2BAYA

Crystal structure of the prp19 u-box dimer
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Pre-mRNA splicing factor PRP19
publication title The Prp19 U-box Crystal Structure Suggests a Common Dimeric Architecture for a Class of Oligomeric E3 Ubiquitin Ligases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2bayA00
3M63A 4YC9A 4MSXA 2VJEB 2D8SA 3O7AA 2K4DA 3L11A 2PUYA 4C9ZA 2KWJA 2MUMA 5J3XA 3U5PA 4MVTA 2LRIC 4L58A 3MHSA 5KH9A 1HYIA 3LQHA 2L43A 5C11A 5KH7A 2YYRA 5TDWA 2KR4A 2LDRA 2KU3A 1FBVA 3O34A 4AUQB 3U5MA 2L75A 5AIUA 4P5OB 4A4CA 2VJFA 1V87A 3O70A 2F6JA 3SOWA 3RPGC 2E6RA 1WEOA 2YT5A 3N9OA 1DVPA 4LJNA 4A49A 1RMDA 3N9MA 4QF2A 2YURA 2I50A 3ZYQA 3O35A 4CCGX 5LKXA 4LK9A 5D1MB 4YAXA 3ZPVE 4I7BA 4R7EA 2MNYA 1Z6UA 2KGIA 4IC3A 2VJEA 1CHCA 3GV4A 2F42A 4FK5A 5H1TA 3MHHA 4XI1A 1X4UA 2FUUA 4WZ3B 3KV5A 3U5OA 4YABA 3HCTA 2MD7B 1WEQA 3V43A 4ZUXU 3RPGB 1LDKC 1WILA 4R2YA 3C5KA 3KQIA 2YHNA 3ZTGA 4B86C 4GNEA 4WZ2A 5H1VA 2RI7A 4FJCA 2LGKA 2YREA 1WE9A 1N87A 5DINA 5TRBA 2KFTA 1WIMA 3O33A 4PTBA 5TBNA 2G6QA 1WEPA 2YUCA 4W4UA 4AP4A 2H0DB 3T7LA 3KV6A 2EA6A 2Y43A 3LQIA 1X4IA 1XWHA 3U5NA 3EB6A 1JM7B 4WZ0A 3QZVA 3PHDA 2JMIA 2VNFA 2ECWA 2JRJA 4F52B 4ZQLA 2CSYA 4N3WA 1WEWA 2K17A 1MM3A 4GNDA 1VFYA 5H9MA 5H1UA 2CSZA 1IYMA 4L7XA 5JG6A 2UZGA 3NG2A 4B7YC 3PURA 1WGMA 4YBSA 2AN6A 5C13A 2YHOA 5G0FA 4LLBA 3HTKC 2H0DA 4YBMA 5FERA 5LKTA 3M62A 2YQLA 2ECJA 2YW8A 4PPEA 4QF3A 2YQMA 4CA1A 1JOCA 2JMJA 2XEUA 4X3GA 4GB0A 1JM7A 5TDRA 4UP5A 4A4BA 5B76A 1LDJB 5KH3A 2L80A 3SOXA 2VPBA 4S3OC 1WESA 2KYUA 2MA6A 2YU4A 3SHBA 3DPLR 2Y1NA 4BHWA 5G05B 2HYED 2NAAA 2MT5A 2LN0A 4WA6A 5D1LB 1MM2A 4ZDTA 2EODA 3I2DA 2XB1A 5B77A 1FP0A 2L5UA 1HYJA 2FUIA 4YADA 2RSDA 1WEUA 5LCWB 2ECGA 2VPEA 2C2VS 2LV9A 1BORA 2ZETC 4I7CA 3M99A 5LKZA 2KREA 2C2LA 4TKPB 1WENA 4UI9B 1WFKA 1Z2QA 2G43A 2L0BA 3HCUA 2ECNA 3HCSA 3ZPV1 2KWKA 4FO9A 2M1RA 