1MM3A

Solution structure of the 2nd phd domain from mi2b with c-terminal loop replaced by corresponding loop from wstf
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
61
structure length
61
Chain Sequence
GPLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLRPALYEVPDGEWQCPRCTCPALKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering a Protein Scaffold from a PHD Finger
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/transcription
molecule keywords Mi2-beta(Chromodomain helicase-DNA-binding protein 4) and tr
total genus 8
structure length 61
sequence length 61
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1mm3A00
1CHCA 3ZTGA 5G0FA 2YREA 3KNVA 1E4UA 5G05B 4IC3A 4LADB 4YBMA 2ECGA 5AIUA 3L1XA 4YBSA 3SHBA 3O36A 4IC2A 4A49A 4B7YC 2VJFB 2ECVA 1VFYA 4YADA 4X3GA 1BORA 3ZYQA 2QJ0A 3MHHA 2RSDA 2LXPC 2EGPA 3GL6A 2KYUA 2VJEA 1WEQA 1WEMA 1WFKA 1WIMA 2ECNA 2PUYA 3LQHA 2YYRA 5B75A 2LV9A 5B78A 2NAAA 2JMDA 2VPEA 4QF2A 1F62A 2MA5A 2E6RA 2XEUA 4R2YA 3DQVR 2VNFA 1MM3A 2ECTA 3HCTA 2QICA 4O64A 1JM7B 4ZQLA 1MM2A 4B86C 3ZVZB 2I50A 2KWKA 3U5MA 4YBTA 2Y43A 5B77A 1WEEA 4S3OC 4WZ2A 4MVTA 1U6GB 2QIZA 5KH3A 5TRBA 2YQLA 5B8DA 4A4CA 5FB0A 1K2FA 4WZ0A 3T6RA 1G25A 1WEUA 2YSJA 2E6SA 2JRJA 3GV4A 4FJCA 1LDKC 4UI9B 5D1MB 2F42A 2HYED 4N4FA 4F52B 2ZETC 1HYIA 4GNFA 2D8SA 4S3OB 1Z2QA 1VD4A 4QF3A 4Q6FA 2LGGA 4UP0A 2G45A 2KWNA 4I7DA 3ZNIA 2JMIA 4GNGA 4BHWA 2F6NA 3U5PA 2FUIA 5D1LB 5LKZA 5LKUA 2M85A 4FO9A 4AYCB 1WGMA 2YSMA 1IYMA 1WILA 2KGGA 1WEVA 3ZPVE 2KU3A 3O33A 5DINA 2L80A 1XWHA 2AN6A 5H1VA 2Y1NA 2LGVA 5G04B 2M1RA 2K17A 3DPLR 3LRQA 2VPBA 2K4DA 4BBQA 2IDAA 1WEOA 2Y1MA 5AITA 2KWJA 2YU4A 1X4IA 2LGKA 2ECJA 2YHOA 5KH7A 2C2VS 5FERA 2YW8A 4NN2A 1HYJA 5TABA 4UP5A 1JOCA 3HTKC 1JM7A 2LRIC 3RTRB 2YT5A 1X4UA 4CCGX 2LXHC 2KWOA 3LQIA 2KFTA 3C5KA 4WA6A 5LCWB 3IHPA 2CKLA 2JMJA 5EYAF 1T1HA 2G43A 4YAXA 5TDRA 4R8PK 2L43A 5LKTA 1FP0A 1Z60A 2F6JA 3PURA 3MHSA 3LQJA 2H0DA 3L11A 5H9MA 5H1TA 3U5OA 4AP4A 5B76A 2RI7A 4LJNA 2FSAA 4WZ3B 1WEPA 3I2DA 4YABA 3PHDA 1N87A 5TDWA 2K1JA 5JG6A 4I7BA 4PTBA 3RPGB 2EA6A 4FK5A 3N9MA 2YURA 2KIZA 1FBVA 2EODA 3ZVYA 3PUQA 2M6MA 2FUUA 2ECWA 1WE9A 2YQMA 3QZVA 4V3LC 4ZDTA 3SOUA 4C9ZA 2KREA 1VYXA 3EB5A 3HCSA 3ASLA 2VJFA 5C13A 3O37A 3L1ZB 3N9QA 2MNYA 2XB1A 4AYCA 3KV6A 1V87A 2CSZA 2CT2A 4V3KC 3KV5A 3O35A 4N3WA 2MT5A 2DX8A 3KQIA 2YUCA 2MA6A 3VK6A 5J3XA 4CA1A 2ECIA 3ZPV1 5KH9A 3HCUA 4LLBA 3N9LA 2YHNA 3RPGC 4L7XA 