1MM3A

Solution structure of the 2nd phd domain from mi2b with c-terminal loop replaced by corresponding loop from wstf
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
61
structure length
61
Chain Sequence
GPLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLRPALYEVPDGEWQCPRCTCPALKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mi2-beta(Chromodomain helicase-DNA-binding protein 4) and tr
publication title Engineering a Protein Scaffold from a PHD Finger
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/transcription
total genus 8
structure length 61
sequence length 61
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1mm3A00
4V3KC 3N9PA 2L80A 3HTKC 4UP5A 3FL2A 4QF3A 3T7LA 5H1TA 2F42A 4WZ3B 4L58A 2EODA 2YHOA 5LKTA 1MM2A 2IDAA 2L43A 3U5OA 3QZVA 3M99A 2YSJA 3ZTGA 5LKUA 5G04B 2KWOA 4I7BA 4S3OC 3N9MA 4LJNA 3KQIA 3EB6A 4IC2A 2HYED 5C13A 3ZVZB 2VP7A 4YADA 2MD8C 2JRJA 2LQ6A 2H0DB 4WA6A 2CSZA 2LGLA 2FUUA 3EB5A 1RMDA 4BHWA 4FO9A 2CSYA 2E6RA 1X4IA 1LDKC 3N9OA 1CHCA 1Z6UA 4CCGX 3U5MA 4A0CD 2VPGA 3SOUA 2D8SA 5KH9A 2MNZA 1X4UA 1ZBDB 1WENA 3SOXA 2F6JA 3PURA 4FJCA 2M3HA 2VJFB 5B76A 5TRBA 2PNXA 5D1KB 4WZ2A 1JM7A 3PHDA 4YABA 5B77A 2RI7A 1VFYA 2YT5A 2ECNA 2LGGA 5TDRA 2YSMA 4X3GA 4AUQB 1VD4A 1WEOA 4L7XA 3ZNIA 4TKPB 5LCWB 1WEMA 4C9ZA 2VPBA 2G6QA 3ZPV1 1JOCA 4R2YA 2KWJA 2VPEA 4R7EA 4LKAA 3O33A 4LADB 5G05B 4ZUXU 2ECIA 3KV5A 2Y1MA 4PTBA 2NAAA 1Z60A 2KE1A 5FEYA 5AITA 1HYIA 3L1ZB 2MNYA 2YW8A 2MA6A 3HCSA 2ECWA 2H0DA 4PPEA 2LXHC 2HDPA 1WEUA 2YQLA 1N87A 1G25A 4UI9B 2C2VS 2QICA 3U5NA 4B7YC 2C2LA 5D1MB 3V43A 5B75A 4B86C 2RSDA 4AVXA 5DKAA 4YBTA 1E4UA 2ECTA 2EA6A 3LQJA 3VK6A 4MVTA 3C5KA 2K4DA 1T1HA 2XEUA 4BBQA 4FIPA 2ECVA 3O37A 4Q6FA 4P5OB 2FSAA 3RPGB 2E6SA 3O7AA 2JMDA 1WILA 4A4BA 2MIQA 1XWHA 5FB1A 3ZVYA 2VJFA 3MHSA 3O36A 2KGGA 3T6RA 5EYAF 1BORA 2KREA 2OXQC 5H1VA 2CKLB 2YUCA 2LGKA 3O34A 3ZYQA 2KGIA 3MHHA 4ZDTA 1WGMA 4QF2A 3HCUA 3PUQA 2K17A 3SHBA 1F62A 1MM3A 5KH7A 4WZ0A 5TABA 5B79A 5I3LA 2EGPA 4GB0A 1FBVA 1WEQA 3RTRB 4A4CA 4CA1A 2M6MA 2VPDA 1WESA 1LDJB 3KNVA 1WIMA 2YYRA 2M1RA 1V87A 2ZETC 3ASLA 1WFKA 4V3LC 3ZPVE 1Z2QA 3LQIA 2VJEB 5FB0A 4YBSA 5H1UA 5TBNA 4N4FA 2AN6A 2K1JA 1K2FA 5H9MA 3KV6A 2L5UA 3RPGC 4O64A 2DX8A 2LN0A 2LGVA 1U6GB 2K16A 3DPLR 2G45A 4GNFA 4GNEA 2Y1NA 4YC9A 2YREA 1HYJA 4I7DA 4A49A 3U5PA 3SOWA 3I2DA 1FP0A 3M63A 4F52B 2KFTA 4GNDA 4YATA 1WEEA 4FK5A 1WEWA 3M62A 3LRQA 2M85A 5JG6A 5G0FA 3N9QA 4ZQLA 