2G45A 4A0CD 2LXHC 2M6MA 2QJ0A 2QICA 5G04B 3N9QA 3ASLA 3LQJA 4YATA 2CT2A 2DX8A 1F62A 2YSJA 5EYAF 2MD8C 5DKAA 2QIZA 2CKLB 5FB1A 1T1HA 3ZVYA 3EB5A 4IC2A 2MNZA 2F6NA 2FSAA 2OXQC 3DQVR 2K16A 2ECVA 2M85A 3N9LA 2KGGA 3SOUA 2VP7A 4UP0A 5B79A 5FB0A 5B78A 3GL6A 2LXPC 3RTRB 4R8PK 2BAYA 2LGGA 4I7DA 3FL2A 1WEVA 5I3LA 2E6SA 2IDAA 5LKUA 5B75A 2MIQA 4YBTA 4V3KC 3O36A 4N4FA 4LKAA 2YSMA 3VK6A 2EGPA 2K1JA 1ZBDB 2KWOA 4AYCB 3LRQA 3ZVZB 5TABA 5FEYA 1E4UA 4GNFA 2LQ6A 2PNXA 5D1KB 1U6GB 1VD4A 2LGVA 2CKLA 3PUQA 3KNVA 1WEMA 1VYXA 4Q6FA 4FIPA 3IHPA 3O37A 2KIZA 2VPDA 2JMDA 1Z60A 3N9PA 2M3HA 2MA5A 2KE1A 2VPGA 1K2FA 2Y1MA 2VJFB 2ECTA 1WEEA 2HDPA 2LGLA 4O64A 5AITA 2ECIA 3ZNIA 4GNGA 4V3LC 1G25A 4LADB 3L1XA 2KWNA 3C6WA 4NN2A 5B8DA 4S3OB 3T6RA 4BBQA 3N9NA 4AYCA 3L1ZB 1X4JA 4AVXA
chains in the Genus database with same CATH superfamily
3M63A 4YC9A 3DDTA 4MSXA 2VJEB 2D8SA 3O7AA 2XOZA 2K4DA 3L11A 2PUYA 4C9ZA 2L7PA 2KWJA 2MUMA 5J3XA 3U5PA 4MVTA 2LRIC 4L58A 3MHSA 5KH9A 1HYIA 3LQHA 2L43A 5C11A 5KH7A 2YYRA 5TDWA 2KR4A 2LDRA 2KU3A 4F1PA 1FBVA 3O34A 4AUQB 3Q1DA 3U5MA 2L75A 3FEHA 5AIUA 4P5OB 4A4CA 2VJFA 1V87A 3O70A 2F6JA 3SOWA 3RPGC 2E6RA 1WEOA 2FFWA 2YT5A 3N9OA 1DVPA 4LJNA 4A49A 1RMDA 3N9MA 4QF2A 2YURA 2I50A 2M13A 3ZYQA 2DJAA 3KDEC 3O35A 4CCGX 5LKXA 4LK9A 3LJUX 5D1MB 3H7HA 4YAXA 3ZPVE 4I7BA 4R7EA 2MNYA 1Z6UA 2KGIA 2IQJA 4IC3A 2VJEA 1CHCA 3GV4A 2E61A 2F42A 4FK5A 5H1TA 3MHHA 4XI1A 1X4UA 2FUUA 4WZ3B 3KV5A 3U5OA 4YABA 3HCTA 2MD7B 1WEQA 3V43A 4ZUXU 3RPGB 1LDKC 1WILA 4R2YA 3C5KA 3KQIA 2YHNA 3ZTGA 4B86C 4GNEA 4WZ2A 5H1VA 2RI7A 4FJCA 2LGKA 4QQ4A 2YREA 1WE9A 5SVIB 1N87A 5DINA 5TRBA 2P57A 2KFTA 1WIMA 3O33A 4PTBA 5TBNA 2G6QA 1WEPA 2YUCA 5K3QA 3LDYA 3LVQE 4W4UA 4AP4A 2H0DB 3FAOA 3T7LA 3KV6A 2EA6A 2Y43A 1MBMA 3LQIA 1X4IA 1XWHA 3U5NA 3JUEA 3EB6A 1JM7B 4WZ0A 3QZVA 3PHDA 2JMIA 2VNFA 2ECWA 2JRJA 3SUBA 4F52B 2MKEA 4ZQLA 2CSYA 3FJUB 4N3WA 