1MM3A

Solution structure of the 2nd phd domain from mi2b with c-terminal loop replaced by corresponding loop from wstf
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
61
structure length
61
Chain Sequence
b'GPLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLRPALYEVPDGEWQCPRCTCPALKGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mi2-beta(Chromodomain helicase-DNA-binding protein 4) and tr
publication title Engineering a Protein Scaffold from a PHD Finger
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/transcription
total genus 8
structure length 61
sequence length 61
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1mm3A00
3L1XA 3O35A 2LXHC 3GL6A 2K17A 3HTKC 3O33A 5B79A 3N9PA 5KH9A 2CT2A 2L0BA 4ZUXU 2AN6A 3U5OA 1X4UA 1F62A 4XI1A 4LK9A 2FUUA 1LDJB 3ZVZB 2KIZA 5DINA 4BHWA 4R8PK 1K2FA 2KU3A 4GNFA 4B86C 1CHCA 2KWOA 4A4CA 2G6QA 1X4JA 3ZTGA 2MNZA 2YHOA 4R7EA 2OXQC 2F6JA 4FJCA 3M62A 2L75A 3LQHA 4AUQB 2VPGA 2LDRA 4LKAA 5J3XA 4YABA 5B78A 4X3GA 4N4FA 3RTRB 4L7XA 2LGLA 2MA5A 2LGGA 3N9QA 5LCWB 4R2YA 1Z6UA 3N9OA 4I7BA 1WEOA 4YATA 2YU4A 5TDWA 1HYJA 2G43A 3N9NA 2VP7A 1ZBDB 3ZYQA 2CKLA 3LQIA 4TKPB 2PNXA 4O64A 1WEQA 4ZQLA 2MD7B 5FB0A 3KNVA 3RPGC 5TABA 2H0DA 5TDRA 3ZPV1 1JOCA 1WEPA 2ECIA 3SOXA 3PURA 3HCTA 2YSMA 3L1ZB 2M85A 4C9ZA 2YW8A 2M1RA 3IHPA 5H9MA 4YBTA 4GB0A 3U5PA 4S3OB 2QIZA 2C2LA 2Y43A 2YREA 2F6NA 5AIUA 4YBSA 3ZVYA 4AYCA 2KGIA 4GNGA 5I3LA 4F52B 2F42A 2K1JA 5G05B 4YAXA 2JMDA 3MHHA 2QICA 2I50A 2ECVA 4CCGX 2VJFB 4IC2A 4MVTA 2ECTA 1VFYA 1WGMA 5H1TA 3N9LA 2LGVA 5G04B 1WEUA 5D1MB 1VYXA 3O34A 3NG2A 2E6RA 3M63A 1FP0A 2EGPA 2VPBA 1V87A 4LADB 5TRBA 5H1UA 3L11A 1JM7A 4GNDA 4A4BA 4P5OB 5B8DA 3QZVA 3C6WA 2LGKA 2ECGA 5FEYA 2JMJA 5G0FA 1DVPA 2FSAA 4FIPA 2YURA 1WEWA 4AVXA 2C2VS 2KGGA 3LRQA 2JMIA 3PUQA 4W4UA 1N87A 5D1KB 1Z2QA 2VJEB 2MNYA 2KWNA 3GV4A 3VK6A 4BBQA 5B77A 1MM2A 4A49A 4S3OC 4N3WA 1E4UA 2XB1A 3KQIA 2VNFA 5LKTA 4Q6FA 3DQVR 1WENA 1FBVA 3O37A 4MSXA 4IC3A 1HYIA 4CA1A 2UZGA 3C5KA 3I2DA 1WIMA 2DX8A 1WEMA 5C13A 2MA6A 3SHBA 3MHSA 5FERA 2EODA 1RMDA 2LRIC 3U5NA 4FK5A 3HCSA 4V3KC 4YC9A 2KE1A 2E6SA 4WZ0A 4LJNA 3V43A 2K4DA 2KFTA 2KYUA 2ECJA 2L5UA 2YUCA 1MM3A 2XEUA 5TBNA 2VPEA 3ZPVE 4V3LC 1BORA 3EB5A 2ZETC 2JRJA 2HDPA 2BAYA 1T1HA 3KV5A 2MIQA 4UP5A 4WZ2A 4YBMA 3SOWA 4AP4A 1WILA 3SOUA 1JM7B 2L43A 4PPEA 2FUIA 5AITA 5B75A 2ECWA 4I7CA 3ZNIA 3T6RA 2Y1MA 2YYRA 2YHNA 3KV6A 3ASLA 1X4IA 2KWKA 2YQLA 5KH3A 4PTBA 2LXPC 2LV9A 5LKUA 3N9MA 2Y1NA 1WFKA 2VJFA 2RSDA 1XWHA 3PHDA 1WEEA 2QJ0A 2KREA 2CKLB 2M3HA 2M6MA 5B76A 2LN0A 2D8SA 1VD4A 2LQ6A 3HCUA 4WZ3B 2K16A 4QF3A 5EYAF 3U5MA 2YQMA 2H0DB 2VPDA 4L58A 4LLBA 4I7DA 5KH7A 1WEVA 2MUMA 5DKAA 4ZDTA 2YSJA 4A0CD 1U6GB 5JG6A 2KR4A 4YADA 2KWJA 1LDKC 3LQJA 2YT5A 5C11A 5D1LB 3O7AA 4GNEA 5H1VA 2ECNA 1IYMA 4AYCB 1Z60A 2L80A 2MD8C 3FL2A 2MT5A 2PUYA 2EA6A 5LKZA 2NAAA 3O70A 2IDAA 2VJEA 5LKXA 4UI9B 1G25A 4NN2A 4WA6A 3EB6A 4FO9A 2RI7A 1WE9A 4QF2A 5FB1A 3T7LA 2G45A 4B7YC 2CSYA 1WESA 3M99A 4UP0A 2HYED 2CSZA 3RPGB 3DPLR 3O36A
chains in the Genus database with same CATH superfamily
3L1XA 3O35A 2LXHC 2L7PA 3GL6A 4OGEA 2K17A 3HTKC 3O33A 5B79A 3N9PA 5KH9A 2E61A 2CT2A 2L0BA 4ZUXU 2AN6A 3U5OA 2CRWA 1X4UA 1F62A 4XI1A 4LK9A 2FUUA 3O47A 3LJUX 1LDJB 3ZVZB 2KIZA 5DINA 5SVIB 4BHWA 4R8PK 1K2FA 2KU3A 4GNFA 4B86C 2RR4A 3FM8C 1CHCA 2KWOA 2EGMA 4A4CA 2G6QA 1X4JA 3ZTGA 2MNZA 2YHOA 3MDBC 4R7EA 2OXQC 2F6JA 4FJCA 3M62A 2L75A 3LQHA 4AUQB 2VPGA 2LDRA 2B0OE 4LKAA 5J3XA 4Z0OA 1DCQA 4YABA 5B78A 4X3GA 4N4FA 3RTRB 4L7XA 2LGLA 2MA5A 2LGGA 3M7KA 2P57A 3N9QA 5LCWB 4R2YA 1Z6UA 2XP0A 3N9OA 4I7BA 1WEOA 2EXUA 4YATA 2YU4A 5TDWA 1HYJA 2G43A 3N9NA 2VP7A 1ZBDB 3ZYQA 2CKLA 3LQIA 4TKPB 2IQJA 3DDTA 2D8UA 2PNXA 4O64A 5SVXA 1WEQA 4ZQLA 2MD7B 5FB0A 3KNVA 3RPGC 5TABA 5SVYA 2H0DA 5TDRA 3ZPV1 3LVQE 1JOCA 1WEPA 2ECIA 3SOXA 3PURA 3HCTA 2YSMA 3L1ZB 2M85A 4C9ZA 2YW8A 2M1RA 3IHPA 5H9MA 4YBTA 4GB0A 2XOYA 3U5PA 4S3OB 2QIZA 2C2LA 2Y43A 2YREA 2F6NA 5AIUA 4YBSA 4OGCA 3ZVYA 4AYCA 2KGIA 4GNGA 5I3LA 4F52B 3H7HA 2F42A 2K1JA 5G05B 4YAXA 2JMDA 3MHHA 3LDYA 2QICA 2I50A 2ECVA 4CCGX 2VJFB 4IC2A 4MVTA 2ECTA 1VFYA 1WGMA 2JM3A 5H1TA 2XOZA 3N9LA 2LGVA 2MKEA 5G04B 1WEUA 5D1MB 1VYXA 2DJAA 3O34A 3NG2A 2E6RA 3M63A 1FP0A 2EGPA 2VPBA 1V87A 4LADB 5TRBA 5H1UA 3L11A 1JM7A 4GNDA 4A4BA 4P5OB 3E2DA 4H9DA 3QZVA 3C6WA 4O62A 3DWDA 5B8DA 2LGKA 2ECGA 5FEYA 2JMJA 5G0FA 1DVPA 2FSAA 4Z0RA 2YVRA 4FIPA 2YURA 1WEWA 4AVXA 2C2VS 2KGGA 3LRQA 2OWAA 5SVIA 2JMIA 3PUQA 4QQ4A 4W4UA 1N87A 5D1KB 1Z2QA 2VJEB 2MNYA 2KWNA 3GV4A 3VK6A 4BBQA 5B77A 1MM2A 2JUNA 4A49A 4S3OC 4N3WA 2XOCA 1E4UA 2XB1A 3KQIA 2VNFA 1MBMA 5LKTA 3KDEC 3JUEA 4Q6FA 3DQVR 1WENA 1FBVA 3O37A 4MSXA 4IC3A 1HYIA 4CA1A 2UZGA 3C5KA 3I2DA 1WIMA 2DX8A 1WEMA 5C13A 2MA6A 3SHBA 3MHSA 5FERA 2EODA 1RMDA 2LRIC 3PLWA 3U5NA 4FK5A 3HCSA 4V3KC 3FJUB 4YC9A 2KE1A 2E6SA 4WZ0A 4LJNA 3V43A 2DSMA 2K4DA 2KFTA 2KYUA 2ECJA 2L5UA 2YUCA 1MM3A 