  4CCG X;  3DWD A;  2JUN A;  3FAN A;  2LDR A;  2YVR A;  5KH7 A;  2K16 A;  4BBQ A;  2MKE A;  2PNX A;  3M62 A;  4FK5 A;  3U5P A;  3KDE C;  2Y1N A;  2F6J A;  4WZ3 B;  3M63 A;  2XOY A;  4I7C A;  1MM2 A;  4OGC A;  1E4U A;  2L75 A;  2VJE A;  1DCQ A;  3ZNI A;  5KH9 A;  4B7Y C;  5G0F A;  4CA1 A;  3VK6 A;  1WEV A;  1HYJ A;  4A0C D;  4QQ4 A;  2Y43 A;  1F62 A;  5DIN A;  3ZVY A;  4IC2 A;  2MUM A;  2EA6 A;  3ASL A;  3RTR B;  2LAU A;  3N9O A;  3SOU A;  5JG6 A;  3O35 A;  3LDY A;  2G6Q A;  2JM3 A;  2MNY A;  2ECG A;  2F42 A;  2JMD A;  2YUR A;  3SUB A;  2KWO A;  3C6W A;  2K1J A;  3RPG C;  2C2V S;  2CRW A;  3PUR A;  3FJU B;  3O33 A;  4A49 A;  5DKA A;  2D8U A;  5B76 A;  2XP0 A;  4YBM A;  2YUC A;  2EGM A;  4F52 B;  5C11 A;  1WEN A;  2ECJ A;  1WFK A;  2VPE A;  1N87 A;  4MSX A;  5SVY A;  5B8D A;  2YHN A;  1VFY A;  2CT2 A;  2HDP A;  3E2D A;  5TDR A;  4O62 A;  1K2F A;  2C2L A;  2XB1 A;  4O64 A;  5H1T A;  2FFW A;  3PLW A;  4WZ2 A;  2VPB A;  4LJN A;  4ZQL A;  3ZYQ A;  1RMD A;  3HCU A;  4MVT A;  2CRR A;  2IQJ A;  2YSJ A;  1XWH A;  1WEP A;  5H1U A;  2FSA A;  4PTB A;  1X4U A;  4A4C A;  2G45 A;  4C9Z A;  3O70 A;  3N9P A;  4LK9 A;  3DPL R;  2KIZ A;  4Z0O A;  2LXP C;  3LRQ A;  2M13 A;  1Z6U A;  4LLB A;  1WIL A;  4I7B A;  5G05 B;  5K3Q A;  5B75 A;  4FIP A;  2LRI C;  4R7E A;  2KRE A;  5LKT A;  4AP4 A;  3FM8 C;  2KWJ A;  2RI7 A;  2MT5 A;  2VJE B;  3N9M A;  4R8P K;  2QIZ A;  3Q1D A;  3O7A A;  5D1L B;  2LGV A;  5D1K B;  3KQI A;  4ZUX U;  2FD4 A;  4P5O B;  5TDW A;  3N9N A;  2L5U A;  4L7X A;  2MD8 C;  1Z60 A;  3M7K A;  4QF3 A;  3KV5 A;  5C13 A;  3LQJ A;  4YAX A;  3SOX A;  2ECI A;  4N4F A;  1JM7 A;  2EOD A;  2OXQ C;  2HYE D;  2KE1 A;  2MA6 A;  2KGG A;  2YQL A;  4W4U A;  5B79 A;  2KYU A;  3O37 A;  5LKZ A;  2AN6 A;  2KKY A;  2LXH C;  2H0D A;  2QIC A;  5FEY A;  2DJA A;  3ZPV E;  4FJC A;  3LQH A;  2E61 A;  2F6N A;  4F1P A;  1WEW A;  2LGL A;  3H7H A;  1WIM A;  3FEH A;  5B77 A;  2L7P A;  2CSV A;  2P57 A;  3U5M A;  2LGG A;  4AUQ B;  2EGP A;  3HTK C;  3ZTG A;  2NAA A;  4GNE A;  4H9D A;  4YC9 A;  3KNV A;  2XOC A;  2YHO A;  2I50 A;  4WA6 A;  3T6R A;  2JMI A;  2OWA A;  4S3O B;  1WES A;  3L1Z B;  2YSM A;  4YAT A;  2XEU A;  1CHC A;  3MHH A;  2M1R A;  2K17 A;  3DQV R;  5SVX A;  3MHS A;  3IHP A;  4FO9 A;  4AYC A;  2EXU A;  4V3L C;  2CKL A;  1ZBD B;  1MM3 A;  2M6M A;  4LKA A;  2LV9 A;  3PHD A;  2PUY A;  4YBT A;  4GNF A;  2MIQ A;  2KWN A;  5B78 A;  3L1X A;  2B0O E;  2M3H A;  2E6R A;  2QJ0 A;  3I2D