2CONA 1WEWA 2XOYA 2K17A 1MM3A 4GNDA 1VFYA 5H9MA 5H1UA 2CSZA 1IYMA 4L7XA 5JG6A 2UZGA 3NG2A 4B7YC 3PURA 5SVIA 1WGMA 4YBSA 2AN6A 5C13A 2YHOA 5G0FA 2XOCA 4LLBA 2CRRA 2YVRA 3HTKC 1DCQA 2H0DA 4YBMA 3M7KA 5FERA 4Z0RA 2JM3A 3M62A 5LKTA 2YQLA 2ECJA 2YW8A 4PPEA 4QF3A 2YQMA 4CA1A 2KKXA 1JOCA 2JMJA 2XEUA 4X3GA 4GB0A 1JM7A 5TDRA 4UP5A 4A4BA 5B76A 1LDJB 5KH3A 2L80A 3PLWA 3SOXA 2VPBA 4S3OC 1WESA 2KYUA 3FANA 2MA6A 2LAUA 2YU4A 3SHBA 3DPLR 2Y1NA 4BHWA 5G05B 2HYED 2NAAA 2MT5A 2LN0A 4WA6A 5D1LB 3DWDA 1MM2A 2EXUA 4ZDTA 2EODA 3I2DA 2XB1A 5B77A 1FP0A 2D8UA 2L5UA 1HYJA 2FUIA 4YADA 2RSDA 1WEUA 5LCWB 2ECGA 2VPEA 2C2VS 2LV9A 1BORA 2ZETC 4I7CA 3M99A 5LKZA 2CRWA 2KREA 2C2LA 4TKPB 1WENA 4UI9B 1WFKA 1Z2QA 2G43A 2L0BA 3HCUA 2ECNA 3HCSA 3ZPV1 2KWKA 4FO9A 3T9KA 2M1RA 2G45A 4A0CD 2LXHC 2M6MA 2QJ0A 2QICA 5G04B 3N9QA 3ASLA 3LQJA 4YATA 2CT2A 2DX8A 3O47A 2JUNA 1F62A 2YSJA 5EYAF 2MD8C 2EGMA 5DKAA 2QIZA 2CKLB 2DSMA 5FB1A 1T1HA 2CSVA 3ZVYA 3FM8C 3EB5A 4IC2A 2MNZA 2F6NA 2FSAA 2OXQC 3DQVR 2K16A 2ECVA 2M85A 3N9LA 2KGGA 3SOUA 2VP7A 4UP0A 5B79A 2B0OE 5FB0A 5B78A 3GL6A 2LXPC 3RTRB 4R8PK 2BAYA 2LGGA 4I7DA 3FL2A 1WEVA 5I3LA 2E6SA 2IDAA 5LKUA 2OWAA 5B75A 4H9DA 2MIQA 4YBTA 4OGEA 4V3KC 3O36A 2RR4A 4N4FA 4LKAA 2YSMA 3LVRE 5SVYA 3VK6A 2EGPA 2K1JA 1ZBDB 2KKYA 2KWOA 3LRQA 3ZVZB 3E2DA 4AYCB 5TABA 5FEYA 1E4UA 4GNFA 2LQ6A 2PNXA 1U6GB 2XP0A 5D1KB 1VD4A 4O62A 2LGVA 2CKLA 3PUQA 3KNVA 1WEMA 1VYXA 4Q6FA 4FIPA 3IHPA 3O37A 2KIZA 2VPDA 3MDBC 2JMDA 2FD4A 1Z60A 3N9PA 2M3HA 2MA5A 2KE1A 2VPGA 1K2FA 4OGCA 2Y1MA 5SVXA 2VJFB 2ECTA 1WEEA 2HDPA 2LGLA 4O64A 5AITA 2ECIA 3ZNIA 4GNGA 4V3LC 1G25A 4LADB 3L1XA 2KWNA 3C6WA 4NN2A 5B8DA 4S3OB 3T6RA 4BBQA 4Z0OA 3N9NA 4AYCA 3L1ZB 1X4JA 4AVXA
chains in the Genus database with same CATH topology