2XEUA 5TBNA 2VPEA 3ZPVE 4V3LC 1BORA 3EB5A 2KKXA 2JRJA 2ZETC 2HDPA 2BAYA 1T1HA 3KV5A 2MIQA 4UP5A 4WZ2A 4YBMA 3SOWA 4AP4A 1WILA 3SOUA 1JM7B 2L43A 3T9KA 3Q1DA 4PPEA 2FUIA 2CRRA 3FEHA 5AITA 5B75A 3FANA 2ECWA 4I7CA 3ZNIA 3T6RA 2Y1MA 2YYRA 2YHNA 3KV6A 3SUBA 3ASLA 1X4IA 2KWKA 2YQLA 3FAOA 5KH3A 4PTBA 2LXPC 2LV9A 5LKUA 3N9MA 2Y1NA 1WFKA 2VJFA 2RSDA 1XWHA 3PHDA 1WEEA 2QJ0A 2CONA 2KREA 2CKLB 2M3HA 2M6MA 3LVRE 5B76A 2LN0A 2D8SA 1VD4A 2LQ6A 3HCUA 4WZ3B 2K16A 4QF3A 5EYAF 3U5MA 2YQMA 2H0DB 2VPDA 4L58A 4LLBA 4I7DA 5KH7A 1WEVA 2MUMA 5DKAA 4ZDTA 2YSJA 4A0CD 2FD4A 1U6GB 5JG6A 2KR4A 4YADA 2KWJA 1LDKC 3LQJA 2YT5A 5C11A 5D1LB 3O7AA 2KKYA 4F1PA 4GNEA 5H1VA 2ECNA 1IYMA 4AYCB 2LAUA 2FFWA 1Z60A 2L80A 2MD8C 3FL2A 2MT5A 2PUYA 5K3QA 2EA6A 5LKZA 2NAAA 3O70A 2IDAA 2VJEA 5LKXA 4UI9B 1G25A 4NN2A 4WA6A 3EB6A 4FO9A 2M13A 2RI7A 1WE9A 4QF2A 5FB1A 3T7LA 2G45A 4B7YC 2CSYA 1WESA 3M99A 4UP0A 2CSVA 2HYED 2CSZA 3RPGB 3DPLR 3O36A
chains in the Genus database with same CATH topology
3L1XA 3O35A 2LXHC 3GL6A 2K17A 3HTKC 3O33A 5B79A 3N9PA 5KH9A 2CT2A 2L0BA 4ZUXU 2AN6A 3U5OA 1X4UA 1F62A 4XI1A 4LK9A 2FUUA 1LDJB 3ZVZB 2KIZA 5DINA 4BHWA 4R8PK 1K2FA 2KU3A 4GNFA 4B86C 1CHCA 2KWOA 4A4CA 2G6QA 1X4JA 3ZTGA 2MNZA 2YHOA 4R7EA 2OXQC 2F6JA 4FJCA 3M62A 2L75A 3LQHA 4AUQB 2VPGA 2LDRA 4LKAA 5J3XA 4YABA 5B78A 4X3GA 4N4FA 3RTRB 4L7XA 2LGLA 2MA5A 2LGGA 3N9QA 5LCWB 4R2YA 1Z6UA 3N9OA 4I7BA 1WEOA 4YATA 2YU4A 5TDWA 1HYJA 2G43A 3N9NA 2VP7A 1ZBDB 3ZYQA 2CKLA 3LQIA 4TKPB 2PNXA 4O64A 1WEQA 4ZQLA 2MD7B 5FB0A 3KNVA 3RPGC 5TABA 2H0DA 5TDRA 3ZPV1 1JOCA 1WEPA 2ECIA 3SOXA 3PURA 3HCTA 2YSMA 3L1ZB 2M85A 4C9ZA 2YW8A 2M1RA 3IHPA 5H9MA 4YBTA 4GB0A 3U5PA 4S3OB 2QIZA 2C2LA 2Y43A 2YREA 2F6NA 5AIUA 4YBSA 3ZVYA 4AYCA 2KGIA 4GNGA 5I3LA 4F52B 2F42A 2K1JA 5G05B 4YAXA 2JMDA 3MHHA 2QICA 2I50A 2ECVA 4CCGX 2VJFB 4IC2A 4MVTA 2ECTA 1VFYA 1WGMA 5H1TA 3N9LA 2LGVA 5G04B 1WEUA 5D1MB 1VYXA 3O34A 3NG2A 2E6RA 3M63A 1FP0A 2EGPA 2VPBA 1V87A 4LADB 5TRBA 5H1UA 3L11A 1JM7A 4GNDA 4A4BA 4P5OB 5B8DA 3QZVA 3C6WA 2LGKA 2ECGA 5FEYA 2JMJA 5G0FA 1DVPA 2FSAA 4FIPA 2YURA 1WEWA 4AVXA 2C2VS 2KGGA 3LRQA 2JMIA 3PUQA 4W4UA 1N87A 5D1KB 1Z2QA 2VJEB 2MNYA 2KWNA 3GV4A 3VK6A 4BBQA 5B77A 1MM2A 4A49A 4S3OC 4N3WA 1E4UA 2XB1A 3KQIA 2VNFA 5LKTA 4Q6FA 3DQVR 1WENA 1FBVA 3O37A 4MSXA 4IC3A 1HYIA 4CA1A 2UZGA 3C5KA 3I2DA 1WIMA 2DX8A 1WEMA 5C13A 2MA6A 3SHBA 3MHSA 5FERA 2EODA 1RMDA 2LRIC 3U5NA 4FK5A 3HCSA 4V3KC 4YC9A 2KE1A 2E6SA 4WZ0A 