1X4JA 2BAYA 2LV9A 2L0BA 2YHNA 5DINA 5C11A 4YAXA 2F6NA 5AIUA 4XI1A 4MSXA 3O35A 2Y43A 2CKLA 2LXPC 4R8PK 2YU4A 1WEVA 2CT2A 4NN2A 4LLBA 2ECGA 2MUMA 5LKZA 5B8DA 2KYUA 2G43A 3L1XA 2KR4A 2QIZA 3IHPA 4IC3A 4I7CA 3C6WA 5KH3A 4AP4A 2KIZA 2YQMA 2JMIA 1VYXA 4LK9A 2LRIC 2KWNA 2KWKA 3N9NA 4UP0A 5FERA 2MA5A 2PUYA 2L75A 2VJEA 2I50A 2UZGA 4GNGA 1IYMA 3N9LA 2VNFA 4S3OB 4AYCA 3GV4A 2XB1A 1WEPA 2QJ0A 4YBMA 4N3WA 3HCTA 3O70A 3LQHA 5LKXA 2KU3A 2ECJA 5B78A 2JMJA 3L11A 2YURA 4AYCB 2LDRA 3NG2A 5D1LB 5J3XA 2MD7B 3DQVR 3GL6A 2FUIA 4W4UA 1WE9A 2MT5A 1JM7B 1DVPA 5TDWA
chains in the Genus database with same CATH superfamily
4V3KC 3N9PA 2L80A 3DDTA 3HTKC 5K3QA 4UP5A 3JUEA 3FL2A 4QF3A 3T7LA 5H1TA 2F42A 4WZ3B 4L58A 2EODA 2YHOA 5LKTA 1MM2A 2IDAA 2L43A 3U5OA 3QZVA 3M99A 2YSJA 3DWDA 3ZTGA 5LKUA 5G04B 2KWOA 2YVRA 4I7BA 4S3OC 3N9MA 4LJNA 3KQIA 3EB6A 4IC2A 2HYED 5C13A 3ZVZB 2VP7A 4YADA 2MD8C 2JRJA 2LQ6A 2H0DB 4WA6A 2CSZA 3O47A 2LGLA 2FUUA 3EB5A 1RMDA 4BHWA 3LDYA 4FO9A 5SVYA 2CSYA 2FFWA 2E6RA 1X4IA 1LDKC 3N9OA 1CHCA 1Z6UA 2EXUA 4CCGX 3U5MA 4A0CD 4Z0RA 2VPGA 3SOUA 3MDBC 4QQ4A 2D8SA 5KH9A 2MNZA 1X4UA 1ZBDB 3Q1DA 1WENA 3SOXA 2F6JA 3PURA 4FJCA 2M3HA 2VJFB 5B76A 5TRBA 2PNXA 5D1KB 3SUBA 4WZ2A 1JM7A 3PHDA 4YABA 5B77A 2RI7A 1VFYA 2CRWA 2YT5A 2ECNA 2LGGA 5TDRA 5SVXA 2YSMA 4X3GA 2JUNA 3FEHA 4AUQB 5SVIA 2EGMA 1VD4A 1WEOA 4L7XA 3ZNIA 4TKPB 2CSVA 3M7KA 5LCWB 1WEMA 4C9ZA 2VPBA 2G6QA 3ZPV1 1JOCA 4R2YA 2KWJA 2VPEA 4R7EA 4LKAA 3O33A 4LADB 5G05B 4ZUXU 2ECIA 3KV5A 2Y1MA 2LAUA 4PTBA 3LVRE 2NAAA 1Z60A 2KE1A 5FEYA 5AITA 1HYIA 5SVIB 3L1ZB 2IQJA 2MNYA 2YW8A 2MA6A 3HCSA 2ECWA 2H0DA 4PPEA 2CONA 2LXHC 2CRRA 1WEUA 2HDPA 2YQLA 1N87A 1G25A 4UI9B 2C2VS 2QICA 2OWAA 3U5NA 4Z0OA 4B7YC 2C2LA 5D1MB 3V43A 5B75A 4B86C 2RSDA 4AVXA 2P57A 5DKAA 4YBTA 1E4UA 2ECTA 2EA6A 3LQJA 3VK6A 4MVTA 3C5KA 2K4DA 1T1HA 2XEUA 3FAOA 4BBQA 2XOZA 4FIPA 2ECVA 3O37A 4Q6FA 4P5OB 2FSAA 3RPGB 2D8UA 2E6SA 3O7AA 2JMDA 1WILA 4A4BA 2MIQA 1XWHA 5FB1A 4F1PA 3ZVYA 2VJFA 3MHSA 3O36A 2KGGA 3T6RA 2B0OE 2M13A 5EYAF 1BORA 2KREA 2OXQC 2RR4A 5H1VA 2CKLB 2YUCA 2LGKA 4OGCA 3LJUX 3O34A 3ZYQA 3E2DA 2KGIA 3MHHA 2E61A 1WGMA 4ZDTA 4QF2A 3HCUA 3PUQA 2K17A 2XP0A 3SHBA 1F62A 2DJAA 1MM3A 5KH7A 4WZ0A 3LVQE 5TABA 2FD4A 5B79A 5I3LA 2EGPA 4GB0A 1FBVA 1WEQA 3RTRB 4A4CA 4CA1A 2M6MA 2VPDA 1WESA 1LDJB 3KNVA 1WIMA 2YYRA 2M1RA 1V87A 2ZETC 3ASLA 1WFKA 4V3LC 3ZPVE 1Z2QA 3LQIA 2VJEB 5FB0A 4YBSA 5H1UA 3KDEC 5TBNA 4N4FA 2AN6A 2K1JA 1K2FA 