1MM3A

Solution structure of the 2nd phd domain from mi2b with c-terminal loop replaced by corresponding loop from wstf
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
61
structure length
61
Chain Sequence
GPLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLRPALYEVPDGEWQCPRCTCPALKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering a Protein Scaffold from a PHD Finger
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/transcription
molecule keywords Mi2-beta(Chromodomain helicase-DNA-binding protein 4) and tr
total genus 8
structure length 61
sequence length 61
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2002-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1mm3A00
2UZGA 2JMJA 2YU4A 2YSJA 3V43A 3DPLR 5LKXA 2JRJA 1WGMA 4UI9B 4YBSA 2ZETC 2JMIA 2MD7B 5D1MB 2L80A 2YHNA 2RI7A 2EA6A 5KH9A 3L1XA 2QIZA 2KR4A 2BAYA 5LKUA 1WEPA 2VPEA 4AYCB 2Y1NA 2YW8A 1FBVA 4FIPA 5H9MA 3PHDA 4A4CA 2M85A 5G04B 1WEWA 2G43A 4S3OB 1WENA 5KH3A 2CT2A 2XB1A 2FSAA 2PNXA 4I7BA 3LQJA 3N9MA 4FO9A 4R7EA 2F42A 2ECWA 2LDRA 1VFYA 4B7YC 3U5MA 4A49A 4FK5A 3ZVZB 1X4JA 5TDWA 4LADB 3N9PA 2F6NA 3PURA 4I7DA 4N4FA 2E6RA 3GV4A 1CHCA 2LGVA 3T7LA 4PTBA 2ECGA 5TBNA 2EODA 2EGPA 4AVXA 2NAAA 5TDRA 3VK6A 3O33A 3L11A 1VYXA 2VPGA 2E6SA 2YQMA 3C6WA 4GNDA 5FERA 2LXPC 4O64A 3T6RA 2C2LA 3LQHA 1MM2A 2LV9A 2MA5A 2MA6A 2ECTA 4TKPB 2VJEA 2K17A 5B75A 3SOWA 4GB0A 1WEEA 3O37A 1XWHA 5KH7A 1VD4A 1HYIA 2OXQC 2CKLB 2CKLA 1LDJB 2MIQA 2I50A 4QF3A 3N9NA 3N9LA 2LXHC 4N3WA 5C13A 2YREA 2FUUA 1G25A 1Z60A 3U5PA 2F6JA 3MHHA 2MNZA 2PUYA 4CA1A 2ECIA 2L5UA 4A4BA 4I7CA 5C11A 5H1VA 2M3HA 4CCGX 2KWOA 2KWNA 3LQIA 2K4DA 4ZDTA 4YATA 3N9OA 1FP0A 4AP4A 1HYJA 1WIMA 5TABA 3ZPV1 3LRQA 3HTKC 4IC2A 2G6QA 4WZ2A 2KGGA 4A0CD 4R2YA 3ZTGA 3RTRB 5I3LA 4V3KC 4LJNA 1BORA 2KYUA 4X3GA 1F62A 3HCUA 5G05B 2ECVA 3MHSA 3M62A 4YC9A 2ECNA 1WILA 2XEUA 2KFTA 5D1KB 3RPGC 5LKZA 3SHBA 5JG6A 1E4UA 5B79A 3FL2A 1WEUA 2VPDA 3O34A 1X4UA 2YUCA 4MSXA 2KE1A 3O7AA 2KREA 4GNEA 2MT5A 3SOUA 3ZNIA 4WA6A 2CSYA 3NG2A 3HCSA 1RMDA 2MD8C 1V87A 3HCTA 4AYCA 2H0DA 1LDKC 4AUQB 4P5OB 2HDPA 2HYED 4XI1A 5J3XA 1WEVA 4LKAA 1JOCA 2IDAA 2AN6A 2K1JA 4YADA 5D1LB 3KNVA 4MVTA 4L7XA 5G0FA 4LLBA 5FB0A 3C5KA 1ZBDB 2KGIA 2VPBA 1WFKA 2FUIA 4R8PK 1WEOA 4BHWA 2JMDA 3GL6A 3KV5A 5B78A 2MNYA 3I2DA 4Q6FA 1U6GB 2LRIC 2DX8A 4YAXA 2LGKA 2QICA 4NN2A 2VJFB 4ZUXU 4FJCA 3PUQA 1IYMA 4IC3A 5DINA 1Z2QA 3QZVA 2M6MA 2YSMA 1N87A 2H0DB 2RSDA 