4LJNA 3V43A 2K4DA 2KFTA 2KYUA 2ECJA 2L5UA 2YUCA 1MM3A 2XEUA 5TBNA 2VPEA 3ZPVE 4V3LC 1BORA 3EB5A 2ZETC 2JRJA 2HDPA 2BAYA 1T1HA 3KV5A 2MIQA 4UP5A 4WZ2A 4YBMA 3SOWA 4AP4A 1WILA 3SOUA 1JM7B 2L43A 4PPEA 2FUIA 5AITA 5B75A 2ECWA 4I7CA 3ZNIA 3T6RA 2Y1MA 2YYRA 2YHNA 3KV6A 3ASLA 1X4IA 2KWKA 2YQLA 5KH3A 4PTBA 2LXPC 2LV9A 5LKUA 3N9MA 2Y1NA 1WFKA 2VJFA 2RSDA 1XWHA 3PHDA 1WEEA 2QJ0A 2KREA 2CKLB 2M3HA 2M6MA 5B76A 2LN0A 2D8SA 1VD4A 2LQ6A 3HCUA 4WZ3B 2K16A 4QF3A 5EYAF 3U5MA 2YQMA 2H0DB 2VPDA 4L58A 4LLBA 4I7DA 5KH7A 1WEVA 2MUMA 5DKAA 4ZDTA 2YSJA 4A0CD 1U6GB 5JG6A 2KR4A 4YADA 2KWJA 1LDKC 3LQJA 2YT5A 5C11A 5D1LB 3O7AA 4GNEA 5H1VA 2ECNA 1IYMA 4AYCB 1Z60A 2L80A 2MD8C 3FL2A 2MT5A 2PUYA 2EA6A 5LKZA 2NAAA 3O70A 2IDAA 2VJEA 5LKXA 4UI9B 1G25A 4NN2A 4WA6A 3EB6A 4FO9A 2RI7A 1WE9A 4QF2A 5FB1A 3T7LA 2G45A 4B7YC 2CSYA 1WESA 3M99A 4UP0A 2HYED 2CSZA 3RPGB 3DPLR 3O36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1X A;  3O35 A;  2LXH C;  3GL6 A;  2K17 A;  3HTK C;  3O33 A;  5B79 A;  3N9P A;  5KH9 A;  2CT2 A;  2L0B A;  4ZUX U;  2AN6 A;  3U5O A;  1X4U A;  1F62 A;  4XI1 A;  4LK9 A;  2FUU A;  1LDJ B;  3ZVZ B;  2KIZ A;  5DIN A;  4BHW A;  4R8P K;  1K2F A;  2KU3 A;  4GNF A;  4B86 C;  1CHC A;  2KWO A;  4A4C A;  2G6Q A;  1X4J A;  3ZTG A;  2MNZ A;  2YHO A;  4R7E A;  2OXQ C;  2F6J A;  4FJC A;  3M62 A;  2L75 A;  3LQH A;  4AUQ B;  2VPG A;  2LDR A;  4LKA A;  5J3X A;  4YAB A;  5B78 A;  4X3G A;  4N4F A;  3RTR B;  4L7X A;  2LGL A;  2MA5 A;  2LGG A;  3N9Q A;  5LCW B;  4R2Y A;  1Z6U A;  3N9O A;  4I7B A;  1WEO A;  4YAT A;  2YU4 A;  5TDW A;  1HYJ A;  2G43 A;  3N9N A;  2VP7 A;  1ZBD B;  3ZYQ A;  2CKL A;  3LQI A;  4TKP B;  2PNX A;  4O64 A;  1WEQ A;  4ZQL A;  2MD7 B;  5FB0 A;  3KNV A;  3RPG C;  5TAB A;  2H0D A;  5TDR A;  3ZPV 1;  1JOC A;  1WEP A;  2ECI A;  3SOX A;  3PUR A;  3HCT A;  2YSM A;  3L1Z B;  2M85 A;  4C9Z A;  2YW8 A;  2M1R A;  3IHP A;  5H9M A;  4YBT A;  4GB0 A;  3U5P A;  4S3O B;  2QIZ A;  2C2L A;  2Y43 A;  2YRE A;  2F6N A;  5AIU A;  4YBS A;  3ZVY A;  4AYC A;  2KGI A;  4GNG A;  5I3L A;  4F52 B;  2F42 A;  2K1J A;  5G05 B;  4YAX A;  2JMD A;  3MHH A;  2QIC A;  2I50 A;  2ECV A;  4CCG X;  2VJF B;  4IC2 A;  4MVT A;  2ECT A;  1VFY A;  1WGM A;  5H1T A;  3N9L A;  2LGV A;  5G04 B;  1WEU A;  5D1M B;  1VYX A;  3O34 A;  3NG2 A;  2E6R A;  3M63 A;  1FP0 A;  2EGP A;  2VPB A;  1V87 A;  4LAD B;  5TRB A;  5H1U A;  3L11 A;  1JM7 A;  4GND A;  4A4B A;  4P5O B;  