A;  1WEQ A;  3QZV A;  4YAB A;  2L43 A;  2LGK A;  3ZPV 1;  1FBV A;  1JM7 B;  2KKX A;  2ZET C;  4S3O C;  4V3K C;  2D8S A;  2RR4 A;  4L58 A;  3NG2 A;  3U5O A;  2VJF B;  3JUE A;  3FAO A;  2H0D B;  3EB5 A;  2KFT A;  3DDT A;  4PPE A;  1BOR A;  5KH3 A;  3O34 A;  4X3G A;  4XI1 A;  2XOZ A;  3RPG B;  1X4J A;  3C5K A;  2ECW A;  4LAD B;  2LN0 A;  2VPD A;  2YU4 A;  2FUI A;  2VJF A;  4IC3 A;  2KR4 A;  1WEU A;  5J3X A;  1WEE A;  3LVR E;  3HCS A;  2DX8 A;  1FP0 A;  3T7L A;  3LJU X;  4QF2 A;  2VPG A;  5H9M A;  5EYA F;  3N9Q A;  1U6G B;  2KU3 A;  4BHW A;  5FER A;  1IYM A;  1LDJ B;  4YBS A;  3SOW A;  4ZDT A;  2YQM A;  3KV6 A;  2FUU A;  5SVI B;  1X4I A;  4OGE A;  1G25 A;  3N9L A;  1WEO A;  2L0B A;  1VD4 A;  4AYC B;  2KWK A;  2DSM A;  2CKL B;  5TAB A;  4N3W A;  3FL2 A;  2JRJ A;  1WGM A;  4UP0 A;  1JOC A;  2CON A;  2YYR A;  4I7D A;  4GND A;  4Z0R A;  3SHB A;  4NN2 A;  5TRB A;  5SVI A;  4TKP B;  5AIU A;  2RSD A;  5LKU A;  4R2Y A;  4UP5 A;  3PUQ A;  4AVX A;  2IDA A;  5TBN A;  3M99 A;  1T1H A;  4B86 C;  4GB0 A;  2CSY A;  5D1M B;  4YAD A;  1V87 A;  2BAY A;  2ECV A;  3MDB C;  3EB6 A;  3LVQ E;  3T9K A;  4WZ0 A;  1LDK C;  2K4D A;  2VP7 A;  2CSZ A;  2LQ6 A;  5I3L A;  2ECT A;  5FB1 A;  2VNF A;  3O47 A;  5FB0 A;  2MNZ A;  4Q6F A;  2E6S A;  3GV4 A;  4UI9 B;  3U5N A;  4GNG A;  3ZVZ B;  5H1V A;  3V43 A;  1WE9 A;  1MBM A;  2YT5 A;  2UZG A; 
#chains in the Genus database with same CATH homology
 5AIT A;  2YRE A;  2KGI A;  3GL6 A;  1Z2Q A;  2ECN A;  3HCT A;  3LQI A;  5LCW B;  5G04 B;  2JMJ A;  3L11 A;  2Y1M A;  1HYI A;  2MA5 A;  1VYX A;  2YW8 A;  1DVP A;  2M85 A;  4A4B A;  2L80 A;  2G43 A;  3O36 A;  1WEM A;  2MD7 B;  5LKX A;  4CCG X;  2LDR A;  5KH7 A;  2K16 A;  4BBQ A;  3M62 A;  2PNX A;  4FK5 A;  3U5P A;  2Y1N A;  2F6J A;  4WZ3 B;  3M63 A;  4I7C A;  1MM2 A;  1E4U A;  2L75 A;  2VJE A;  3ZNI A;  5KH9 A;  4B7Y C;  5G0F A;  4CA1 A;  3VK6 A;  1WEV A;  1HYJ A;  4A0C D;  2Y43 A;  1F62 A;  5DIN A;  3ZVY A;  4IC2 A;  2MUM A;  2EA6 A;  3ASL A;  3RTR B;  3N9O A;  3SOU A;  5JG6 A;  3O35 A;  2G6Q A;  2MNY A;  2ECG A;  2F42 A;  2JMD A;  2YUR A;  2KWO A;  3C6W A;  2K1J A;  3RPG C;  2C2V S;  3PUR A;  3O33 A;  4A49 A;  5DKA A;  5B76 A;  4YBM A;  2YUC A;  4F52 B;  5C11 A;  1WEN A;  2ECJ A;  1WFK A;  2VPE A;  1N87 A;  4MSX A;  5B8D A;  2YHN A;  1VFY A;  2CT2 A;  2HDP A;  5TDR A;  1K2F A;  2C2L A;  2XB1 A;  4O64 A;  5H1T A;  4WZ2 A;  2VPB A;  4LJN A;  4ZQL A;  3ZYQ A;  1RMD A;  3HCU A;  4MVT A;  2YSJ A;  1XWH A;  1WEP A;  5H1U A;  2FSA A;  4PTB A;  1X4U A;  4A4C A;  2G45 A;  4C9Z A;  3O70 A;  3N9P A;  4LK9 A;  3DPL R;  2KIZ A;  2LXP C;  3LRQ A;  1Z6U A;  4LLB A;  1WIL A;  4I7B A;  5G05 B;  5B75 A;  4FIP A;  2LRI C;  4R7E A;  2KRE A;  5LKT A;  4AP4 A;  2KWJ A;  2RI7 A;  2MT5 A;  2VJE B;  3N9M A;  4R8P K;  2QIZ A;  3O7A A;  5D1L B;  2LGV A;  5D1K B;  3KQI A;  4ZUX U;  4P5O B;  5TDW A;  3N9N A;  2L5U A;  4L7X A;  2MD8 C;  1Z60 A;  4QF3 A;  3KV5 A;  5C13 A;  3LQJ A;  4YAX A;  3SOX A;  2ECI A;  4N4F A;  1JM7 A;  2EOD A;  2OXQ C;  2HYE D;  2KE1 A;  2MA6 A;  2KGG A;  2YQL A;  4W4U A;  5B79 A;  2KYU A;  3O37 A;  5LKZ A;  2AN6 A;  2LXH C;  2H0D A;  2QIC A;  5FEY A;  3ZPV E;  4FJC A;  3LQH A;  2F6N A;  1WEW A;  2LGL A;  1WIM A;  5B77 A;  3U5M A;  2LGG A;  4AUQ B;  2EGP A;  3HTK C;  3ZTG A;  2NAA A;  4GNE A;  4YC9 A;  3KNV A;  2YHO A;  2I50 A;  4WA6 A;  3T6R A;  2JMI A;  4S3O B;  1WES A;  3L1Z B;  2YSM A;  4YAT A;  2XEU A;  1CHC A;  3MHH A;  2M1R A;  2K17 A;  3DQV R;  3MHS A;  3IHP A;  4FO9 A;  4AYC A;  4V3L C;  2CKL A;  1ZBD B;  1MM3 A;  2M6M A;  4LKA A;  2LV9 A;  3PHD A;  2PUY A;  4YBT A;  4GNF A;  2MIQ A;  2KWN A;  5B78 A;  3L1X A;  2M3H A;  2E6R A;  2QJ0 A;  3I2D A;  1WEQ A;  3QZV A;  4YAB A;  2L43 A;  2LGK A;  3ZPV 1;  1FBV A;  1JM7 B;  2ZET C;  4S3O C;  4V3K C;  2D8S A;  3NG2 A;  3U5O A;  2VJF B;  2H0D B;  3EB5 A;  2KFT A;  4PPE A;  1BOR A;  5KH3 A;  3O34 A;  4X3G A;  4XI1 A;  3RPG B;  1X4J A;  3C5K A;  2ECW A;  4LAD B;  2LN0 A;  2VPD A;  2YU4 A;  2FUI A;  2VJF A;  4IC3 A;  2KR4 A;  1WEU A;  5J3X A;  1WEE A;  3HCS A;  2DX8 A;  1FP0 A;  3T7L A;  4QF2 A;  2VPG A;  5H9M A;  5EYA F;  3N9Q A;  1U6G B;  2KU3 A;  4BHW A;  5FER A;  1IYM A;  1LDJ B;  4YBS A;  3SOW A;  4ZDT A;  2YQM A;  3KV6 A;  2FUU A;  1X4I A;  1G25 A;  3N9L A;  1WEO A;  2L0B A;  1VD4 A;  4AYC B;  2KWK A;  2CKL B;  5TAB A;  4N3W A;  3FL2 A;  2JRJ A;  1WGM A;  4UP0 A;  1JOC A;  2YYR A;  4I7D A;  4GND A;  3SHB A;  4NN2 A;  5TRB A;  4TKP B;  5AIU A;  2RSD A;  5LKU A;  4R2Y A;  4UP5 A;  3PUQ A;  4AVX A;  2IDA A;  5TBN A;  3M99 A;  1T1H A;  4B86 C;  4GB0 A;  2CSY A;  5D1M B;  4YAD A;  1V87 A;  2BAY A;  2ECV A;  3EB6 A;  4WZ0 A;  1LDK C;  2K4D A;  2VP7 A;  2CSZ A;  2LQ6 A;  5I3L A;  2ECT A;  5FB1 A;  2VNF A;  5FB0 A;  2MNZ A;  4Q6F A;  2E6S A;  3GV4 A;  4UI9 B;  3U5N A;  4GNG A;  3ZVZ B;  5H1V A;  3V43 A;  1WE9 A;  4L58 A;  2YT5 A;  2UZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...