1RMDA 4W4UA 2VPGA 5LKXA 2C2LA 2L0BA 4GB0A 1LDJB 4GNEA 1WESA 1Z6UA 4YC9A 1ZBDB 3U5NA 4A4BA 2VPDA 2KR4A 2HDPA 2MNZA 3EB6A 4P5OB 2LQ6A 3M62A 4GNDA 2LGLA 3NG2A 3O70A 3C6WA 5B79A 4XI1A 2UZGA 2L5UA 5I3LA 4PPEA 2M3HA 3N9PA 4LK9A 2MIQA 4AUQB 4TKPB 4YATA 4I7CA 4LKAA 5D1KB 5H1UA 2K16A 2G6QA 3T7LA 5FB1A 2H0DB 4L58A 4ZUXU 3FL2A 3O34A 2KGIA 3M99A 2OXQC 5TBNA 1X4JA 2MD7B 5FEYA 3SOXA 2BAYA 2CKLB 2L75A 4FIPA 4A0CD 3SOWA 3N9OA 2PNXA 3V43A 5DKAA 4MSXA 2VJEB 1WEWA 2MUMA 4R7EA 3O7AA 2LDRA 2KE1A 3M63A 2VP7A 1WENA 2LN0A 2CSYA 1DVPA 4AVXA 5C11A 2MD8C 3N9NA
chains in the Genus database with same CATH superfamily
1CHCA 3ZTGA 5G0FA 2YREA 3KNVA 2FFWA 1E4UA 5G05B 2LAUA 4IC3A 4LADB 4YBMA 2ECGA 5AIUA 3L1XA 4YBSA 3FJUB 3SHBA 3O36A 4IC2A 4A49A 4B7YC 2VJFB 2ECVA 1VFYA 4YADA 2MKEA 1BORA 4X3GA 3ZYQA 2QJ0A 3MHHA 2RSDA 2LXPC 2EGPA 3GL6A 2KYUA 2VJEA 1WEQA 1WEMA 1WFKA 1WIMA 3DDTA 2ECNA 2PUYA 3LQHA 2YYRA 5B75A 5SVIA 2LV9A 5B78A 3FEHA 2NAAA 2JMDA 2VPEA 4QF2A 1F62A 2MA5A 2E6RA 2XEUA 5K3QA 4R2YA 3DQVR 2VNFA 1MM3A 2ECTA 3HCTA 2QICA 4O64A 1JM7B 4ZQLA 1MM2A 4B86C 3ZVZB 2CONA 2I50A 2KWKA 3U5MA 2DJAA 4YBTA 2Y43A 2FD4A 5B77A 1WEEA 4S3OC 4WZ2A 4MVTA 2JUNA 2EGMA 1U6GB 2QIZA 3LDYA 5KH3A 5TRBA 2YQLA 5B8DA 4A4CA 5FB0A 1K2FA 4WZ0A 3T6RA 3SUBA 1G25A 1WEUA 2YSJA 2M13A 2E6SA 2JRJA 3GV4A 4FJCA 1LDKC 4UI9B 5D1MB 2F42A 2HYED 2IQJA 4N4FA 4F52B 2ZETC 1HYIA 4GNFA 4Z0OA 2D8SA 4S3OB 1Z2QA 1VD4A 1MBMA 4QF3A 4Q6FA 2LGGA 4UP0A 2G45A 3FANA 2KWNA 4I7DA 3ZNIA 2JMIA 4GNGA 4BHWA 2F6NA 3U5PA 2FUIA 3LJUX 5D1LB 5LKZA 5LKUA 2M85A 4FO9A 4AYCB 1WGMA 2YSMA 1IYMA 1WILA 2KKYA 2KGGA 1WEVA 3ZPVE 2KU3A 2B0OE 3O33A 3FM8C 5DINA 2L80A 2XOYA 1XWHA 2AN6A 5H1VA 2Y1NA 2XP0A 2LGVA 5G04B 2M1RA 2K17A 3DPLR 3LRQA 2VPBA 3JUEA 2K4DA 4BBQA 2IDAA 1WEOA 2Y1MA 2L7PA 5AITA 2KWJA 2YU4A 2XOCA 1X4IA 2LGKA 2ECJA 2YHOA 5KH7A 2C2VS 5FERA 2YW8A 4NN2A 1HYJA 5TABA 4UP5A 1JOCA 3HTKC 1DCQA 5SVYA 1JM7A 2LRIC 3RTRB 2YT5A 1X4UA 2CRRA 4CCGX 2LXHC 2DSMA 2KWOA 3LQIA 2KFTA 3C5KA 3M7KA 4WA6A 5LCWB 3IHPA 2CKLA 2JMJA 4OGEA 5EYAF 1T1HA 2G43A 4YAXA 3PLWA 3DWDA 5TDRA 4R8PK 2L43A 5LKTA 1FP0A 1Z60A 2F6JA 3PURA 3MHSA 3LQJA 3E2DA 3MDBC 2H0DA 3L11A 5H9MA 5H1TA 4F1PA 3U5OA 3KDEC 3T9KA 4AP4A 5B76A 5SVIB 2RI7A 4LJNA 4Z0RA 2FSAA 1WEPA 4WZ3B 3I2DA 4YABA 3PHDA 1N87A 5TDWA 2K1JA 5JG6A 4I7BA 4PTBA 3O47A 3RPGB 2EA6A 4FK5A 2CSVA 3N9MA 2YURA 2KIZA 1FBVA 2EODA 3ZVYA 3PUQA 2M6MA 2FUUA 2ECWA 1WE9A 2YQMA 3QZVA 5SVXA 4V3LC 4ZDTA 3SOUA 