3ASLA 3M63A 2QJ0A 2VNFA 3KV6A 4GNGA 5AIUA 1Z6UA 1X4IA 2LQ6A 1WE9A 4ZQLA 5H1UA 4L58A 1K2FA 5LCWB 2YT5A 3U5OA 4WZ0A 2C2VS 2YQLA 4BBQA 2Y43A 2Y1MA 4YBTA 3SOXA 2LGLA 2L75A 3O36A 4UP0A 3M99A 2YURA 4UP5A 2K16A 1DVPA 5DKAA 4S3OC 1T1HA 2VP7A 3DQVR 5B77A 4QF2A 3IHPA 2KWKA 2KIZA 3ZVYA 3ZPVE 3RPGB 4C9ZA 4V3LC 4LK9A 5LKTA 5EYAF 4YBMA 3O35A 4B86C 1JM7A 1JM7B 2L0BA 5FEYA 1MM3A 3KQIA 3O70A 2VJFA 4F52B 2YYRA 1WESA 2MUMA 2D8SA 2YHOA 4WZ3B 5FB1A 3U5NA 2KU3A 4GNFA 2G45A 2CSZA 2LN0A 3EB6A 5H1TA 4YABA 1WEMA 4PPEA 2KWJA 1WEQA 5TRBA 2L43A 2M1RA 3L1ZB 4W4UA 2LGGA 3N9QA 2VJEB 3EB5A 3ZYQA 5B76A 2ECJA 5AITA 5B8DA
chains in the Genus database with same CATH superfamily
3LVQE 2UZGA 2JMJA 3Q1DA 2YU4A 2YSJA 3V43A 2KKXA 3DPLR 5LKXA 2JRJA 1WGMA 4UI9B 4YBSA 2ZETC 3MDBC 2JMIA 2MD7B 5D1MB 2L80A 2YHNA 4Z0OA 2RI7A 2EA6A 5KH9A 3L1XA 2QIZA 2KR4A 2BAYA 5LKUA 1WEPA 2VPEA 4AYCB 2Y1NA 2YW8A 1FBVA 4FIPA 5H9MA 3PHDA 4F1PA 4A4CA 2M85A 5G04B 1WEWA 2G43A 4S3OB 1WENA 5KH3A 2CT2A 3KDEC 5SVIB 2XB1A 2FSAA 2DSMA 2PNXA 4I7BA 2EXUA 3FEHA 3LQJA 3N9MA 4FO9A 4R7EA 2F42A 2ECWA 2LDRA 1VFYA 4B7YC 3LVRE 3U5MA 4A49A 2KKYA 4FK5A 3ZVZB 1X4JA 5TDWA 4LADB 3N9PA 2F6NA 3PURA 4I7DA 4N4FA 2E6RA 3GV4A 3FAOA 1CHCA 2LGVA 3T7LA 4PTBA 3T9KA 2ECGA 5TBNA 2EODA 2EGPA 4AVXA 2NAAA 1DCQA 2LAUA 2XOCA 2XOYA 5TDRA 3VK6A 3O33A 3L11A 1VYXA 2M13A 2VPGA 2E6SA 2YQMA 3C6WA 4GNDA 5K3QA 5FERA 2LXPC 4O64A 3T6RA 2C2LA 3LQHA 1MM2A 2LV9A 2MA5A 2MA6A 2ECTA 4Z0RA 4TKPB 2VJEA 2K17A 2XOZA 5B75A 3SOWA 4GB0A 1WEEA 3O37A 1XWHA 5KH7A 1VD4A 3DDTA 1HYIA 2OXQC 2CKLB 2DJAA 2CKLA 1LDJB 2MIQA 2I50A 4QF3A 3N9NA 3N9LA 2LXHC 4N3WA 5C13A 2JUNA 2D8UA 2YREA 2FUUA 1G25A 4QQ4A 1Z60A 3U5PA 2F6JA 3MHHA 2MNZA 2PUYA 4CA1A 2ECIA 2L5UA 4A4BA 4I7CA 5C11A 5H1VA 2M3HA 4CCGX 2KWOA 2KWNA 3LQIA 2K4DA 4ZDTA 4YATA 3N9OA 1FP0A 4AP4A 1HYJA 1WIMA 5TABA 3ZPV1 3LRQA 3HTKC 4IC2A 2G6QA 4WZ2A 2KGGA 4A0CD 2CRWA 4R2YA 3ZTGA 3RTRB 5I3LA 4V3KC 2OWAA 4LJNA 1BORA 2KYUA 4X3GA 1F62A 3HCUA 5G05B 3FM8C 2ECVA 3MHSA 3M62A 4YC9A 2ECNA 3PLWA 1WILA 2XEUA 2MKEA 2KFTA 5D1KB 2FD4A 3RPGC 5LKZA 3SHBA 5JG6A 1E4UA 5B79A 3FL2A 3M7KA 1WEUA 2VPDA 3O34A 1X4UA 2YUCA 4MSXA 2KE1A 3O7AA 4OGEA 2KREA 4GNEA 2MT5A 3SOUA 3ZNIA 2E61A 4WA6A 2CSYA 3NG2A 3HCSA 1RMDA 2MD8C 1V87A 3E2DA 3HCTA 3O47A 4AYCA 2H0DA 3JUEA 1LDKC 4AUQB 4P5OB 2FFWA 2HDPA 2HYED 4XI1A 5J3XA 2EGMA 3FANA 1WEVA 4LKAA 1JOCA 2IDAA 2AN6A 2K1JA 4YADA 5D1LB 3KNVA 5SVXA 4MVTA 3LJUX 4L7XA 2IQJA 5SVIA 5G0FA 4LLBA 5FB0A 