5B8D A;  3QZV A;  3C6W A;  2LGK A;  2ECG A;  5FEY A;  2JMJ A;  5G0F A;  1DVP A;  2FSA A;  4FIP A;  2YUR A;  1WEW A;  4AVX A;  2C2V S;  2KGG A;  3LRQ A;  2JMI A;  3PUQ A;  4W4U A;  1N87 A;  5D1K B;  1Z2Q A;  2VJE B;  2MNY A;  2KWN A;  3GV4 A;  3VK6 A;  4BBQ A;  5B77 A;  1MM2 A;  4A49 A;  4S3O C;  4N3W A;  1E4U A;  2XB1 A;  3KQI A;  2VNF A;  5LKT A;  4Q6F A;  3DQV R;  1WEN A;  1FBV A;  3O37 A;  4MSX A;  4IC3 A;  1HYI A;  4CA1 A;  2UZG A;  3C5K A;  3I2D A;  1WIM A;  2DX8 A;  1WEM A;  5C13 A;  2MA6 A;  3SHB A;  3MHS A;  5FER A;  2EOD A;  1RMD A;  2LRI C;  3U5N A;  4FK5 A;  3HCS A;  4V3K C;  4YC9 A;  2KE1 A;  2E6S A;  4WZ0 A;  4LJN A;  3V43 A;  2K4D A;  2KFT A;  2KYU A;  2ECJ A;  2L5U A;  2YUC A;  1MM3 A;  2XEU A;  5TBN A;  2VPE A;  3ZPV E;  4V3L C;  1BOR A;  3EB5 A;  2ZET C;  2JRJ A;  2HDP A;  2BAY A;  1T1H A;  3KV5 A;  2MIQ A;  4UP5 A;  4WZ2 A;  4YBM A;  3SOW A;  4AP4 A;  1WIL A;  3SOU A;  1JM7 B;  2L43 A;  4PPE A;  2FUI A;  5AIT A;  5B75 A;  2ECW A;  4I7C A;  3ZNI A;  3T6R A;  2Y1M A;  2YYR A;  2YHN A;  3KV6 A;  3ASL A;  1X4I A;  2KWK A;  2YQL A;  5KH3 A;  4PTB A;  2LXP C;  2LV9 A;  5LKU A;  3N9M A;  2Y1N A;  1WFK A;  2VJF A;  2RSD A;  1XWH A;  3PHD A;  1WEE A;  2QJ0 A;  2KRE A;  2CKL B;  2M3H A;  2M6M A;  5B76 A;  2LN0 A;  2D8S A;  1VD4 A;  2LQ6 A;  3HCU A;  4WZ3 B;  2K16 A;  4QF3 A;  5EYA F;  3U5M A;  2YQM A;  2H0D B;  2VPD A;  4L58 A;  4LLB A;  4I7D A;  5KH7 A;  1WEV A;  2MUM A;  5DKA A;  4ZDT A;  2YSJ A;  4A0C D;  1U6G B;  5JG6 A;  2KR4 A;  4YAD A;  2KWJ A;  1LDK C;  3LQJ A;  2YT5 A;  5C11 A;  5D1L B;  3O7A A;  4GNE A;  5H1V A;  2ECN A;  1IYM A;  4AYC B;  1Z60 A;  2L80 A;  2MD8 C;  3FL2 A;  2MT5 A;  2PUY A;  2EA6 A;  5LKZ A;  2NAA A;  3O70 A;  2IDA A;  2VJE A;  5LKX A;  4UI9 B;  1G25 A;  4NN2 A;  4WA6 A;  3EB6 A;  4FO9 A;  2RI7 A;  1WE9 A;  4QF2 A;  5FB1 A;  3T7L A;  2G45 A;  4B7Y C;  2CSY A;  1WES A;  3M99 A;  4UP0 A;  2HYE D;  2CSZ A;  3RPG B;  3DPL R;  3O36 A; 
#chains in the Genus database with same CATH topology
 3L1X A;  3O35 A;  2LXH C;  2L7P A;  3GL6 A;  4OGE A;  2K17 A;  3HTK C;  3O33 A;  5B79 A;  3N9P A;  5KH9 A;  2E61 A;  2CT2 A;  2L0B A;  4ZUX U;  2AN6 A;  3U5O A;  2CRW A;  1X4U A;  1F62 A;  4XI1 A;  4LK9 A;  2FUU A;  3O47 A;  3LJU X;  1LDJ B;  3ZVZ B;  2KIZ A;  5DIN A;  5SVI B;  4BHW A;  4R8P K;  1K2F A;  2KU3 A;  4GNF A;  4B86 C;  2RR4 A;  3FM8 C;  1CHC A;  2KWO A;  2EGM A;  4A4C