5H9MA 3KV6A 2L5UA 3RPGC 4O64A 2DX8A 2LN0A 2LGVA 1U6GB 2K16A 3DPLR 2G45A 3PLWA 2KKXA 4GNFA 4GNEA 2Y1NA 4YC9A 2YREA 1HYJA 4I7DA 4A49A 3U5PA 3SOWA 3I2DA 2JM3A 1FP0A 3T9KA 3M63A 4F52B 2KFTA 4GNDA 4YATA 1WEEA 4FK5A 1WEWA 3M62A 4H9DA 3LRQA 2M85A 5JG6A 1MBMA 5G0FA 3N9QA 4ZQLA 1X4JA 2BAYA 2LV9A 2L0BA 2YHNA 3FJUB 5DINA 5C11A 4YAXA 2F6NA 2MKEA 5AIUA 4XI1A 4MSXA 3O35A 2Y43A 2CKLA 2LXPC 4O62A 4R8PK 2YU4A 1WEVA 1DCQA 2CT2A 4NN2A 4LLBA 2ECGA 2MUMA 5LKZA 5B8DA 2KYUA 2G43A 2XOYA 3L1XA 2KR4A 2QIZA 3IHPA 4IC3A 4I7CA 3C6WA 5KH3A 2DSMA 4AP4A 2KIZA 2YQMA 2JMIA 1VYXA 4LK9A 2LRIC 2KWNA 2KWKA 4OGEA 2KKYA 3N9NA 4UP0A 5FERA 2MA5A 2PUYA 2L75A 3FM8C 2VJEA 2I50A 2UZGA 3FANA 4GNGA 1IYMA 3N9LA 2VNFA 4S3OB 4AYCA 3GV4A 2XB1A 1WEPA 2QJ0A 4YBMA 4N3WA 2XOCA 3HCTA 3O70A 3LQHA 5LKXA 2KU3A 2ECJA 5B78A 2JMJA 3L11A 2YURA 4AYCB 2LDRA 3H7HA 3NG2A 5D1LB 5J3XA 2MD7B 3DQVR 3GL6A 2FUIA 4W4UA 1WE9A 2MT5A 1JM7B 1DVPA 2L7PA 5TDWA
chains in the Genus database with same CATH topology
4V3KC 3N9PA 2L80A 3HTKC 4UP5A 3FL2A 4QF3A 3T7LA 5H1TA 2F42A 4WZ3B 4L58A 2EODA 2YHOA 5LKTA 1MM2A 2IDAA 2L43A 3U5OA 3QZVA 3M99A 2YSJA 3ZTGA 5LKUA 5G04B 2KWOA 4I7BA 4S3OC 3N9MA 4LJNA 3KQIA 3EB6A 4IC2A 2HYED 5C13A 3ZVZB 2VP7A 4YADA 2MD8C 2JRJA 2LQ6A 2H0DB 4WA6A 2CSZA 2LGLA 2FUUA 3EB5A 1RMDA 4BHWA 4FO9A 2CSYA 2E6RA 1X4IA 1LDKC 3N9OA 1CHCA 1Z6UA 4CCGX 3U5MA 4A0CD 2VPGA 3SOUA 2D8SA 5KH9A 2MNZA 1X4UA 1ZBDB 1WENA 3SOXA 2F6JA 3PURA 4FJCA 2M3HA 2VJFB 5B76A 5TRBA 2PNXA 5D1KB 4WZ2A 1JM7A 3PHDA 4YABA 5B77A 2RI7A 1VFYA 2YT5A 2ECNA 2LGGA 5TDRA 2YSMA 4X3GA 4AUQB 1VD4A 1WEOA 4L7XA 3ZNIA 4TKPB 5LCWB 1WEMA 4C9ZA 2VPBA 2G6QA 3ZPV1 1JOCA 4R2YA 2KWJA 2VPEA 4R7EA 4LKAA 3O33A 4LADB 5G05B 4ZUXU 2ECIA 3KV5A 2Y1MA 4PTBA 2NAAA 1Z60A 2KE1A 5FEYA 5AITA 1HYIA 3L1ZB 2MNYA 2YW8A 2MA6A 3HCSA 2ECWA 2H0DA 4PPEA 2LXHC 2HDPA 1WEUA 2YQLA 1N87A 1G25A 4UI9B 2C2VS 2QICA 3U5NA 4B7YC 2C2LA 5D1MB 3V43A 5B75A 4B86C 2RSDA 4AVXA 5DKAA 4YBTA 1E4UA 2ECTA 2EA6A 3LQJA 3VK6A 4MVTA 3C5KA 2K4DA 1T1HA 2XEUA 4BBQA 4FIPA 2ECVA 3O37A 4Q6FA 4P5OB 2FSAA 3RPGB 2E6SA 3O7AA 2JMDA 1WILA 4A4BA 2MIQA 1XWHA 5FB1A 3ZVYA 2VJFA 3MHSA 3O36A 2KGGA 3T6RA 5EYAF 1BORA 2KREA 2OXQC 5H1VA 2CKLB 2YUCA 2LGKA 3O34A 3ZYQA 2KGIA 3MHHA 4ZDTA 1WGMA 4QF2A 3HCUA 3PUQA 2K17A 3SHBA 1F62A 1MM3A 5KH7A 4WZ0A 5TABA 5B79A 5I3LA 2EGPA 4GB0A 1FBVA 1WEQA 3RTRB 4A4CA 4CA1A 2M6MA 2VPDA 1WESA 1LDJB 3KNVA 1WIMA 2YYRA 2M1RA 1V87A 2ZETC 3ASLA 1WFKA 4V3LC 3ZPVE 1Z2QA 