4OGCA 3C5KA 1ZBDB 2KGIA 2VPBA 1WFKA 2FUIA 3LDYA 4R8PK 1WEOA 4BHWA 2JMDA 3GL6A 2B0OE 3KV5A 5B78A 2RR4A 2MNYA 3I2DA 2XP0A 4Q6FA 1U6GB 2LRIC 2DX8A 3FJUB 4YAXA 2LGKA 2QICA 4NN2A 2VJFB 4ZUXU 4FJCA 3PUQA 1IYMA 4IC3A 5DINA 1Z2QA 4O62A 3QZVA 2M6MA 2YSMA 1N87A 2H0DB 2RSDA 3ASLA 3M63A 2QJ0A 2VNFA 2P57A 3KV6A 4GNGA 5AIUA 4H9DA 1Z6UA 2JM3A 1MBMA 1X4IA 2LQ6A 1WE9A 4ZQLA 3H7HA 4L58A 1K2FA 5H1UA 5LCWB 2YT5A 2YVRA 3U5OA 4WZ0A 2CSVA 2C2VS 2YQLA 4BBQA 2Y43A 2Y1MA 4YBTA 3SOXA 2LGLA 2CRRA 2L75A 3O36A 4UP0A 3M99A 2YURA 4UP5A 2K16A 1DVPA 5DKAA 4S3OC 1T1HA 2VP7A 3DQVR 5B77A 4QF2A 3IHPA 2KWKA 2KIZA 3ZVYA 3ZPVE 3RPGB 4C9ZA 4V3LC 5SVYA 4LK9A 5LKTA 5EYAF 4YBMA 3O35A 2CONA 4B86C 1JM7A 1JM7B 2L0BA 2L7PA 5FEYA 1MM3A 3KQIA 3O70A 2VJFA 4F52B 2YYRA 1WESA 2MUMA 2D8SA 2YHOA 4WZ3B 5FB1A 3U5NA 2KU3A 4GNFA 2G45A 3SUBA 2CSZA 2LN0A 3EB6A 5H1TA 4YABA 1WEMA 4PPEA 2KWJA 1WEQA 5TRBA 2L43A 2M1RA 3L1ZB 4W4UA 2LGGA 3N9QA 3DWDA 2VJEB 3EB5A 3ZYQA 5B76A 2ECJA 5AITA 5B8DA
chains in the Genus database with same CATH topology
2UZGA 2JMJA 2YU4A 2YSJA 3V43A 3DPLR 5LKXA 2JRJA 1WGMA 4UI9B 4YBSA 2ZETC 2JMIA 2MD7B 5D1MB 2L80A 2YHNA 2RI7A 2EA6A 5KH9A 3L1XA 2QIZA 2KR4A 2BAYA 5LKUA 1WEPA 2VPEA 4AYCB 2Y1NA 2YW8A 1FBVA 4FIPA 5H9MA 3PHDA 4A4CA 2M85A 5G04B 1WEWA 2G43A 4S3OB 1WENA 5KH3A 2CT2A 2XB1A 2FSAA 2PNXA 4I7BA 3LQJA 3N9MA 4FO9A 4R7EA 2F42A 2ECWA 2LDRA 1VFYA 4B7YC 3U5MA 4A49A 4FK5A 3ZVZB 1X4JA 5TDWA 4LADB 3N9PA 2F6NA 3PURA 4I7DA 4N4FA 2E6RA 3GV4A 1CHCA 2LGVA 3T7LA 4PTBA 2ECGA 5TBNA 2EODA 2EGPA 4AVXA 2NAAA 5TDRA 3VK6A 3O33A 3L11A 1VYXA 2VPGA 2E6SA 2YQMA 3C6WA 4GNDA 5FERA 2LXPC 4O64A 3T6RA 2C2LA 3LQHA 1MM2A 2LV9A 2MA5A 2MA6A 2ECTA 4TKPB 2VJEA 2K17A 5B75A 3SOWA 4GB0A 1WEEA 3O37A 1XWHA 5KH7A 1VD4A 1HYIA 2OXQC 2CKLB 2CKLA 1LDJB 2MIQA 2I50A 4QF3A 3N9NA 3N9LA 2LXHC 4N3WA 5C13A 2YREA 2FUUA 1G25A 1Z60A 3U5PA 2F6JA 3MHHA 2MNZA 2PUYA 4CA1A 2ECIA 2L5UA 4A4BA 4I7CA 5C11A 5H1VA 2M3HA 4CCGX 2KWOA 2KWNA 3LQIA 2K4DA 4ZDTA 4YATA 3N9OA 1FP0A 4AP4A 1HYJA 1WIMA 5TABA 3ZPV1 3LRQA 3HTKC 4IC2A 2G6QA 4WZ2A 2KGGA 4A0CD 4R2YA 3ZTGA 3RTRB 5I3LA 4V3KC 4LJNA 1BORA 2KYUA 4X3GA 1F62A 3HCUA 5G05B 2ECVA 3MHSA 3M62A 4YC9A 2ECNA 1WILA 2XEUA 2KFTA 5D1KB 3RPGC 5LKZA 3SHBA 5JG6A 1E4UA 5B79A 3FL2A 1WEUA 2VPDA 3O34A 1X4UA 2YUCA 4MSXA 2KE1A 3O7AA 2KREA 4GNEA 2MT5A 3SOUA 3ZNIA 4WA6A 2CSYA 3NG2A 3HCSA 1RMDA 2MD8C 1V87A 3HCTA 4AYCA 2H0DA 1LDKC 4AUQB 4P5OB 2HDPA 2HYED 4XI1A 5J3XA 1WEVA 4LKAA 1JOCA 2IDAA 