4C9ZA 2KREA 1VYXA 3EB5A 3HCSA 3ASLA 2VJFA 5C13A 3O37A 3L1ZB 3N9QA 2MNYA 2XB1A 4AYCA 3KV6A 1V87A 2CSZA 2CT2A 4H9DA 4V3KC 3KV5A 3O35A 4N3WA 2MT5A 2DX8A 2JM3A 3KQIA 2YUCA 2MA6A 3VK6A 5J3XA 4CA1A 2ECIA 3H7HA 3ZPV1 2P57A 5KH9A 3HCUA 4LLBA 3N9LA 2YHNA 3RPGC 4L7XA 1RMDA 4W4UA 2VPGA 5LKXA 2C2LA 2L0BA 4GB0A 1LDJB 4GNEA 1WESA 2D8UA 1Z6UA 4YC9A 1ZBDB 3U5NA 3Q1DA 2VPDA 4O62A 2KR4A 3FAOA 4A4BA 2HDPA 2MNZA 3EB6A 4P5OB 2XOZA 2LQ6A 3M62A 4GNDA 2LGLA 3NG2A 3O70A 3C6WA 5B79A 4XI1A 2UZGA 2L5UA 5I3LA 4PPEA 2M3HA 3N9PA 4LK9A 2MIQA 4AUQB 4TKPB 4YATA 4I7CA 4LKAA 5D1KB 5H1UA 2K16A 2G6QA 3T7LA 5FB1A 2H0DB 4L58A 4ZUXU 2KKXA 3FL2A 3O34A 2KGIA 3M99A 2YVRA 2OXQC 5TBNA 2RR4A 1X4JA 2MD7B 5FEYA 3SOXA 2BAYA 2CKLB 2L75A 4FIPA 4A0CD 3SOWA 3LVRE 3N9OA 2CRWA 2PNXA 3V43A 5DKAA 4MSXA 2VJEB 4OGCA 2E61A 1WEWA 2MUMA 4R7EA 3O7AA 2LDRA 2KE1A 2EXUA 3M63A 2VP7A 1WENA 2LN0A 2CSYA 2OWAA 1DVPA 4AVXA 5C11A 3LVQE 4QQ4A 2MD8C 3N9NA
chains in the Genus database with same CATH topology
1CHCA 3ZTGA 5G0FA 2YREA 3KNVA 1E4UA 5G05B 4IC3A 4LADB 4YBMA 2ECGA 5AIUA 3L1XA 4YBSA 3SHBA 3O36A 4IC2A 4A49A 4B7YC 2VJFB 2ECVA 1VFYA 4YADA 4X3GA 1BORA 3ZYQA 2QJ0A 3MHHA 2RSDA 2LXPC 2EGPA 3GL6A 2KYUA 2VJEA 1WEQA 1WEMA 1WFKA 1WIMA 2ECNA 2PUYA 3LQHA 2YYRA 5B75A 2LV9A 5B78A 2NAAA 2JMDA 2VPEA 4QF2A 1F62A 2MA5A 2E6RA 2XEUA 4R2YA 3DQVR 2VNFA 1MM3A 2ECTA 3HCTA 2QICA 4O64A 1JM7B 4ZQLA 1MM2A 4B86C 3ZVZB 2I50A 2KWKA 3U5MA 4YBTA 2Y43A 5B77A 1WEEA 4S3OC 4WZ2A 4MVTA 1U6GB 2QIZA 5KH3A 5TRBA 2YQLA 5B8DA 4A4CA 5FB0A 1K2FA 4WZ0A 3T6RA 1G25A 1WEUA 2YSJA 2E6SA 2JRJA 3GV4A 4FJCA 1LDKC 4UI9B 5D1MB 2F42A 2HYED 4N4FA 4F52B 2ZETC 1HYIA 4GNFA 2D8SA 4S3OB 1Z2QA 1VD4A 4QF3A 4Q6FA 2LGGA 4UP0A 2G45A 2KWNA 4I7DA 3ZNIA 2JMIA 4GNGA 4BHWA 2F6NA 3U5PA 2FUIA 5D1LB 5LKZA 5LKUA 2M85A 4FO9A 4AYCB 1WGMA 2YSMA 1IYMA 1WILA 2KGGA 1WEVA 3ZPVE 2KU3A 3O33A 5DINA 2L80A 1XWHA 2AN6A 5H1VA 2Y1NA 2LGVA 5G04B 2M1RA 2K17A 3DPLR 3LRQA 2VPBA 2K4DA 4BBQA 2IDAA 1WEOA 2Y1MA 5AITA 2KWJA 2YU4A 1X4IA 2LGKA 2ECJA 2YHOA 5KH7A 2C2VS 5FERA 2YW8A 4NN2A 1HYJA 5TABA 4UP5A 1JOCA 3HTKC 1JM7A 2LRIC 3RTRB 2YT5A 1X4UA 4CCGX 2LXHC 2KWOA 3LQIA 2KFTA 3C5KA 4WA6A 5LCWB 3IHPA 2CKLA 2JMJA 5EYAF 1T1HA 2G43A 4YAXA 5TDRA 4R8PK 2L43A 5LKTA 1FP0A 1Z60A 2F6JA 3PURA 3MHSA 3LQJA 2H0DA 3L11A 5H9MA 5H1TA 3U5OA 4AP4A 5B76A 2RI7A 4LJNA 2FSAA 4WZ3B 1WEPA 3I2DA 4YABA 3PHDA 1N87A 5TDWA 2K1JA 5JG6A 4I7BA 4PTBA 3RPGB 2EA6A 4FK5A 3N9MA 2YURA 2KIZA 1FBVA 2EODA 