A;  2G6Q A;  1X4J A;  3ZTG A;  2MNZ A;  2YHO A;  3MDB C;  4R7E A;  2OXQ C;  2F6J A;  4FJC A;  3M62 A;  2L75 A;  3LQH A;  4AUQ B;  2VPG A;  2LDR A;  2B0O E;  4LKA A;  5J3X A;  4Z0O A;  1DCQ A;  4YAB A;  5B78 A;  4X3G A;  4N4F A;  3RTR B;  4L7X A;  2LGL A;  2MA5 A;  2LGG A;  3M7K A;  2P57 A;  3N9Q A;  5LCW B;  4R2Y A;  1Z6U A;  2XP0 A;  3N9O A;  4I7B A;  1WEO A;  2EXU A;  4YAT A;  2YU4 A;  5TDW A;  1HYJ A;  2G43 A;  3N9N A;  2VP7 A;  1ZBD B;  3ZYQ A;  2CKL A;  3LQI A;  4TKP B;  2IQJ A;  3DDT A;  2D8U A;  2PNX A;  4O64 A;  5SVX A;  1WEQ A;  4ZQL A;  2MD7 B;  5FB0 A;  3KNV A;  3RPG C;  5TAB A;  5SVY A;  2H0D A;  5TDR A;  3ZPV 1;  3LVQ E;  1JOC A;  1WEP A;  2ECI A;  3SOX A;  3PUR A;  3HCT A;  2YSM A;  3L1Z B;  2M85 A;  4C9Z A;  2YW8 A;  2M1R A;  3IHP A;  5H9M A;  4YBT A;  4GB0 A;  2XOY A;  3U5P A;  4S3O B;  2QIZ A;  2C2L A;  2Y43 A;  2YRE A;  2F6N A;  5AIU A;  4YBS A;  4OGC A;  3ZVY A;  4AYC A;  2KGI A;  4GNG A;  5I3L A;  4F52 B;  3H7H A;  2F42 A;  2K1J A;  5G05 B;  4YAX A;  2JMD A;  3MHH A;  3LDY A;  2QIC A;  2I50 A;  2ECV A;  4CCG X;  2VJF B;  4IC2 A;  4MVT A;  2ECT A;  1VFY A;  1WGM A;  2JM3 A;  5H1T A;  2XOZ A;  3N9L A;  2LGV A;  2MKE A;  5G04 B;  1WEU A;  5D1M B;  1VYX A;  2DJA A;  3O34 A;  3NG2 A;  2E6R A;  3M63 A;  1FP0 A;  2EGP A;  2VPB A;  1V87 A;  4LAD B;  5TRB A;  5H1U A;  3L11 A;  1JM7 A;  4GND A;  4A4B A;  4P5O B;  3E2D A;  4H9D A;  3QZV A;  3C6W A;  4O62 A;  3DWD A;  5B8D A;  2LGK A;  2ECG A;  5FEY A;  2JMJ A;  5G0F A;  1DVP A;  2FSA A;  4Z0R A;  2YVR A;  4FIP A;  2YUR A;  1WEW A;  4AVX A;  2C2V S;  2KGG A;  3LRQ A;  2OWA A;  5SVI A;  2JMI A;  3PUQ A;  4QQ4 A;  4W4U A;  1N87 A;  5D1K B;  1Z2Q A;  2VJE B;  2MNY A;  2KWN A;  3GV4 A;  3VK6 A;  4BBQ A;  5B77 A;  1MM2 A;  2JUN A;  4A49 A;  4S3O C;  4N3W A;  2XOC A;  1E4U A;  2XB1 A;  3KQI A;  2VNF A;  1MBM A;  5LKT A;  3KDE C;  3JUE A;  4Q6F A;  3DQV R;  1WEN A;  1FBV A;  3O37 A;  4MSX A;  4IC3 A;  1HYI A;  4CA1 A;  2UZG A;  3C5K A;  3I2D A;  1WIM A;  2DX8 A;  1WEM A;  5C13 A;  2MA6 A;  3SHB A;  3MHS A;  5FER A;  2EOD A;  1RMD A;  2LRI C;  3PLW A;  3U5N A;  4FK5 A;  3HCS A;  4V3K C;  3FJU B;  4YC9 A;  2KE1 A;  2E6S A;  4WZ0 A;  4LJN A;  3V43 A;  2DSM A;  2K4D A;  2KFT A;  2KYU A;  2ECJ A;  2L5U A;  2YUC A;  1MM3 A;  2XEU A;  5TBN A;  2VPE A;  3ZPV E;  4V3L C;  1BOR A;  3EB5 A;  2KKX A;  2JRJ A;  2ZET C;  2HDP A;  2BAY A;  1T1H A;  3KV5 A;  