3LQIA 2VJEB 5FB0A 4YBSA 5H1UA 5TBNA 4N4FA 2AN6A 2K1JA 1K2FA 5H9MA 3KV6A 2L5UA 3RPGC 4O64A 2DX8A 2LN0A 2LGVA 1U6GB 2K16A 3DPLR 2G45A 4GNFA 4GNEA 2Y1NA 4YC9A 2YREA 1HYJA 4I7DA 4A49A 3U5PA 3SOWA 3I2DA 1FP0A 3M63A 4F52B 2KFTA 4GNDA 4YATA 1WEEA 4FK5A 1WEWA 3M62A 3LRQA 2M85A 5JG6A 5G0FA 3N9QA 4ZQLA 1X4JA 2BAYA 2LV9A 2L0BA 2YHNA 5DINA 5C11A 4YAXA 2F6NA 5AIUA 4XI1A 4MSXA 3O35A 2Y43A 2CKLA 2LXPC 4R8PK 2YU4A 1WEVA 2CT2A 4NN2A 4LLBA 2ECGA 2MUMA 5LKZA 5B8DA 2KYUA 2G43A 3L1XA 2KR4A 2QIZA 3IHPA 4IC3A 4I7CA 3C6WA 5KH3A 4AP4A 2KIZA 2YQMA 2JMIA 1VYXA 4LK9A 2LRIC 2KWNA 2KWKA 3N9NA 4UP0A 5FERA 2MA5A 2PUYA 2L75A 2VJEA 2I50A 2UZGA 4GNGA 1IYMA 3N9LA 2VNFA 4S3OB 4AYCA 3GV4A 2XB1A 1WEPA 2QJ0A 4YBMA 4N3WA 3HCTA 3O70A 3LQHA 5LKXA 2KU3A 2ECJA 5B78A 2JMJA 3L11A 2YURA 4AYCB 2LDRA 3NG2A 5D1LB 5J3XA 2MD7B 3DQVR 3GL6A 2FUIA 4W4UA 1WE9A 2MT5A 1JM7B 1DVPA 5TDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V3K C;  3N9P A;  2L80 A;  3HTK C;  4UP5 A;  3FL2 A;  4QF3 A;  3T7L A;  5H1T A;  2F42 A;  4WZ3 B;  4L58 A;  2EOD A;  2YHO A;  5LKT A;  1MM2 A;  2IDA A;  2L43 A;  3U5O A;  3QZV A;  3M99 A;  2YSJ A;  3ZTG A;  5LKU A;  5G04 B;  2KWO A;  4I7B A;  4S3O C;  3N9M A;  4LJN A;  3KQI A;  3EB6 A;  4IC2 A;  2HYE D;  5C13 A;  3ZVZ B;  2VP7 A;  4YAD A;  2MD8 C;  2JRJ A;  2LQ6 A;  2H0D B;  4WA6 A;  2CSZ A;  2LGL A;  2FUU A;  3EB5 A;  1RMD A;  4BHW A;  4FO9 A;  2CSY A;  2E6R A;  1X4I A;  1LDK C;  3N9O A;  1CHC A;  1Z6U A;  4CCG X;  3U5M A;  4A0C D;  2VPG A;  3SOU A;  2D8S A;  5KH9 A;  2MNZ A;  1X4U A;  1ZBD B;  1WEN A;  3SOX A;  2F6J A;  3PUR A;  4FJC A;  2M3H A;  2VJF B;  5B76 A;  5TRB A;  2PNX A;  5D1K B;  4WZ2 A;  1JM7 A;  3PHD A;  4YAB A;  5B77 A;  2RI7 A;  1VFY A;  2YT5 A;  2ECN A;  2LGG A;  5TDR A;  2YSM A;  4X3G A;  4AUQ B;  1VD4 A;  1WEO A;  4L7X A;  3ZNI A;  4TKP B;  5LCW B;  1WEM A;  4C9Z A;  2VPB A;  2G6Q A;  3ZPV 1;  1JOC A;  4R2Y A;  2KWJ A;  2VPE A;  4R7E A;  4LKA A;  3O33 A;  4LAD B;  5G05 B;  4ZUX U;  2ECI A;  3KV5 A;  2Y1M A;  4PTB A;  2NAA A;  1Z60 A;  2KE1 A;  5FEY A;  5AIT A;  1HYI A;  3L1Z B;  2MNY A;  2YW8 A;  2MA6 A;  3HCS A;  2ECW A;  2H0D A;  4PPE A;  2LXH C;  2HDP A;  1WEU A;  2YQL A;  1N87 A;  1G25 A;  4UI9 B;  2C2V S;  2QIC A;  3U5N A;  4B7Y C;  2C2L A;  5D1M B;  3V43 A;  5B75 A;  4B86 C;  2RSD A;  4AVX A;  5DKA A;  4YBT A;  1E4U A;  2ECT A;  2EA6 A;  3LQJ A;  3VK6 A;  4MVT A;  3C5K A;  2K4D A;  1T1H A;  2XEU A;  4BBQ A;  4FIP A;  2ECV A;  3O37 A;  4Q6F A;  4P5O B;  2FSA A;  3RPG B;  2E6S A;  3O7A A;  2JMD A;  1WIL A;  4A4B A;  2MIQ A;  1XWH A;  5FB1 A;  3ZVY A;  2VJF A;  3MHS A;  3O36 A;  2KGG A;  3T6R A;  5EYA F;  1BOR A;  2KRE A;  2OXQ C;  5H1V A;  2CKL B;  2YUC A;  2LGK A;  3O34 A;  3ZYQ A;  2KGI A;  3MHH A;  4ZDT A;  1WGM A;  4QF2 A;  3HCU A;  3PUQ A;  2K17 A;  3SHB A;  1F62 A;  1MM3 A;  5KH7 A;  4WZ0 A;  5TAB A;  5B79 A;  5I3L A;  2EGP A;  4GB0 A;  1FBV A;  1WEQ A;  3RTR B;  4A4C A;  4CA1 A;  2M6M A;  2VPD A;  1WES A;  1LDJ B;  3KNV A;  1WIM A;  2YYR A;  2M1R A;  1V87 A;  2ZET C;  3ASL A;  1WFK A;  4V3L C;  3ZPV E;  1Z2Q A;  3LQI A;  2VJE B;  5FB0 A;  4YBS A;  5H1U A;  5TBN A;  4N4F A;  2AN6 A;  2K1J A;  1K2F A;  5H9M A;  3KV6 A;  2L5U A;  3RPG C;  4O64 A;  2DX8 A;  2LN0 A;  2LGV A;  1U6G B;  2K16 A;  3DPL R;  2G45 A;  4GNF A;  4GNE A;  2Y1N A;  4YC9 A;  2YRE A;  1HYJ A;  4I7D A;  4A49 A;  3U5P A;  3SOW A;  3I2D A;  1FP0 A;  3M63 A;  4F52 B;  2KFT A;  4GND A;  4YAT A;  1WEE A;  4FK5 A;  1WEW A;  3M62 A;  3LRQ A;  2M85 A;  5JG6 A;  5G0F A;  3N9Q A;  4ZQL A;  1X4J A;  2BAY A;  2LV9 A;  2L0B A;  2YHN A;  5DIN A;  5C11 A;  4YAX A;  2F6N A;  5AIU A;  4XI1 A;  4MSX A;  3O35 A;  2Y43 A;  2CKL A;  2LXP C;  4R8P K;  2YU4 A;  1WEV A;  2CT2 A;  4NN2 A;  4LLB A;  2ECG A;  2MUM A;  5LKZ A;  5B8D A;  2KYU A;  2G43 A;  3L1X A;  2KR4 A;  2QIZ A;  3IHP A;  4IC3 A;  4I7C A;  3C6W A;  5KH3 A;  4AP4 A;  2KIZ A;  2YQM A;  2JMI A;  1VYX A;  4LK9 A;  2LRI C;  2KWN A;  2KWK A;  3N9N A;  4UP0 A;  5FER A;  2MA5 A;  2PUY A;  2L75 A;  2VJE A;  2I50 A;  2UZG A;  4GNG A;  1IYM A;  3N9L A;  2VNF A;  4S3O B;  4AYC A;  3GV4 A;  2XB1 A;  1WEP A;  2QJ0 A;  4YBM A;  4N3W A;  3HCT A;  3O70 A;  3LQH A;  5LKX A;  2KU3 A;  2ECJ A;  5B78 A;  2JMJ A;  3L11 A;  2YUR A;  4AYC B;  2LDR A;  3NG2 A;  5D1L B;  5J3X A;  2MD7 B;  3DQV R;  3GL6 A;  2FUI A;  4W4U A;  1WE9 A;  2MT5 A;  1JM7 B;  1DVP A;  5TDW A; 
#chains in the Genus database with same CATH topology
 4V3K C;  3N9P A;  2L80 A;  3DDT A;  3HTK C;  5K3Q A;  4UP5 A;  3JUE A;  3FL2 A;  4QF3 A;  3T7L A;  5H1T A;  2F42 A;  4WZ3 B;  4L58 A;  2EOD A;  2YHO A;  5LKT A;  1MM2 A;  2IDA A;  2L43 A;  3U5O A;  3QZV A;  3M99 A;  2YSJ A;  3DWD A;  3ZTG A;  5LKU A;  5G04 B;  2KWO A;  2YVR A;  4I7B A;  4S3O C;  3N9M A;  4LJN A;  3KQI A;  3EB6 A;  4IC2 A;  2HYE D;  5C13 A;  3ZVZ B;  2VP7 A;  4YAD