3ZVYA 3PUQA 2M6MA 2FUUA 2ECWA 1WE9A 2YQMA 3QZVA 4V3LC 4ZDTA 3SOUA 4C9ZA 2KREA 1VYXA 3EB5A 3HCSA 3ASLA 2VJFA 5C13A 3O37A 3L1ZB 3N9QA 2MNYA 2XB1A 4AYCA 3KV6A 1V87A 2CSZA 2CT2A 4V3KC 3KV5A 3O35A 4N3WA 2MT5A 2DX8A 3KQIA 2YUCA 2MA6A 3VK6A 5J3XA 4CA1A 2ECIA 3ZPV1 5KH9A 3HCUA 4LLBA 3N9LA 2YHNA 3RPGC 4L7XA 1RMDA 4W4UA 2VPGA 5LKXA 2C2LA 2L0BA 4GB0A 1LDJB 4GNEA 1WESA 1Z6UA 4YC9A 1ZBDB 3U5NA 4A4BA 2VPDA 2KR4A 2HDPA 2MNZA 3EB6A 4P5OB 2LQ6A 3M62A 4GNDA 2LGLA 3NG2A 3O70A 3C6WA 5B79A 4XI1A 2UZGA 2L5UA 5I3LA 4PPEA 2M3HA 3N9PA 4LK9A 2MIQA 4AUQB 4TKPB 4YATA 4I7CA 4LKAA 5D1KB 5H1UA 2K16A 2G6QA 3T7LA 5FB1A 2H0DB 4L58A 4ZUXU 3FL2A 3O34A 2KGIA 3M99A 2OXQC 5TBNA 1X4JA 2MD7B 5FEYA 3SOXA 2BAYA 2CKLB 2L75A 4FIPA 4A0CD 3SOWA 3N9OA 2PNXA 3V43A 5DKAA 4MSXA 2VJEB 1WEWA 2MUMA 4R7EA 3O7AA 2LDRA 2KE1A 3M63A 2VP7A 1WENA 2LN0A 2CSYA 1DVPA 4AVXA 5C11A 2MD8C 3N9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHC A;  3ZTG A;  5G0F A;  2YRE A;  3KNV A;  1E4U A;  5G05 B;  4IC3 A;  4LAD B;  4YBM A;  2ECG A;  5AIU A;  3L1X A;  4YBS A;  3SHB A;  3O36 A;  4IC2 A;  4A49 A;  4B7Y C;  2VJF B;  2ECV A;  1VFY A;  4YAD A;  4X3G A;  1BOR A;  3ZYQ A;  2QJ0 A;  3MHH A;  2RSD A;  2LXP C;  2EGP A;  3GL6 A;  2KYU A;  2VJE A;  1WEQ A;  1WEM A;  1WFK A;  1WIM A;  2ECN A;  2PUY A;  3LQH A;  2YYR A;  5B75 A;  2LV9 A;  5B78 A;  2NAA A;  2JMD A;  2VPE A;  4QF2 A;  1F62 A;  2MA5 A;  2E6R A;  2XEU A;  4R2Y A;  3DQV R;  2VNF A;  1MM3 A;  2ECT A;  3HCT A;  2QIC A;  4O64 A;  1JM7 B;  4ZQL A;  1MM2 A;  4B86 C;  3ZVZ B;  2I50 A;  2KWK A;  3U5M A;  4YBT A;  2Y43 A;  5B77 A;  1WEE A;  4S3O C;  4WZ2 A;  4MVT A;  1U6G B;  2QIZ A;  5KH3 A;  5TRB A;  2YQL A;  5B8D A;  4A4C A;  5FB0 A;  1K2F A;  4WZ0 A;  3T6R A;  1G25 A;  1WEU A;  2YSJ A;  2E6S A;  2JRJ A;  3GV4 A;  4FJC A;  1LDK C;  4UI9 B;  5D1M B;  2F42 A;  2HYE D;  4N4F A;  4F52 B;  2ZET C;  1HYI A;  4GNF A;  2D8S A;  4S3O B;  1Z2Q A;  1VD4 A;  4QF3 A;  4Q6F A;  2LGG A;  4UP0 A;  2G45 A;  2KWN A;  4I7D A;  3ZNI A;  2JMI A;  4GNG A;  4BHW A;  2F6N A;  3U5P A;  2FUI A;  5D1L B;  5LKZ A;  5LKU A;  2M85 A;  4FO9 A;  4AYC B;  1WGM A;  2YSM A;  1IYM A;  1WIL A;  2KGG A;  1WEV A;  3ZPV E;  2KU3 A;  3O33 A;  5DIN A;  2L80 A;  1XWH A;  2AN6 A;  5H1V A;  2Y1N A;  2LGV A;  5G04 B;  2M1R A;  2K17 A;  3DPL R;  3LRQ A;  2VPB A;  2K4D A;  4BBQ A;  2IDA A;  1WEO A;  2Y1M A;  5AIT A;  2KWJ A;  2YU4 A;  1X4I A;  2LGK A;  2ECJ A;  2YHO A;  5KH7 A;  2C2V S;  5FER A;  2YW8 A;  4NN2 A;  1HYJ A;  5TAB A;  4UP5 A;  1JOC A;  3HTK C;  1JM7 A;  2LRI C;  3RTR B;  2YT5 A;  1X4U A;  4CCG X;  2LXH C;  2KWO A;  3LQI A;  2KFT A;  3C5K A;  4WA6 A;  5LCW B;  3IHP A;  2CKL A;  2JMJ A;  5EYA F;  1T1H A;  2G43 A;  4YAX A;  5TDR A;  4R8P K;  2L43 A;  5LKT A;  1FP0 A;  1Z60 A;  2F6J A;  3PUR A;  3MHS A;  3LQJ A;  2H0D A;  3L11 A;  5H9M A;  5H1T A;  3U5O A;  4AP4 A;  5B76 A;  2RI7 A;  4LJN A;  2FSA A;  4WZ3 B;  1WEP A;  3I2D A;  4YAB A;  3PHD A;  1N87 A;  5TDW A;  2K1J A;  5JG6 A;  4I7B A;  4PTB A;  3RPG B;  2EA6 A;  4FK5 A;  3N9M A;  2YUR A;  2KIZ A;  1FBV A;  2EOD A;  3ZVY A;  3PUQ A;  2M6M A;  2FUU A;  2ECW A;  1WE9 A;  2YQM A;  3QZV A;  4V3L C;  4ZDT A;  3SOU A;  4C9Z A;  2KRE A;  1VYX A;  3EB5 A;  3HCS A;  3ASL A;  2VJF A;  5C13 A;  3O37 A;  3L1Z B;  3N9Q A;  2MNY A;  2XB1 A;  4AYC A;  3KV6 A;  1V87 A;  2CSZ A;  2CT2 A;  4V3K C;  3KV5 A;  3O35 A;  4N3W A;  2MT5 A;  2DX8 A;  3KQI A;  2YUC A;  2MA6 A;  3VK6 A;  5J3X A;  4CA1 A;  2ECI A;  3ZPV 1;  5KH9 A;  3HCU A;  4LLB A;  3N9L A;  2YHN A;  3RPG C;  4L7X A;  1RMD A;  4W4U A;  2VPG A;  5LKX A;  2C2L A;  2L0B A;  4GB0 A;  1LDJ B;  4GNE A;  1WES A;  1Z6U A;  4YC9 A;  1ZBD B;  3U5N A;  4A4B A;  2VPD A;  2KR4 A;  2HDP A;  2MNZ A;  3EB6 A;  4P5O B;  2LQ6 A;  3M62 A;  4GND A;  2LGL A;  3NG2 A;  3O70 A;  3C6W A;  5B79 A;  4XI1 A;  2UZG A;  2L5U A;  5I3L A;  4PPE A;  2M3H A;  3N9P A;  4LK9 A;  2MIQ A;  4AUQ B;  4TKP B;  4YAT A;  4I7C A;  4LKA A;  5D1K B;  5H1U A;  2K16 A;  2G6Q A;  3T7L A;  5FB1 A;  2H0D B;  4L58 A;  4ZUX U;  3FL2 A;  3O34 A;  2KGI A;  3M99 A;  2OXQ C;  5TBN A;  1X4J A;  2MD7 B;  5FEY A;  3SOX A;  2BAY A;  2CKL B;  2L75 A;  4FIP A;  4A0C D;  3SOW A;  3N9O A;  2PNX A;  3V43 A;  5DKA A;  4MSX A;  2VJE B;  1WEW A;  2MUM A;  4R7E A;  3O7A A;  2LDR A;  2KE1 A;  3M63 A;  2VP7 A;  1WEN A;  2LN0 A;  2CSY A;  1DVP A;  4AVX A;  5C11 A;  2MD8 C;  3N9N A; 
#chains in the Genus database with same CATH topology
 1CHC A;  3ZTG A;  5G0F A;  2YRE A;  3KNV A;  2FFW A;  1E4U A;  5G05 B;  2LAU A;  4IC3 A;  4LAD B;  4YBM A;  2ECG A;  5AIU A;  3L1X A;  4YBS A;  3FJU B;  3SHB A;  3O36 A;  4IC2 A;  4A49 A;  4B7Y C;  2VJF B;  2ECV A;  1VFY A;  4YAD A;  2MKE A;  1BOR A;  4X3G A;  3ZYQ A;  2QJ0 A;  3MHH A;  2RSD A;  2LXP C;  2EGP A;  3GL6 A;  2KYU A;  2VJE A;  1WEQ A;  1WEM A;  1WFK A;  1WIM A;  3DDT A;  