3M63A 4YC9A 4MSXA 2VJEB 2D8SA 3O7AA 2K4DA 3L11A 2PUYA 4C9ZA 2KWJA 2MUMA 5J3XA 3U5PA 4MVTA 2LRIC 4L58A 3MHSA 5KH9A 1HYIA 3LQHA 2L43A 5C11A 5KH7A 2YYRA 5TDWA 2KR4A 2LDRA 2KU3A 1FBVA 3O34A 4AUQB 3U5MA 2L75A 5AIUA 4P5OB 4A4CA 2VJFA 1V87A 3O70A 2F6JA 3SOWA 3RPGC 2E6RA 1WEOA 2YT5A 3N9OA 1DVPA 4LJNA 4A49A 1RMDA 3N9MA 4QF2A 2YURA 2I50A 3ZYQA 3O35A 4CCGX 5LKXA 4LK9A 5D1MB 4YAXA 3ZPVE 4I7BA 4R7EA 2MNYA 1Z6UA 2KGIA 4IC3A 2VJEA 1CHCA 3GV4A 2F42A 4FK5A 5H1TA 3MHHA 4XI1A 1X4UA 2FUUA 4WZ3B 3KV5A 3U5OA 4YABA 3HCTA 2MD7B 1WEQA 3V43A 4ZUXU 3RPGB 1LDKC 1WILA 4R2YA 3C5KA 3KQIA 2YHNA 3ZTGA 4B86C 4GNEA 4WZ2A 5H1VA 2RI7A 4FJCA 2LGKA 2YREA 1WE9A 1N87A 5DINA 5TRBA 2KFTA 1WIMA 3O33A 4PTBA 5TBNA 2G6QA 1WEPA 2YUCA 4W4UA 4AP4A 2H0DB 3T7LA 3KV6A 2EA6A 2Y43A 3LQIA 1X4IA 1XWHA 3U5NA 3EB6A 1JM7B 4WZ0A 3QZVA 3PHDA 2JMIA 2VNFA 2ECWA 2JRJA 4F52B 4ZQLA 2CSYA 4N3WA 1WEWA 2K17A 1MM3A 4GNDA 1VFYA 5H9MA 5H1UA 2CSZA 1IYMA 4L7XA 5JG6A 2UZGA 3NG2A 4B7YC 3PURA 1WGMA 4YBSA 2AN6A 5C13A 2YHOA 5G0FA 4LLBA 3HTKC 2H0DA 4YBMA 5FERA 5LKTA 3M62A 2YQLA 2ECJA 2YW8A 4PPEA 4QF3A 2YQMA 4CA1A 1JOCA 2JMJA 2XEUA 4X3GA 4GB0A 1JM7A 5TDRA 4UP5A 4A4BA 5B76A 1LDJB 5KH3A 2L80A 3SOXA 2VPBA 4S3OC 1WESA 2KYUA 2MA6A 2YU4A 3SHBA 3DPLR 2Y1NA 4BHWA 5G05B 2HYED 2NAAA 2MT5A 2LN0A 4WA6A 5D1LB 1MM2A 4ZDTA 2EODA 3I2DA 2XB1A 5B77A 1FP0A 2L5UA 1HYJA 2FUIA 4YADA 2RSDA 1WEUA 5LCWB 2ECGA 2VPEA 2C2VS 2LV9A 1BORA 2ZETC 4I7CA 3M99A 5LKZA 2KREA 2C2LA 4TKPB 1WENA 4UI9B 1WFKA 1Z2QA 2G43A 2L0BA 3HCUA 2ECNA 3HCSA 3ZPV1 2KWKA 4FO9A 2M1RA 2G45A 4A0CD 2LXHC 2M6MA 2QJ0A 2QICA 5G04B 3N9QA 3ASLA 3LQJA 4YATA 2CT2A 2DX8A 1F62A 2YSJA 5EYAF 2MD8C 5DKAA 2QIZA 2CKLB 5FB1A 1T1HA 3ZVYA 3EB5A 4IC2A 2MNZA 2F6NA 2FSAA 2OXQC 3DQVR 2K16A 2ECVA 2M85A 3N9LA 2KGGA 3SOUA 2VP7A 4UP0A 5B79A 5FB0A 5B78A 3GL6A 2LXPC 3RTRB 4R8PK 2BAYA 2LGGA 4I7DA 3FL2A 1WEVA 5I3LA 2E6SA 2IDAA 5LKUA 5B75A 2MIQA 4YBTA 4V3KC 3O36A 4N4FA 4LKAA 2YSMA 3VK6A 2EGPA 2K1JA 1ZBDB 2KWOA 4AYCB 3LRQA 3ZVZB 5TABA 5FEYA 1E4UA 4GNFA 2LQ6A 2PNXA 