2MIQ A;  4UP5 A;  4WZ2 A;  4YBM A;  3SOW A;  4AP4 A;  1WIL A;  3SOU A;  1JM7 B;  2L43 A;  3T9K A;  3Q1D A;  4PPE A;  2FUI A;  2CRR A;  3FEH A;  5AIT A;  5B75 A;  3FAN A;  2ECW A;  4I7C A;  3ZNI A;  3T6R A;  2Y1M A;  2YYR A;  2YHN A;  3KV6 A;  3SUB A;  3ASL A;  1X4I A;  2KWK A;  2YQL A;  3FAO A;  5KH3 A;  4PTB A;  2LXP C;  2LV9 A;  5LKU A;  3N9M A;  2Y1N A;  1WFK A;  2VJF A;  2RSD A;  1XWH A;  3PHD A;  1WEE A;  2QJ0 A;  2CON A;  2KRE A;  2CKL B;  2M3H A;  2M6M A;  3LVR E;  5B76 A;  2LN0 A;  2D8S A;  1VD4 A;  2LQ6 A;  3HCU A;  4WZ3 B;  2K16 A;  4QF3 A;  5EYA F;  3U5M A;  2YQM A;  2H0D B;  2VPD A;  4L58 A;  4LLB A;  4I7D A;  5KH7 A;  1WEV A;  2MUM A;  5DKA A;  4ZDT A;  2YSJ A;  4A0C D;  2FD4 A;  1U6G B;  5JG6 A;  2KR4 A;  4YAD A;  2KWJ A;  1LDK C;  3LQJ A;  2YT5 A;  5C11 A;  5D1L B;  3O7A A;  2KKY A;  4F1P A;  4GNE A;  5H1V A;  2ECN A;  1IYM A;  4AYC B;  2LAU A;  2FFW A;  1Z60 A;  2L80 A;  2MD8 C;  3FL2 A;  2MT5 A;  2PUY A;  5K3Q A;  2EA6 A;  5LKZ A;  2NAA A;  3O70 A;  2IDA A;  2VJE A;  5LKX A;  4UI9 B;  1G25 A;  4NN2 A;  4WA6 A;  3EB6 A;  4FO9 A;  2M13 A;  2RI7 A;  1WE9 A;  4QF2 A;  5FB1 A;  3T7L A;  2G45 A;  4B7Y C;  2CSY A;  1WES A;  3M99 A;  4UP0 A;  2CSV A;  2HYE D;  2CSZ A;  3RPG B;  3DPL R;  3O36 A; 
#chains in the Genus database with same CATH homology
 3L1X A;  3O35 A;  2LXH C;  3GL6 A;  2K17 A;  3HTK C;  3O33 A;  5B79 A;  3N9P A;  5KH9 A;  2CT2 A;  2L0B A;  4ZUX U;  2AN6 A;  3U5O A;  1X4U A;  1F62 A;  4XI1 A;  4LK9 A;  2FUU A;  1LDJ B;  3ZVZ B;  2KIZ A;  5DIN A;  4BHW A;  4R8P K;  1K2F A;  2KU3 A;  4GNF A;  4B86 C;  1CHC A;  2KWO A;  4A4C A;  2G6Q A;  1X4J A;  3ZTG A;  2MNZ A;  2YHO A;  4R7E A;  2OXQ C;  2F6J A;  4FJC A;  3M62 A;  2L75 A;  3LQH A;  4AUQ B;  2VPG A;  2LDR A;  4LKA A;  5J3X A;  4YAB A;  5B78 A;  4X3G A;  4N4F A;  3RTR B;  4L7X A;  2LGL A;  2MA5 A;  2LGG A;  3N9Q A;  5LCW B;  4R2Y A;  1Z6U A;  3N9O A;  4I7B A;  1WEO A;  4YAT A;  2YU4 A;  5TDW A;  1HYJ A;  2G43 A;  3N9N A;  2VP7 A;  1ZBD B;  3ZYQ A;  2CKL A;  3LQI A;  4TKP B;  2PNX A;  4O64 A;  1WEQ A;  4ZQL A;  2MD7 B;  5FB0 A;  3KNV A;  3RPG C;  5TAB A;  2H0D A;  5TDR A;  3ZPV 1;  1JOC A;  1WEP A;  2ECI A;  3SOX A;  3PUR A;  3HCT A;  2YSM A;  3L1Z B;  2M85 A;  4C9Z A;  2YW8 A;  2M1R A;  3IHP A;  5H9M A;  4YBT A;  4GB0 A;  3U5P A;  4S3O B;  2QIZ A;  2C2L A;  2Y43 A;  2YRE A;  2F6N A;  5AIU A;  4YBS A;  3ZVY A;  4AYC A;  