2ECN A;  2PUY A;  3LQH A;  2YYR A;  5B75 A;  5SVI A;  2LV9 A;  5B78 A;  3FEH A;  2NAA A;  2JMD A;  2VPE A;  4QF2 A;  1F62 A;  2MA5 A;  2E6R A;  2XEU A;  5K3Q A;  4R2Y A;  3DQV R;  2VNF A;  1MM3 A;  2ECT A;  3HCT A;  2QIC A;  4O64 A;  1JM7 B;  4ZQL A;  1MM2 A;  4B86 C;  3ZVZ B;  2CON A;  2I50 A;  2KWK A;  3U5M A;  2DJA A;  4YBT A;  2Y43 A;  2FD4 A;  5B77 A;  1WEE A;  4S3O C;  4WZ2 A;  4MVT A;  2JUN A;  2EGM A;  1U6G B;  2QIZ A;  3LDY A;  5KH3 A;  5TRB A;  2YQL A;  5B8D A;  4A4C A;  5FB0 A;  1K2F A;  4WZ0 A;  3T6R A;  3SUB A;  1G25 A;  1WEU A;  2YSJ A;  2M13 A;  2E6S A;  2JRJ A;  3GV4 A;  4FJC A;  1LDK C;  4UI9 B;  5D1M B;  2F42 A;  2HYE D;  2IQJ A;  4N4F A;  4F52 B;  2ZET C;  1HYI A;  4GNF A;  4Z0O A;  2D8S A;  4S3O B;  1Z2Q A;  1VD4 A;  1MBM A;  4QF3 A;  4Q6F A;  2LGG A;  4UP0 A;  2G45 A;  3FAN A;  2KWN A;  4I7D A;  3ZNI A;  2JMI A;  4GNG A;  4BHW A;  2F6N A;  3U5P A;  2FUI A;  3LJU X;  5D1L B;  5LKZ A;  5LKU A;  2M85 A;  4FO9 A;  4AYC B;  1WGM A;  2YSM A;  1IYM A;  1WIL A;  2KKY A;  2KGG A;  1WEV A;  3ZPV E;  2KU3 A;  2B0O E;  3O33 A;  3FM8 C;  5DIN A;  2L80 A;  2XOY A;  1XWH A;  2AN6 A;  5H1V A;  2Y1N A;  2XP0 A;  2LGV A;  5G04 B;  2M1R A;  2K17 A;  3DPL R;  3LRQ A;  2VPB A;  3JUE A;  2K4D A;  4BBQ A;  2IDA A;  1WEO A;  2Y1M A;  2L7P A;  5AIT A;  2KWJ A;  2YU4 A;  2XOC A;  1X4I A;  2LGK A;  2ECJ A;  2YHO A;  5KH7 A;  2C2V S;  5FER A;  2YW8 A;  4NN2 A;  1HYJ A;  5TAB A;  4UP5 A;  1JOC A;  3HTK C;  1DCQ A;  5SVY A;  1JM7 A;  2LRI C;  3RTR B;  2YT5 A;  1X4U A;  2CRR A;  4CCG X;  2LXH C;  2DSM A;  2KWO A;  3LQI A;  2KFT A;  3C5K A;  3M7K A;  4WA6 A;  5LCW B;  3IHP A;  2CKL A;  2JMJ A;  4OGE A;  5EYA F;  1T1H A;  2G43 A;  4YAX A;  3PLW A;  3DWD A;  5TDR A;  4R8P K;  2L43 A;  5LKT A;  1FP0 A;  1Z60 A;  2F6J A;  3PUR A;  3MHS A;  3LQJ A;  3E2D A;  3MDB C;  2H0D A;  3L11 A;  5H9M A;  5H1T A;  4F1P A;  3U5O A;  3KDE C;  3T9K A;  4AP4 A;  5B76 A;  5SVI B;  2RI7 A;  4LJN A;  4Z0R A;  2FSA A;  1WEP A;  4WZ3 B;  3I2D A;  4YAB A;  3PHD A;  1N87 A;  5TDW A;  2K1J A;  5JG6 A;  4I7B A;  4PTB A;  3O47 A;  3RPG B;  2EA6 A;  4FK5 A;  2CSV A;  3N9M A;  2YUR A;  2KIZ A;  1FBV A;  2EOD A;  3ZVY A;  3PUQ A;  2M6M A;  2FUU A;  2ECW A;  1WE9 A;  2YQM A;  3QZV A;  5SVX A;  4V3L C;  4ZDT A;  3SOU A;  4C9Z A;  2KRE A;  1VYX A;  3EB5 A;  3HCS A;  3ASL A;  2VJF A;  5C13 A;  3O37 A;  3L1Z B;  3N9Q A;  2MNY A;  2XB1 A;  