A;  2MD8 C;  2JRJ A;  2LQ6 A;  2H0D B;  4WA6 A;  2CSZ A;  3O47 A;  2LGL A;  2FUU A;  3EB5 A;  1RMD A;  4BHW A;  3LDY A;  4FO9 A;  5SVY A;  2CSY A;  2FFW A;  2E6R A;  1X4I A;  1LDK C;  3N9O A;  1CHC A;  1Z6U A;  2EXU A;  4CCG X;  3U5M A;  4A0C D;  4Z0R A;  2VPG A;  3SOU A;  3MDB C;  4QQ4 A;  2D8S A;  5KH9 A;  2MNZ A;  1X4U A;  1ZBD B;  3Q1D A;  1WEN A;  3SOX A;  2F6J A;  3PUR A;  4FJC A;  2M3H A;  2VJF B;  5B76 A;  5TRB A;  2PNX A;  5D1K B;  3SUB A;  4WZ2 A;  1JM7 A;  3PHD A;  4YAB A;  5B77 A;  2RI7 A;  1VFY A;  2CRW A;  2YT5 A;  2ECN A;  2LGG A;  5TDR A;  5SVX A;  2YSM A;  4X3G A;  2JUN A;  3FEH A;  4AUQ B;  5SVI A;  2EGM A;  1VD4 A;  1WEO A;  4L7X A;  3ZNI A;  4TKP B;  2CSV A;  3M7K A;  5LCW B;  1WEM A;  4C9Z A;  2VPB A;  2G6Q A;  3ZPV 1;  1JOC A;  4R2Y A;  2KWJ A;  2VPE A;  4R7E A;  4LKA A;  3O33 A;  4LAD B;  5G05 B;  4ZUX U;  2ECI A;  3KV5 A;  2Y1M A;  2LAU A;  4PTB A;  3LVR E;  2NAA A;  1Z60 A;  2KE1 A;  5FEY A;  5AIT A;  1HYI A;  5SVI B;  3L1Z B;  2IQJ A;  2MNY A;  2YW8 A;  2MA6 A;  3HCS A;  2ECW A;  2H0D A;  4PPE A;  2CON A;  2LXH C;  2CRR A;  1WEU A;  2HDP A;  2YQL A;  1N87 A;  1G25 A;  4UI9 B;  2C2V S;  2QIC A;  2OWA A;  3U5N A;  4Z0O A;  4B7Y C;  2C2L A;  5D1M B;  3V43 A;  5B75 A;  4B86 C;  2RSD A;  4AVX A;  2P57 A;  5DKA A;  4YBT A;  1E4U A;  2ECT A;  2EA6 A;  3LQJ A;  3VK6 A;  4MVT A;  3C5K A;  2K4D A;  1T1H A;  2XEU A;  3FAO A;  4BBQ A;  2XOZ A;  4FIP A;  2ECV A;  3O37 A;  4Q6F A;  4P5O B;  2FSA A;  3RPG B;  2D8U A;  2E6S A;  3O7A A;  2JMD A;  1WIL A;  4A4B A;  2MIQ A;  1XWH A;  5FB1 A;  4F1P A;  3ZVY A;  2VJF A;  3MHS A;  3O36 A;  2KGG A;  3T6R A;  2B0O E;  2M13 A;  5EYA F;  1BOR A;  2KRE A;  2OXQ C;  2RR4 A;  5H1V A;  2CKL B;  2YUC A;  2LGK A;  4OGC A;  3LJU X;  3O34 A;  3ZYQ A;  3E2D A;  2KGI A;  3MHH A;  2E61 A;  1WGM A;  4ZDT A;  4QF2 A;  3HCU A;  3PUQ A;  2K17 A;  2XP0 A;  3SHB A;  1F62 A;  2DJA A;  1MM3 A;  5KH7 A;  4WZ0 A;  3LVQ E;  5TAB A;  2FD4 A;  5B79 A;  5I3L A;  2EGP A;  4GB0 A;  1FBV A;  1WEQ A;  3RTR B;  4A4C A;  4CA1 A;  2M6M A;  2VPD A;  1WES A;  1LDJ B;  3KNV A;  1WIM A;  2YYR A;  2M1R A;  1V87 A;  2ZET C;  3ASL A;  1WFK A;  4V3L C;  3ZPV E;  1Z2Q A;  3LQI A;  2VJE B;  5FB0 A;  4YBS A;  5H1U A;  3KDE C;  5TBN A;  4N4F A;  2AN6 A;  2K1J A;  1K2F A;  5H9M A;  3KV6 A;  2L5U A;  3RPG C;  4O64 A;  2DX8 A;  2LN0 A;  2LGV A;  1U6G B;  2K16 A;  3DPL R;  2G45 A;  3PLW A;  