5D1KB 1U6GB 1VD4A 2LGVA 2CKLA 3PUQA 3KNVA 1WEMA 1VYXA 4Q6FA 4FIPA 3IHPA 3O37A 2KIZA 2VPDA 2JMDA 1Z60A 3N9PA 2M3HA 2MA5A 2KE1A 2VPGA 1K2FA 2Y1MA 2VJFB 2ECTA 1WEEA 2HDPA 2LGLA 4O64A 5AITA 2ECIA 3ZNIA 4GNGA 4V3LC 1G25A 4LADB 3L1XA 2KWNA 3C6WA 4NN2A 5B8DA 4S3OB 3T6RA 4BBQA 3N9NA 4AYCA 3L1ZB 1X4JA 4AVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 A;  4YC9 A;  4MSX A;  2VJE B;  2D8S A;  3O7A A;  2K4D A;  3L11 A;  2PUY A;  4C9Z A;  2KWJ A;  2MUM A;  5J3X A;  3U5P A;  4MVT A;  2LRI C;  4L58 A;  3MHS A;  5KH9 A;  1HYI A;  3LQH A;  2L43 A;  5C11 A;  5KH7 A;  2YYR A;  5TDW A;  2KR4 A;  2LDR A;  2KU3 A;  1FBV A;  3O34 A;  4AUQ B;  3U5M A;  2L75 A;  5AIU A;  4P5O B;  4A4C A;  2VJF A;  1V87 A;  3O70 A;  2F6J A;  3SOW A;  3RPG C;  2E6R A;  1WEO A;  2YT5 A;  3N9O A;  1DVP A;  4LJN A;  4A49 A;  1RMD A;  3N9M A;  4QF2 A;  2YUR A;  2I50 A;  3ZYQ A;  3O35 A;  4CCG X;  5LKX A;  4LK9 A;  5D1M B;  4YAX A;  3ZPV E;  4I7B A;  4R7E A;  2MNY A;  1Z6U A;  2KGI A;  4IC3 A;  2VJE A;  1CHC A;  3GV4 A;  2F42 A;  4FK5 A;  5H1T A;  3MHH A;  4XI1 A;  1X4U A;  2FUU A;  4WZ3 B;  3KV5 A;  3U5O A;  4YAB A;  3HCT A;  2MD7 B;  1WEQ A;  3V43 A;  4ZUX U;  3RPG B;  1LDK C;  1WIL A;  4R2Y A;  3C5K A;  3KQI A;  2YHN A;  3ZTG A;  4B86 C;  4GNE A;  4WZ2 A;  5H1V A;  2RI7 A;  4FJC A;  2LGK A;  2YRE A;  1WE9 A;  1N87 A;  5DIN A;  5TRB A;  2KFT A;  1WIM A;  3O33 A;  4PTB A;  5TBN A;  2G6Q A;  1WEP A;  2YUC A;  4W4U A;  4AP4 A;  2H0D B;  3T7L A;  3KV6 A;  2EA6 A;  2Y43 A;  3LQI A;  1X4I A;  1XWH A;  3U5N A;  3EB6 A;  1JM7 B;  4WZ0 A;  3QZV A;  3PHD A;  2JMI A;  2VNF A;  2ECW A;  2JRJ A;  4F52 B;  4ZQL A;  2CSY A;  4N3W A;  1WEW A;  2K17 A;  1MM3 A;  4GND A;  1VFY A;  5H9M A;  5H1U A;  2CSZ A;  1IYM A;  4L7X A;  5JG6 A;  2UZG A;  3NG2 A;  4B7Y C;  3PUR A;  1WGM A;  4YBS A;  2AN6 A;  5C13 A;  2YHO A;  5G0F A;  4LLB A;  3HTK C;  2H0D A;  4YBM A;  5FER A;  5LKT A;  3M62 A;  2YQL A;  2ECJ A;  2YW8 A;  4PPE A;  4QF3 A;  2YQM A;  4CA1 A;  1JOC A;  2JMJ A;  2XEU A;  4X3G A;  4GB0 A;  1JM7 A;  5TDR A;  4UP5 A;  4A4B A;  5B76 A;  1LDJ B;  5KH3 A;  2L80 A;  3SOX A;  2VPB A;  4S3O C;  1WES A;  2KYU A;  2MA6 A;  2YU4 A;  3SHB A;  3DPL R;  2Y1N A;  4BHW A;  5G05 B;  2HYE D;  2NAA A;  2MT5 A;  2LN0 A;  4WA6 A;  5D1L B;  1MM2 A;  4ZDT A;  2EOD A;  3I2D A;  2XB1 A;  5B77 A;  1FP0 A;  2L5U A;  1HYJ A;  2FUI A;  4YAD A;  2RSD A;  1WEU A;  5LCW B;  2ECG A;  2VPE A;  2C2V S;  2LV9 A;  1BOR A;  2ZET C;  4I7C A;  3M99 A;  5LKZ A;  2KRE A;  2C2L A;  4TKP B;  1WEN A;  4UI9 B;  1WFK A;  1Z2Q A;  2G43 A;  2L0B A;  3HCU A;  2ECN A;  3HCS A;  3ZPV 1;  2KWK A;  4FO9 A;  2M1R A;  2G45 A;  4A0C D;  2LXH C;  2M6M A;  2QJ0 A;  2QIC A;  5G04 B;  3N9Q A;  3ASL A;  3LQJ A;  4YAT A;  2CT2 A;  2DX8 A;  1F62 A;  2YSJ A;  5EYA F;  2MD8 C;  5DKA A;  2QIZ A;  2CKL B;  5FB1 A;  1T1H A;  3ZVY A;  3EB5 A;  4IC2 A;  2MNZ A;  2F6N A;  2FSA A;  2OXQ C;  3DQV R;  2K16 A;  2ECV A;  2M85 A;  3N9L A;  2KGG A;  3SOU A;  2VP7 A;  4UP0 A;  5B79 A;  5FB0 A;  5B78 A;  3GL6 A;  2LXP C;  3RTR B;  4R8P K;  2BAY A;  2LGG A;  4I7D A;  3FL2 A;  1WEV A;  5I3L A;  2E6S A;  2IDA A;  5LKU A;  5B75 A;  2MIQ A;  4YBT A;  4V3K C;  3O36 A;  4N4F A;  4LKA A;  2YSM A;  3VK6 A;  2EGP A;  2K1J A;  1ZBD B;  2KWO A;  4AYC B;  3LRQ A;  3ZVZ B;  5TAB A;  5FEY A;  1E4U A;  4GNF A;  2LQ6 A;  2PNX A;  5D1K B;  1U6G B;  1VD4 A;  2LGV A;  2CKL A;  3PUQ A;  3KNV A;  1WEM A;  1VYX A;  4Q6F A;  4FIP A;  3IHP A;  3O37 A;  2KIZ A;  2VPD A;  2JMD A;  1Z60 A;  3N9P A;  2M3H A;  2MA5 A;  2KE1 A;  2VPG A;  1K2F A;  2Y1M A;  2VJF B;  2ECT A;  1WEE A;  2HDP A;  2LGL A;  4O64 A;  5AIT A;  2ECI A;  3ZNI A;  4GNG A;  4V3L C;  1G25 A;  4LAD B;  3L1X A;  2KWN A;  3C6W A;  4NN2 A;  5B8D A;  4S3O B;  3T6R A;  4BBQ A;  3N9N A;  4AYC A;  3L1Z B;  1X4J A;  4AVX A; 