2AN6A 2K1JA 4YADA 5D1LB 3KNVA 4MVTA 4L7XA 5G0FA 4LLBA 5FB0A 3C5KA 1ZBDB 2KGIA 2VPBA 1WFKA 2FUIA 4R8PK 1WEOA 4BHWA 2JMDA 3GL6A 3KV5A 5B78A 2MNYA 3I2DA 4Q6FA 1U6GB 2LRIC 2DX8A 4YAXA 2LGKA 2QICA 4NN2A 2VJFB 4ZUXU 4FJCA 3PUQA 1IYMA 4IC3A 5DINA 1Z2QA 3QZVA 2M6MA 2YSMA 1N87A 2H0DB 2RSDA 3ASLA 3M63A 2QJ0A 2VNFA 3KV6A 4GNGA 5AIUA 1Z6UA 1X4IA 2LQ6A 1WE9A 4ZQLA 5H1UA 4L58A 1K2FA 5LCWB 2YT5A 3U5OA 4WZ0A 2C2VS 2YQLA 4BBQA 2Y43A 2Y1MA 4YBTA 3SOXA 2LGLA 2L75A 3O36A 4UP0A 3M99A 2YURA 4UP5A 2K16A 1DVPA 5DKAA 4S3OC 1T1HA 2VP7A 3DQVR 5B77A 4QF2A 3IHPA 2KWKA 2KIZA 3ZVYA 3ZPVE 3RPGB 4C9ZA 4V3LC 4LK9A 5LKTA 5EYAF 4YBMA 3O35A 4B86C 1JM7A 1JM7B 2L0BA 5FEYA 1MM3A 3KQIA 3O70A 2VJFA 4F52B 2YYRA 1WESA 2MUMA 2D8SA 2YHOA 4WZ3B 5FB1A 3U5NA 2KU3A 4GNFA 2G45A 2CSZA 2LN0A 3EB6A 5H1TA 4YABA 1WEMA 4PPEA 2KWJA 1WEQA 5TRBA 2L43A 2M1RA 3L1ZB 4W4UA 2LGGA 3N9QA 2VJEB 3EB5A 3ZYQA 5B76A 2ECJA 5AITA 5B8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZG A;  2JMJ A;  2YU4 A;  2YSJ A;  3V43 A;  3DPL R;  5LKX A;  2JRJ A;  1WGM A;  4UI9 B;  4YBS A;  2ZET C;  2JMI A;  2MD7 B;  5D1M B;  2L80 A;  2YHN A;  2RI7 A;  2EA6 A;  5KH9 A;  3L1X A;  2QIZ A;  2KR4 A;  2BAY A;  5LKU A;  1WEP A;  2VPE A;  4AYC B;  2Y1N A;  2YW8 A;  1FBV A;  4FIP A;  5H9M A;  3PHD A;  4A4C A;  2M85 A;  5G04 B;  1WEW A;  2G43 A;  4S3O B;  1WEN A;  5KH3 A;  2CT2 A;  2XB1 A;  2FSA A;  2PNX A;  4I7B A;  3LQJ A;  3N9M A;  4FO9 A;  4R7E A;  2F42 A;  2ECW A;  2LDR A;  1VFY A;  4B7Y C;  3U5M A;  4A49 A;  4FK5 A;  3ZVZ B;  1X4J A;  5TDW A;  4LAD B;  3N9P A;  2F6N A;  3PUR A;  4I7D A;  4N4F A;  2E6R A;  3GV4 A;  1CHC A;  2LGV A;  3T7L A;  4PTB A;  2ECG A;  5TBN A;  2EOD A;  2EGP A;  4AVX A;  2NAA A;  5TDR A;  3VK6 A;  3O33 A;  3L11 A;  1VYX A;  2VPG A;  2E6S A;  2YQM A;  3C6W A;  4GND A;  5FER A;  2LXP C;  4O64 A;  3T6R A;  2C2L A;  3LQH A;  1MM2 A;  2LV9 A;  2MA5 A;  2MA6 A;  2ECT A;  4TKP B;  2VJE A;  2K17 A;  5B75 A;  3SOW A;  4GB0 A;  1WEE A;  3O37 A;  1XWH A;  5KH7 A;  1VD4 A;  1HYI A;  2OXQ C;  2CKL B;  2CKL A;  1LDJ B;  2MIQ A;  2I50 A;  4QF3 A;  3N9N A;  3N9L A;  2LXH C;  4N3W A;  5C13 A;  2YRE A;  2FUU A;  1G25 A;  1Z60 A;  3U5P A;  2F6J A;  3MHH A;  2MNZ A;  2PUY A;  4CA1 A;  2ECI A;  2L5U A;  4A4B A;  4I7C A;  5C11 A;  5H1V A;  2M3H A;  4CCG X;  2KWO A;  2KWN A;  3LQI A;  2K4D A;  4ZDT A;  4YAT A;  3N9O A;  1FP0 A;  4AP4 A;  1HYJ A;  1WIM A;  5TAB A;  3ZPV 1;  3LRQ A;  3HTK