2KKX A;  4GNF A;  4GNE A;  2Y1N A;  4YC9 A;  2YRE A;  1HYJ A;  4I7D A;  4A49 A;  3U5P A;  3SOW A;  3I2D A;  2JM3 A;  1FP0 A;  3T9K A;  3M63 A;  4F52 B;  2KFT A;  4GND A;  4YAT A;  1WEE A;  4FK5 A;  1WEW A;  3M62 A;  4H9D A;  3LRQ A;  2M85 A;  5JG6 A;  1MBM A;  5G0F A;  3N9Q A;  4ZQL A;  1X4J A;  2BAY A;  2LV9 A;  2L0B A;  2YHN A;  3FJU B;  5DIN A;  5C11 A;  4YAX A;  2F6N A;  2MKE A;  5AIU A;  4XI1 A;  4MSX A;  3O35 A;  2Y43 A;  2CKL A;  2LXP C;  4O62 A;  4R8P K;  2YU4 A;  1WEV A;  1DCQ A;  2CT2 A;  4NN2 A;  4LLB A;  2ECG A;  2MUM A;  5LKZ A;  5B8D A;  2KYU A;  2G43 A;  2XOY A;  3L1X A;  2KR4 A;  2QIZ A;  3IHP A;  4IC3 A;  4I7C A;  3C6W A;  5KH3 A;  2DSM A;  4AP4 A;  2KIZ A;  2YQM A;  2JMI A;  1VYX A;  4LK9 A;  2LRI C;  2KWN A;  2KWK A;  4OGE A;  2KKY A;  3N9N A;  4UP0 A;  5FER A;  2MA5 A;  2PUY A;  2L75 A;  3FM8 C;  2VJE A;  2I50 A;  2UZG A;  3FAN A;  4GNG A;  1IYM A;  3N9L A;  2VNF A;  4S3O B;  4AYC A;  3GV4 A;  2XB1 A;  1WEP A;  2QJ0 A;  4YBM A;  4N3W A;  2XOC A;  3HCT A;  3O70 A;  3LQH A;  5LKX A;  2KU3 A;  2ECJ A;  5B78 A;  2JMJ A;  3L11 A;  2YUR A;  4AYC B;  2LDR A;  3H7H A;  3NG2 A;  5D1L B;  5J3X A;  2MD7 B;  3DQV R;  3GL6 A;  2FUI A;  4W4U A;  1WE9 A;  2MT5 A;  1JM7 B;  1DVP A;  2L7P A;  5TDW A; 
#chains in the Genus database with same CATH homology
 4V3K C;  3N9P A;  2L80 A;  3HTK C;  4UP5 A;  3FL2 A;  4QF3 A;  3T7L A;  5H1T A;  2F42 A;  4WZ3 B;  4L58 A;  2EOD A;  2YHO A;  5LKT A;  1MM2 A;  2IDA A;  2L43 A;  3U5O A;  3QZV A;  3M99 A;  2YSJ A;  3ZTG A;  5LKU A;  5G04 B;  2KWO A;  4I7B A;  4S3O C;  3N9M A;  4LJN A;  3KQI A;  3EB6 A;  4IC2 A;  2HYE D;  5C13 A;  3ZVZ B;  2VP7 A;  4YAD A;  2MD8 C;  2JRJ A;  2LQ6 A;  2H0D B;  4WA6 A;  2CSZ A;  2LGL A;  2FUU A;  3EB5 A;  1RMD A;  4BHW A;  4FO9 A;  2CSY A;  2E6R A;  1X4I A;  1LDK C;  3N9O A;  1CHC A;  1Z6U A;  4CCG X;  3U5M A;  4A0C D;  2VPG A;  3SOU A;  2D8S A;  5KH9 A;  2MNZ A;  1X4U A;  1ZBD B;  1WEN A;  3SOX A;  2F6J A;  3PUR A;  4FJC A;  2M3H A;  2VJF B;  5B76 A;  5TRB A;  2PNX A;  5D1K B;  4WZ2 A;  1JM7 A;  3PHD A;  4YAB A;  5B77 A;  2RI7 A;  1VFY A;  2YT5 A;  2ECN A;  2LGG A;  5TDR A;  2YSM A;  4X3G A;  4AUQ B;  1VD4 A;  1WEO A;  4L7X A;  3ZNI A;  4TKP B;  5LCW B;  1WEM A;  4C9Z A;  2VPB A;  2G6Q A;  3ZPV 1;  1JOC A;  4R2Y A;  2KWJ A;  2VPE A;  4R7E A;  4LKA A;  3O33 A;  4LAD B;  5G05 B;  4ZUX U;  2ECI A;  3KV5 A;  2Y1M A;  4PTB A;  