#chains in the Genus database with same CATH topology
 3M63 A;  4YC9 A;  3DDT A;  4MSX A;  2VJE B;  2D8S A;  3O7A A;  2XOZ A;  2K4D A;  3L11 A;  2PUY A;  4C9Z A;  2L7P A;  2KWJ A;  2MUM A;  5J3X A;  3U5P A;  4MVT A;  2LRI C;  4L58 A;  3MHS A;  5KH9 A;  1HYI A;  3LQH A;  2L43 A;  5C11 A;  5KH7 A;  2YYR A;  5TDW A;  2KR4 A;  2LDR A;  2KU3 A;  4F1P A;  1FBV A;  3O34 A;  4AUQ B;  3Q1D A;  3U5M A;  2L75 A;  3FEH A;  5AIU A;  4P5O B;  4A4C A;  2VJF A;  1V87 A;  3O70 A;  2F6J A;  3SOW A;  3RPG C;  2E6R A;  1WEO A;  2FFW A;  2YT5 A;  3N9O A;  1DVP A;  4LJN A;  4A49 A;  1RMD A;  3N9M A;  4QF2 A;  2YUR A;  2I50 A;  2M13 A;  3ZYQ A;  2DJA A;  3KDE C;  3O35 A;  4CCG X;  5LKX A;  4LK9 A;  3LJU X;  5D1M B;  3H7H A;  4YAX A;  3ZPV E;  4I7B A;  4R7E A;  2MNY A;  1Z6U A;  2KGI A;  2IQJ A;  4IC3 A;  2VJE A;  1CHC A;  3GV4 A;  2E61 A;  2F42 A;  4FK5 A;  5H1T A;  3MHH A;  4XI1 A;  1X4U A;  2FUU A;  4WZ3 B;  3KV5 A;  3U5O A;  4YAB A;  3HCT A;  2MD7 B;  1WEQ A;  3V43 A;  4ZUX U;  3RPG B;  1LDK C;  1WIL A;  4R2Y A;  3C5K A;  3KQI A;  2YHN A;  3ZTG A;  4B86 C;  4GNE A;  4WZ2 A;  5H1V A;  2RI7 A;  4FJC A;  2LGK A;  4QQ4 A;  2YRE A;  1WE9 A;  5SVI B;  1N87 A;  5DIN A;  5TRB A;  2P57 A;  2KFT A;  1WIM A;  3O33 A;  4PTB A;  5TBN A;  2G6Q A;  1WEP A;  2YUC A;  5K3Q A;  3LDY A;  3LVQ E;  4W4U A;  4AP4 A;  2H0D B;  3FAO A;  3T7L A;  3KV6 A;  2EA6 A;  2Y43 A;  1MBM A;  3LQI A;  1X4I A;  1XWH A;  3U5N A;  3JUE A;  3EB6 A;  1JM7 B;  4WZ0 A;  3QZV A;  3PHD A;  2JMI A;  2VNF A;  2ECW A;  2JRJ A;  3SUB A;  4F52 B;  2MKE A;  4ZQL A;  2CSY A;  3FJU B;  4N3W A;  2CON A;  1WEW A;  2XOY A;  2K17 A;  1MM3 A;  4GND A;  1VFY A;  5H9M A;  5H1U A;  2CSZ A;  1IYM A;  4L7X A;  5JG6 A;  2UZG A;  3NG2 A;  4B7Y C;  3PUR A;  5SVI A;  1WGM A;  4YBS A;  