2KGI A;  4GNG A;  5I3L A;  4F52 B;  2F42 A;  2K1J A;  5G05 B;  4YAX A;  2JMD A;  3MHH A;  2QIC A;  2I50 A;  2ECV A;  4CCG X;  2VJF B;  4IC2 A;  4MVT A;  2ECT A;  1VFY A;  1WGM A;  5H1T A;  3N9L A;  2LGV A;  5G04 B;  1WEU A;  5D1M B;  1VYX A;  3O34 A;  3NG2 A;  2E6R A;  3M63 A;  1FP0 A;  2EGP A;  2VPB A;  1V87 A;  4LAD B;  5TRB A;  5H1U A;  3L11 A;  1JM7 A;  4GND A;  4A4B A;  4P5O B;  5B8D A;  3QZV A;  3C6W A;  2LGK A;  2ECG A;  5FEY A;  2JMJ A;  5G0F A;  1DVP A;  2FSA A;  4FIP A;  2YUR A;  1WEW A;  4AVX A;  2C2V S;  2KGG A;  3LRQ A;  2JMI A;  3PUQ A;  4W4U A;  1N87 A;  5D1K B;  1Z2Q A;  2VJE B;  2MNY A;  2KWN A;  3GV4 A;  3VK6 A;  4BBQ A;  5B77 A;  1MM2 A;  4A49 A;  4S3O C;  4N3W A;  1E4U A;  2XB1 A;  3KQI A;  2VNF A;  5LKT A;  4Q6F A;  3DQV R;  1WEN A;  1FBV A;  3O37 A;  4MSX A;  4IC3 A;  1HYI A;  4CA1 A;  2UZG A;  3C5K A;  3I2D A;  1WIM A;  2DX8 A;  1WEM A;  5C13 A;  2MA6 A;  3SHB A;  3MHS A;  5FER A;  2EOD A;  1RMD A;  2LRI C;  3U5N A;  4FK5 A;  3HCS A;  4V3K C;  4YC9 A;  2KE1 A;  2E6S A;  4WZ0 A;  4LJN A;  3V43 A;  2K4D A;  2KFT A;  2KYU A;  2ECJ A;  2L5U A;  2YUC A;  1MM3 A;  2XEU A;  5TBN A;  2VPE A;  3ZPV E;  4V3L C;  1BOR A;  3EB5 A;  2ZET C;  2JRJ A;  2HDP A;  2BAY A;  1T1H A;  3KV5 A;  2MIQ A;  4UP5 A;  4WZ2 A;  4YBM A;  3SOW A;  4AP4 A;  1WIL A;  3SOU A;  1JM7 B;  2L43 A;  4PPE A;  2FUI A;  5AIT A;  5B75 A;  2ECW A;  4I7C A;  3ZNI A;  3T6R A;  2Y1M A;  2YYR A;  2YHN A;  3KV6 A;  3ASL A;  1X4I A;  2KWK A;  2YQL A;  5KH3 A;  4PTB A;  2LXP C;  2LV9 A;  5LKU A;  3N9M A;  2Y1N A;  1WFK A;  2VJF A;  2RSD A;  1XWH A;  3PHD A;  1WEE A;  2QJ0 A;  2KRE A;  2CKL B;  2M3H A;  2M6M A;  5B76 A;  2LN0 A;  2D8S A;  1VD4 A;  2LQ6 A;  3HCU A;  4WZ3 B;  2K16 A;  4QF3 A;  5EYA F;  3U5M A;  2YQM A;  2H0D B;  2VPD A;  4L58 A;  4LLB A;  4I7D A;  5KH7 A;  1WEV A;  2MUM A;  5DKA A;  4ZDT A;  2YSJ A;  4A0C D;  1U6G B;  5JG6 A;  2KR4 A;  4YAD A;  2KWJ A;  1LDK C;  3LQJ A;  2YT5 A;  5C11 A;  5D1L B;  3O7A A;  4GNE A;  5H1V A;  2ECN A;  1IYM A;  4AYC B;  1Z60 A;  2L80 A;  2MD8 C;  3FL2 A;  2MT5 A;  2PUY A;  2EA6 A;  5LKZ A;  2NAA A;  3O70 A;  2IDA A;  2VJE A;  5LKX A;  4UI9 B;  1G25 A;  4NN2 A;  4WA6 A;  3EB6 A;  4FO9 A;  2RI7 A;  1WE9 A;  4QF2 A;  5FB1 A;  3T7L A;  2G45 A;  4B7Y C;  2CSY A;  1WES A;  3M99 A;  4UP0 A;  2HYE D;  2CSZ A;  3RPG B;  3DPL R;  3O36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...