4AYC A;  3KV6 A;  1V87 A;  2CSZ A;  2CT2 A;  4H9D A;  4V3K C;  3KV5 A;  3O35 A;  4N3W A;  2MT5 A;  2DX8 A;  2JM3 A;  3KQI A;  2YUC A;  2MA6 A;  3VK6 A;  5J3X A;  4CA1 A;  2ECI A;  3H7H A;  3ZPV 1;  2P57 A;  5KH9 A;  3HCU A;  4LLB A;  3N9L A;  2YHN A;  3RPG C;  4L7X A;  1RMD A;  4W4U A;  2VPG A;  5LKX A;  2C2L A;  2L0B A;  4GB0 A;  1LDJ B;  4GNE A;  1WES A;  2D8U A;  1Z6U A;  4YC9 A;  1ZBD B;  3U5N A;  3Q1D A;  2VPD A;  4O62 A;  2KR4 A;  3FAO A;  4A4B A;  2HDP A;  2MNZ A;  3EB6 A;  4P5O B;  2XOZ A;  2LQ6 A;  3M62 A;  4GND A;  2LGL A;  3NG2 A;  3O70 A;  3C6W A;  5B79 A;  4XI1 A;  2UZG A;  2L5U A;  5I3L A;  4PPE A;  2M3H A;  3N9P A;  4LK9 A;  2MIQ A;  4AUQ B;  4TKP B;  4YAT A;  4I7C A;  4LKA A;  5D1K B;  5H1U A;  2K16 A;  2G6Q A;  3T7L A;  5FB1 A;  2H0D B;  4L58 A;  4ZUX U;  2KKX A;  3FL2 A;  3O34 A;  2KGI A;  3M99 A;  2YVR A;  2OXQ C;  5TBN A;  2RR4 A;  1X4J A;  2MD7 B;  5FEY A;  3SOX A;  2BAY A;  2CKL B;  2L75 A;  4FIP A;  4A0C D;  3SOW A;  3LVR E;  3N9O A;  2CRW A;  2PNX A;  3V43 A;  5DKA A;  4MSX A;  2VJE B;  4OGC A;  2E61 A;  1WEW A;  2MUM A;  4R7E A;  3O7A A;  2LDR A;  2KE1 A;  2EXU A;  3M63 A;  2VP7 A;  1WEN A;  2LN0 A;  2CSY A;  2OWA A;  1DVP A;  4AVX A;  5C11 A;  3LVQ E;  4QQ4 A;  2MD8 C;  3N9N A; 
#chains in the Genus database with same CATH homology
 1CHC A;  3ZTG A;  5G0F A;  2YRE A;  3KNV A;  1E4U A;  5G05 B;  4IC3 A;  4LAD B;  4YBM A;  2ECG A;  5AIU A;  3L1X A;  4YBS A;  3SHB A;  3O36 A;  4IC2 A;  4A49 A;  4B7Y C;  2VJF B;  2ECV A;  1VFY A;  4YAD A;  4X3G A;  1BOR A;  3ZYQ A;  2QJ0 A;  3MHH A;  2RSD A;  2LXP C;  2EGP A;  3GL6 A;  2KYU A;  2VJE A;  1WEQ A;  1WEM A;  1WFK A;  1WIM A;  2ECN A;  2PUY A;  3LQH A;  2YYR A;  5B75 A;  2LV9 A;  5B78 A;  2NAA A;  2JMD A;  2VPE A;  4QF2 A;  1F62 A;  2MA5 A;  2E6R A;  2XEU A;  4R2Y A;  3DQV R;  2VNF A;  1MM3 A;  2ECT A;  3HCT A;  2QIC A;  4O64 A;  1JM7 B;  4ZQL A;  1MM2 A;  4B86 C;  3ZVZ B;  2I50 A;  2KWK A;  3U5M A;  4YBT A;  2Y43 A;  5B77 A;  1WEE A;  4S3O C;  4WZ2 A;  4MVT A;  1U6G B;  2QIZ A;  5KH3 A;  5TRB A;  2YQL A;  5B8D A;  4A4C A;  5FB0 A;  1K2F A;  4WZ0 A;  3T6R A;  1G25 A;  1WEU A;  2YSJ A;  2E6S A;  2JRJ A;  3GV4 A;  4FJC A;  1LDK C;  4UI9 B;  5D1M B;  2F42 A;  2HYE D;  4N4F A;  4F52 B;  2ZET C;  1HYI A;  4GNF A;  2D8S A;  4S3O B;  1Z2Q A;  1VD4 A;  4QF3 A;  4Q6F A;  2LGG A;  4UP0 A;  2G45 A;  2KWN A;  4I7D A;  3ZNI A;  2JMI A;  4GNG