C;  4IC2 A;  2G6Q A;  4WZ2 A;  2KGG A;  4A0C D;  4R2Y A;  3ZTG A;  3RTR B;  5I3L A;  4V3K C;  4LJN A;  1BOR A;  2KYU A;  4X3G A;  1F62 A;  3HCU A;  5G05 B;  2ECV A;  3MHS A;  3M62 A;  4YC9 A;  2ECN A;  1WIL A;  2XEU A;  2KFT A;  5D1K B;  3RPG C;  5LKZ A;  3SHB A;  5JG6 A;  1E4U A;  5B79 A;  3FL2 A;  1WEU A;  2VPD A;  3O34 A;  1X4U A;  2YUC A;  4MSX A;  2KE1 A;  3O7A A;  2KRE A;  4GNE A;  2MT5 A;  3SOU A;  3ZNI A;  4WA6 A;  2CSY A;  3NG2 A;  3HCS A;  1RMD A;  2MD8 C;  1V87 A;  3HCT A;  4AYC A;  2H0D A;  1LDK C;  4AUQ B;  4P5O B;  2HDP A;  2HYE D;  4XI1 A;  5J3X A;  1WEV A;  4LKA A;  1JOC A;  2IDA A;  2AN6 A;  2K1J A;  4YAD A;  5D1L B;  3KNV A;  4MVT A;  4L7X A;  5G0F A;  4LLB A;  5FB0 A;  3C5K A;  1ZBD B;  2KGI A;  2VPB A;  1WFK A;  2FUI A;  4R8P K;  1WEO A;  4BHW A;  2JMD A;  3GL6 A;  3KV5 A;  5B78 A;  2MNY A;  3I2D A;  4Q6F A;  1U6G B;  2LRI C;  2DX8 A;  4YAX A;  2LGK A;  2QIC A;  4NN2 A;  2VJF B;  4ZUX U;  4FJC A;  3PUQ A;  1IYM A;  4IC3 A;  5DIN A;  1Z2Q A;  3QZV A;  2M6M A;  2YSM A;  1N87 A;  2H0D B;  2RSD A;  3ASL A;  3M63 A;  2QJ0 A;  2VNF A;  3KV6 A;  4GNG A;  5AIU A;  1Z6U A;  1X4I A;  2LQ6 A;  1WE9 A;  4ZQL A;  5H1U A;  4L58 A;  1K2F A;  5LCW B;  2YT5 A;  3U5O A;  4WZ0 A;  2C2V S;  2YQL A;  4BBQ A;  2Y43 A;  2Y1M A;  4YBT A;  3SOX A;  2LGL A;  2L75 A;  3O36 A;  4UP0 A;  3M99 A;  2YUR A;  4UP5 A;  2K16 A;  1DVP A;  5DKA A;  4S3O C;  1T1H A;  2VP7 A;  3DQV R;  5B77 A;  4QF2 A;  3IHP A;  2KWK A;  2KIZ A;  3ZVY A;  3ZPV E;  3RPG B;  4C9Z A;  4V3L C;  4LK9 A;  5LKT A;  5EYA F;  4YBM A;  3O35 A;  4B86 C;  1JM7 A;  1JM7 B;  2L0B A;  5FEY A;  1MM3 A;  3KQI A;  3O70 A;  2VJF A;  4F52 B;  2YYR A;  1WES A;  2MUM A;  2D8S A;  2YHO A;  4WZ3 B;  5FB1 A;  3U5N A;  2KU3 A;  4GNF A;  2G45 A;  2CSZ A;  2LN0 A;  3EB6 A;  5H1T A;  4YAB A;  1WEM A;  4PPE A;  2KWJ A;  1WEQ A;  5TRB A;  2L43 A;  2M1R A;  3L1Z B;  4W4U A;  2LGG A;  3N9Q A;  2VJE B;  3EB5 A;  3ZYQ A;  5B76 A;  2ECJ A;  5AIT A;  5B8D A; 
#chains in the Genus database with same CATH topology
 3LVQ E;  2UZG A;  2JMJ A;  3Q1D A;  2YU4 A;  2YSJ A;  3V43 A;  2KKX A;  3DPL R;  5LKX A;  2JRJ A;  1WGM A;  4UI9 B;  4YBS A;  2ZET C;  3MDB C;  2JMI A;  2MD7 B;  5D1M B;  2L80 A;  2YHN A;  4Z0O A;  2RI7 A;  2EA6 A;  5KH9 A;  3L1X A;  2QIZ A;  2KR4 A;  2BAY A;  5LKU A;  1WEP A;  2VPE A;  4AYC B;  2Y1N A;  2YW8 A;  1FBV A;  4FIP A;  5H9M A;  3PHD A;  4F1P A;  4A4C