2NAA A;  1Z60 A;  2KE1 A;  5FEY A;  5AIT A;  1HYI A;  3L1Z B;  2MNY A;  2YW8 A;  2MA6 A;  3HCS A;  2ECW A;  2H0D A;  4PPE A;  2LXH C;  2HDP A;  1WEU A;  2YQL A;  1N87 A;  1G25 A;  4UI9 B;  2C2V S;  2QIC A;  3U5N A;  4B7Y C;  2C2L A;  5D1M B;  3V43 A;  5B75 A;  4B86 C;  2RSD A;  4AVX A;  5DKA A;  4YBT A;  1E4U A;  2ECT A;  2EA6 A;  3LQJ A;  3VK6 A;  4MVT A;  3C5K A;  2K4D A;  1T1H A;  2XEU A;  4BBQ A;  4FIP A;  2ECV A;  3O37 A;  4Q6F A;  4P5O B;  2FSA A;  3RPG B;  2E6S A;  3O7A A;  2JMD A;  1WIL A;  4A4B A;  2MIQ A;  1XWH A;  5FB1 A;  3ZVY A;  2VJF A;  3MHS A;  3O36 A;  2KGG A;  3T6R A;  5EYA F;  1BOR A;  2KRE A;  2OXQ C;  5H1V A;  2CKL B;  2YUC A;  2LGK A;  3O34 A;  3ZYQ A;  2KGI A;  3MHH A;  4ZDT A;  1WGM A;  4QF2 A;  3HCU A;  3PUQ A;  2K17 A;  3SHB A;  1F62 A;  1MM3 A;  5KH7 A;  4WZ0 A;  5TAB A;  5B79 A;  5I3L A;  2EGP A;  4GB0 A;  1FBV A;  1WEQ A;  3RTR B;  4A4C A;  4CA1 A;  2M6M A;  2VPD A;  1WES A;  1LDJ B;  3KNV A;  1WIM A;  2YYR A;  2M1R A;  1V87 A;  2ZET C;  3ASL A;  1WFK A;  4V3L C;  3ZPV E;  1Z2Q A;  3LQI A;  2VJE B;  5FB0 A;  4YBS A;  5H1U A;  5TBN A;  4N4F A;  2AN6 A;  2K1J A;  1K2F A;  5H9M A;  3KV6 A;  2L5U A;  3RPG C;  4O64 A;  2DX8 A;  2LN0 A;  2LGV A;  1U6G B;  2K16 A;  3DPL R;  2G45 A;  4GNF A;  4GNE A;  2Y1N A;  4YC9 A;  2YRE A;  1HYJ A;  4I7D A;  4A49 A;  3U5P A;  3SOW A;  3I2D A;  1FP0 A;  3M63 A;  4F52 B;  2KFT A;  4GND A;  4YAT A;  1WEE A;  4FK5 A;  1WEW A;  3M62 A;  3LRQ A;  2M85 A;  5JG6 A;  5G0F A;  3N9Q A;  4ZQL A;  1X4J A;  2BAY A;  2LV9 A;  2L0B A;  2YHN A;  5DIN A;  5C11 A;  4YAX A;  2F6N A;  5AIU A;  4XI1 A;  4MSX A;  3O35 A;  2Y43 A;  2CKL A;  2LXP C;  4R8P K;  2YU4 A;  1WEV A;  2CT2 A;  4NN2 A;  4LLB A;  2ECG A;  2MUM A;  5LKZ A;  5B8D A;  2KYU A;  2G43 A;  3L1X A;  2KR4 A;  2QIZ A;  3IHP A;  4IC3 A;  4I7C A;  3C6W A;  5KH3 A;  4AP4 A;  2KIZ A;  2YQM A;  2JMI A;  1VYX A;  4LK9 A;  2LRI C;  2KWN A;  2KWK A;  3N9N A;  4UP0 A;  5FER A;  2MA5 A;  2PUY A;  2L75 A;  2VJE A;  2I50 A;  2UZG A;  4GNG A;  1IYM A;  3N9L A;  2VNF A;  4S3O B;  4AYC A;  3GV4 A;  2XB1 A;  1WEP A;  2QJ0 A;  4YBM A;  4N3W A;  3HCT A;  3O70 A;  3LQH A;  5LKX A;  2KU3 A;  2ECJ A;  5B78 A;  2JMJ A;  3L11 A;  2YUR A;  4AYC B;  2LDR A;  3NG2 A;  5D1L B;  5J3X A;  2MD7 B;  3DQV R;  3GL6 A;  2FUI A;  4W4U A;  1WE9 A;  2MT5 A;  1JM7 B;  1DVP A;  5TDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...