A;  4BHW A;  2F6N A;  3U5P A;  2FUI A;  5D1L B;  5LKZ A;  5LKU A;  2M85 A;  4FO9 A;  4AYC B;  1WGM A;  2YSM A;  1IYM A;  1WIL A;  2KGG A;  1WEV A;  3ZPV E;  2KU3 A;  3O33 A;  5DIN A;  2L80 A;  1XWH A;  2AN6 A;  5H1V A;  2Y1N A;  2LGV A;  5G04 B;  2M1R A;  2K17 A;  3DPL R;  3LRQ A;  2VPB A;  2K4D A;  4BBQ A;  2IDA A;  1WEO A;  2Y1M A;  5AIT A;  2KWJ A;  2YU4 A;  1X4I A;  2LGK A;  2ECJ A;  2YHO A;  5KH7 A;  2C2V S;  5FER A;  2YW8 A;  4NN2 A;  1HYJ A;  5TAB A;  4UP5 A;  1JOC A;  3HTK C;  1JM7 A;  2LRI C;  3RTR B;  2YT5 A;  1X4U A;  4CCG X;  2LXH C;  2KWO A;  3LQI A;  2KFT A;  3C5K A;  4WA6 A;  5LCW B;  3IHP A;  2CKL A;  2JMJ A;  5EYA F;  1T1H A;  2G43 A;  4YAX A;  5TDR A;  4R8P K;  2L43 A;  5LKT A;  1FP0 A;  1Z60 A;  2F6J A;  3PUR A;  3MHS A;  3LQJ A;  2H0D A;  3L11 A;  5H9M A;  5H1T A;  3U5O A;  4AP4 A;  5B76 A;  2RI7 A;  4LJN A;  2FSA A;  4WZ3 B;  1WEP A;  3I2D A;  4YAB A;  3PHD A;  1N87 A;  5TDW A;  2K1J A;  5JG6 A;  4I7B A;  4PTB A;  3RPG B;  2EA6 A;  4FK5 A;  3N9M A;  2YUR A;  2KIZ A;  1FBV A;  2EOD A;  3ZVY A;  3PUQ A;  2M6M A;  2FUU A;  2ECW A;  1WE9 A;  2YQM A;  3QZV A;  4V3L C;  4ZDT A;  3SOU A;  4C9Z A;  2KRE A;  1VYX A;  3EB5 A;  3HCS A;  3ASL A;  2VJF A;  5C13 A;  3O37 A;  3L1Z B;  3N9Q A;  2MNY A;  2XB1 A;  4AYC A;  3KV6 A;  1V87 A;  2CSZ A;  2CT2 A;  4V3K C;  3KV5 A;  3O35 A;  4N3W A;  2MT5 A;  2DX8 A;  3KQI A;  2YUC A;  2MA6 A;  3VK6 A;  5J3X A;  4CA1 A;  2ECI A;  3ZPV 1;  5KH9 A;  3HCU A;  4LLB A;  3N9L A;  2YHN A;  3RPG C;  4L7X A;  1RMD A;  4W4U A;  2VPG A;  5LKX A;  2C2L A;  2L0B A;  4GB0 A;  1LDJ B;  4GNE A;  1WES A;  1Z6U A;  4YC9 A;  1ZBD B;  3U5N A;  4A4B A;  2VPD A;  2KR4 A;  2HDP A;  2MNZ A;  3EB6 A;  4P5O B;  2LQ6 A;  3M62 A;  4GND A;  2LGL A;  3NG2 A;  3O70 A;  3C6W A;  5B79 A;  4XI1 A;  2UZG A;  2L5U A;  5I3L A;  4PPE A;  2M3H A;  3N9P A;  4LK9 A;  2MIQ A;  4AUQ B;  4TKP B;  4YAT A;  4I7C A;  4LKA A;  5D1K B;  5H1U A;  2K16 A;  2G6Q A;  3T7L A;  5FB1 A;  2H0D B;  4L58 A;  4ZUX U;  3FL2 A;  3O34 A;  2KGI A;  3M99 A;  2OXQ C;  5TBN A;  1X4J A;  2MD7 B;  5FEY A;  3SOX A;  2BAY A;  2CKL B;  2L75 A;  4FIP A;  4A0C D;  3SOW A;  3N9O A;  2PNX A;  3V43 A;  5DKA A;  4MSX A;  2VJE B;  1WEW A;  2MUM A;  4R7E A;  3O7A A;  2LDR A;  2KE1 A;  3M63 A;  2VP7 A;  1WEN A;  2LN0 A;  2CSY A;  1DVP A;  4AVX A;  5C11 A;  2MD8 C;  3N9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...