A;  2M85 A;  5G04 B;  1WEW A;  2G43 A;  4S3O B;  1WEN A;  5KH3 A;  2CT2 A;  3KDE C;  5SVI B;  2XB1 A;  2FSA A;  2DSM A;  2PNX A;  4I7B A;  2EXU A;  3FEH A;  3LQJ A;  3N9M A;  4FO9 A;  4R7E A;  2F42 A;  2ECW A;  2LDR A;  1VFY A;  4B7Y C;  3LVR E;  3U5M A;  4A49 A;  2KKY A;  4FK5 A;  3ZVZ B;  1X4J A;  5TDW A;  4LAD B;  3N9P A;  2F6N A;  3PUR A;  4I7D A;  4N4F A;  2E6R A;  3GV4 A;  3FAO A;  1CHC A;  2LGV A;  3T7L A;  4PTB A;  3T9K A;  2ECG A;  5TBN A;  2EOD A;  2EGP A;  4AVX A;  2NAA A;  1DCQ A;  2LAU A;  2XOC A;  2XOY A;  5TDR A;  3VK6 A;  3O33 A;  3L11 A;  1VYX A;  2M13 A;  2VPG A;  2E6S A;  2YQM A;  3C6W A;  4GND A;  5K3Q A;  5FER A;  2LXP C;  4O64 A;  3T6R A;  2C2L A;  3LQH A;  1MM2 A;  2LV9 A;  2MA5 A;  2MA6 A;  2ECT A;  4Z0R A;  4TKP B;  2VJE A;  2K17 A;  2XOZ A;  5B75 A;  3SOW A;  4GB0 A;  1WEE A;  3O37 A;  1XWH A;  5KH7 A;  1VD4 A;  3DDT A;  1HYI A;  2OXQ C;  2CKL B;  2DJA A;  2CKL A;  1LDJ B;  2MIQ A;  2I50 A;  4QF3 A;  3N9N A;  3N9L A;  2LXH C;  4N3W A;  5C13 A;  2JUN A;  2D8U A;  2YRE A;  2FUU A;  1G25 A;  4QQ4 A;  1Z60 A;  3U5P A;  2F6J A;  3MHH A;  2MNZ A;  2PUY A;  4CA1 A;  2ECI A;  2L5U A;  4A4B A;  4I7C A;  5C11 A;  5H1V A;  2M3H A;  4CCG X;  2KWO A;  2KWN A;  3LQI A;  2K4D A;  4ZDT A;  4YAT A;  3N9O A;  1FP0 A;  4AP4 A;  1HYJ A;  1WIM A;  5TAB A;  3ZPV 1;  3LRQ A;  3HTK C;  4IC2 A;  2G6Q A;  4WZ2 A;  2KGG A;  4A0C D;  2CRW A;  4R2Y A;  3ZTG A;  3RTR B;  5I3L A;  4V3K C;  2OWA A;  4LJN A;  1BOR A;  2KYU A;  4X3G A;  1F62 A;  3HCU A;  5G05 B;  3FM8 C;  2ECV A;  3MHS A;  3M62 A;  4YC9 A;  2ECN A;  3PLW A;  1WIL A;  2XEU A;  2MKE A;  2KFT A;  5D1K B;  2FD4 A;  3RPG C;  5LKZ A;  3SHB A;  5JG6 A;  1E4U A;  5B79 A;  3FL2 A;  3M7K A;  1WEU A;  2VPD A;  3O34 A;  1X4U A;  2YUC A;  4MSX A;  2KE1 A;  3O7A A;  4OGE A;  2KRE A;  4GNE A;  2MT5 A;  3SOU A;  3ZNI A;  2E61 A;  4WA6 A;  2CSY A;  3NG2 A;  3HCS A;  1RMD A;  2MD8 C;  1V87 A;  3E2D A;  3HCT A;  3O47 A;  4AYC A;  2H0D A;  3JUE A;  1LDK C;  4AUQ B;  4P5O B;  2FFW A;  2HDP A;  2HYE D;  4XI1 A;  5J3X A;  2EGM A;  3FAN A;  1WEV A;  4LKA A;  1JOC A;  2IDA A;  2AN6 A;  2K1J A;  4YAD A;  5D1L B;  3KNV A;  5SVX A;  4MVT A;  3LJU X;  4L7X A;  2IQJ A;  5SVI A;  5G0F A;  4LLB A;  5FB0 A;  4OGC A;  3C5K A;  1ZBD B;  2KGI A;  2VPB A;  1WFK A;  2FUI A;  3LDY A;  4R8P K;  1WEO A;  4BHW A;  2JMD A;  3GL6 A;  2B0O E;  3KV5 A;  5B78 A;  2RR4 A;  2MNY A;  3I2D A;  2XP0 A;  4Q6F A;  1U6G B;  2LRI C;  2DX8 A;  3FJU B;  4YAX A;  2LGK A;  2QIC A;  4NN2 A;  2VJF B;  4ZUX U;  4FJC A;  3PUQ A;  1IYM A;  4IC3 A;  5DIN A;  1Z2Q A;  4O62 A;  3QZV A;  2M6M A;  2YSM A;  1N87 A;  2H0D B;  2RSD A;  3ASL A;  3M63 A;  2QJ0 A;  2VNF A;  2P57 A;  3KV6 A;  4GNG A;  5AIU A;  4H9D A;  1Z6U A;  2JM3 A;  1MBM A;  1X4I A;  2LQ6 A;  1WE9 A;  4ZQL A;  3H7H A;  4L58 A;  1K2F A;  5H1U A;  5LCW B;  2YT5 A;  2YVR A;  3U5O A;  4WZ0 A;  2CSV A;  2C2V S;  2YQL A;  4BBQ A;  2Y43 A;  2Y1M A;  4YBT A;  3SOX A;  2LGL A;  2CRR A;  2L75 A;  3O36 A;  4UP0 A;  3M99 A;  2YUR A;  4UP5 A;  2K16 A;  1DVP A;  5DKA A;  4S3O C;  1T1H A;  2VP7 A;  3DQV R;  5B77 A;  4QF2 A;  3IHP A;  2KWK A;  2KIZ A;  3ZVY A;  3ZPV E;  3RPG B;  4C9Z A;  4V3L C;  5SVY A;  4LK9 A;  5LKT A;  5EYA F;  4YBM A;  3O35 A;  2CON A;  4B86 C;  1JM7 A;  1JM7 B;  2L0B A;  2L7P A;  5FEY A;  1MM3 A;  3KQI A;  3O70 A;  2VJF A;  4F52 B;  2YYR A;  1WES A;  2MUM A;  2D8S A;  2YHO A;  4WZ3 B;  5FB1 A;  3U5N A;  2KU3 A;  4GNF A;  2G45 A;  3SUB A;  2CSZ A;  2LN0 A;  3EB6 A;  5H1T A;  4YAB A;  1WEM A;  4PPE A;  2KWJ A;  1WEQ A;  5TRB A;  2L43 A;  2M1R A;  3L1Z B;  4W4U A;  2LGG A;  3N9Q A;  3DWD A;  2VJE B;  3EB5 A;  3ZYQ A;  5B76 A;  2ECJ A;  5AIT A;  5B8D A; 
#chains in the Genus database with same CATH homology
 2UZG A;  2JMJ A;  2YU4 A;  2YSJ A;  3V43 A;  3DPL R;  5LKX A;  2JRJ A;  1WGM A;  4UI9 B;  4YBS A;  2ZET C;  2JMI A;  2MD7 B;  5D1M B;  2L80 A;  2YHN A;  2RI7 A;  2EA6 A;  5KH9 A;  3L1X A;  2QIZ A;  2KR4 A;  2BAY A;  5LKU A;  1WEP A;  2VPE A;  4AYC B;  2Y1N A;  2YW8 A;  1FBV A;  4FIP A;  5H9M A;  3PHD A;  4A4C A;  2M85 A;  5G04 B;  1WEW A;  2G43 A;  4S3O B;  1WEN A;  5KH3 A;  2CT2 A;  2XB1 A;  2FSA A;  2PNX A;  4I7B A;  3LQJ A;  3N9M A;  4FO9 A;  4R7E A;  2F42 A;  2ECW A;  2LDR A;  1VFY A;  4B7Y C;  3U5M A;  4A49 A;  4FK5 A;  3ZVZ B;  1X4J A;  5TDW A;  4LAD B;  3N9P A;  2F6N A;  3PUR A;  4I7D A;  4N4F A;  2E6R A;  3GV4 A;  1CHC A;  2LGV A;  3T7L A;  4PTB A;  2ECG A;  5TBN A;  2EOD A;  2EGP A;  4AVX A;  2NAA A;  5TDR A;  3VK6 A;  3O33 A;  3L11 A;  1VYX A;  2VPG A;  2E6S A;  2YQM A;  3C6W A;  4GND A;  5FER A;  2LXP C;  4O64 A;  3T6R A;  2C2L A;  3LQH A;  1MM2 A;  2LV9 A;  2MA5 A;  2MA6 A;  2ECT A;  4TKP B;  2VJE A;  2K17 A;  5B75 A;  3SOW A;  4GB0 A;  1WEE A;  3O37 A;  1XWH A;  5KH7 A;  1VD4 A;  1HYI A;  2OXQ C;  2CKL B;  2CKL A;  1LDJ B;  2MIQ A;  2I50 A;  4QF3 A;  3N9N A;  3N9L A;  2LXH C;  4N3W A;  5C13 A;  2YRE A;  2FUU A;  1G25 A;  1Z60 A;  3U5P A;  2F6J A;  3MHH A;  2MNZ A;  2PUY A;  4CA1 A;  2ECI A;  2L5U A;  4A4B A;  4I7C A;  5C11 A;  5H1V A;  2M3H A;  4CCG X;  2KWO A;  2KWN A;  3LQI A;  2K4D A;  4ZDT A;  4YAT A;  3N9O A;  1FP0 A;  4AP4 A;  1HYJ A;  1WIM A;  5TAB A;  3ZPV 1;  3LRQ A;  3HTK C;  4IC2 A;  2G6Q A;  4WZ2 A;  2KGG A;  4A0C D;  4R2Y A;  3ZTG A;  3RTR B;  5I3L A;  4V3K C;  4LJN A;  1BOR A;  2KYU A;  4X3G A;  1F62 A;  3HCU A;  5G05 B;  2ECV A;  3MHS A;  3M62 A;  4YC9 A;  2ECN A;  1WIL A;  2XEU A;  2KFT A;  5D1K B;  3RPG C;  5LKZ A;  3SHB A;  5JG6 A;  1E4U A;  5B79 A;  3FL2 A;  1WEU A;  2VPD A;  3O34 A;  1X4U A;  2YUC A;  4MSX A;  2KE1 A;  3O7A A;  2KRE A;  4GNE A;  2MT5 A;  3SOU A;  3ZNI A;  4WA6 A;  2CSY A;  3NG2 A;  3HCS A;  1RMD A;  2MD8 C;  1V87 A;  3HCT A;  4AYC A;  2H0D A;  1LDK C;  4AUQ B;  4P5O B;  2HDP A;  2HYE D;  4XI1 A;  5J3X A;  1WEV A;  4LKA A;  1JOC A;  2IDA A;  2AN6 A;  2K1J A;  4YAD A;  5D1L B;  3KNV A;  4MVT A;  4L7X A;  5G0F A;  4LLB A;  5FB0 A;  3C5K A;  1ZBD B;  2KGI A;  2VPB A;  1WFK A;  2FUI A;  4R8P K;  1WEO A;  4BHW A;  2JMD A;  3GL6 A;  3KV5 A;  5B78 A;  2MNY A;  3I2D A;  4Q6F A;  1U6G B;  2LRI C;  2DX8 A;  4YAX A;  2LGK A;  2QIC A;  4NN2 A;  2VJF B;  4ZUX U;  4FJC A;  3PUQ A;  1IYM A;  4IC3 A;  5DIN A;  1Z2Q A;  3QZV A;  2M6M A;  2YSM A;  1N87 A;  2H0D B;  2RSD A;  3ASL A;  3M63 A;  2QJ0 A;  2VNF A;  3KV6 A;  4GNG A;  5AIU A;  1Z6U A;  1X4I A;  2LQ6 A;  1WE9 A;  4ZQL A;  5H1U A;  4L58 A;  1K2F A;  5LCW B;  2YT5 A;  3U5O A;  4WZ0 A;  2C2V S;  2YQL A;  4BBQ A;  2Y43 A;  2Y1M A;  4YBT A;  3SOX A;  2LGL A;  2L75 A;  3O36 A;  4UP0 A;  3M99 A;  2YUR A;  4UP5 A;  2K16 A;  1DVP A;  5DKA A;  4S3O C;  1T1H A;  2VP7 A;  3DQV R;  5B77 A;  4QF2 A;  3IHP A;  2KWK A;  2KIZ A;  3ZVY A;  3ZPV E;  3RPG B;  4C9Z A;  4V3L C;  4LK9 A;  5LKT A;  5EYA F;  4YBM A;  3O35 A;  4B86 C;  1JM7 A;  1JM7 B;  2L0B A;  5FEY A;  1MM3 A;  3KQI A;  3O70 A;  2VJF A;  4F52 B;  2YYR A;  1WES A;  2MUM A;  2D8S A;  2YHO A;  4WZ3 B;  5FB1 A;  3U5N A;  2KU3 A;  4GNF A;  2G45 A;  2CSZ A;  2LN0 A;  3EB6 A;  5H1T A;  4YAB A;  1WEM A;  4PPE A;  2KWJ A;  1WEQ A;  5TRB A;  2L43 A;  2M1R A;  3L1Z B;  4W4U A;  2LGG A;  3N9Q A;  2VJE B;  3EB5 A;  3ZYQ A;  5B76 A;  2ECJ A;  5AIT A;  5B8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...