2AN6 A;  5C13 A;  2YHO A;  5G0F A;  2XOC A;  4LLB A;  2CRR A;  2YVR A;  3HTK C;  1DCQ A;  2H0D A;  4YBM A;  3M7K A;  5FER A;  4Z0R A;  2JM3 A;  3M62 A;  5LKT A;  2YQL A;  2ECJ A;  2YW8 A;  4PPE A;  4QF3 A;  2YQM A;  4CA1 A;  2KKX A;  1JOC A;  2JMJ A;  2XEU A;  4X3G A;  4GB0 A;  1JM7 A;  5TDR A;  4UP5 A;  4A4B A;  5B76 A;  1LDJ B;  5KH3 A;  2L80 A;  3PLW A;  3SOX A;  2VPB A;  4S3O C;  1WES A;  2KYU A;  3FAN A;  2MA6 A;  2LAU A;  2YU4 A;  3SHB A;  3DPL R;  2Y1N A;  4BHW A;  5G05 B;  2HYE D;  2NAA A;  2MT5 A;  2LN0 A;  4WA6 A;  5D1L B;  3DWD A;  1MM2 A;  2EXU A;  4ZDT A;  2EOD A;  3I2D A;  2XB1 A;  5B77 A;  1FP0 A;  2D8U A;  2L5U A;  1HYJ A;  2FUI A;  4YAD A;  2RSD A;  1WEU A;  5LCW B;  2ECG A;  2VPE A;  2C2V S;  2LV9 A;  1BOR A;  2ZET C;  4I7C A;  3M99 A;  5LKZ A;  2CRW A;  2KRE A;  2C2L A;  4TKP B;  1WEN A;  4UI9 B;  1WFK A;  1Z2Q A;  2G43 A;  2L0B A;  3HCU A;  2ECN A;  3HCS A;  3ZPV 1;  2KWK A;  4FO9 A;  3T9K A;  2M1R A;  2G45 A;  4A0C D;  2LXH C;  2M6M A;  2QJ0 A;  2QIC A;  5G04 B;  3N9Q A;  3ASL A;  3LQJ A;  4YAT A;  2CT2 A;  2DX8 A;  3O47 A;  2JUN A;  1F62 A;  2YSJ A;  5EYA F;  2MD8 C;  2EGM A;  5DKA A;  2QIZ A;  2CKL B;  2DSM A;  5FB1 A;  1T1H A;  2CSV A;  3ZVY A;  3FM8 C;  3EB5 A;  4IC2 A;  2MNZ A;  2F6N A;  2FSA A;  2OXQ C;  3DQV R;  2K16 A;  2ECV A;  2M85 A;  3N9L A;  2KGG A;  3SOU A;  2VP7 A;  4UP0 A;  5B79 A;  2B0O E;  5FB0 A;  5B78 A;  3GL6 A;  2LXP C;  3RTR B;  4R8P K;  2BAY A;  2LGG A;  4I7D A;  3FL2 A;  1WEV A;  5I3L A;  2E6S A;  2IDA A;  5LKU A;  2OWA A;  5B75 A;  4H9D A;  2MIQ A;  4YBT A;  4OGE A;  4V3K C;  3O36 A;  2RR4 A;  4N4F A;  4LKA A;  2YSM A;  3LVR E;  5SVY A;  3VK6 A;  2EGP A;  2K1J A;  1ZBD B;  2KKY A;  2KWO A;  3LRQ A;  3ZVZ B;  3E2D A;  4AYC B;  5TAB A;  5FEY A;  1E4U A;  4GNF A;  2LQ6 A;  2PNX A;  1U6G B;  2XP0 A;  5D1K B;  1VD4 A;  4O62 A;  2LGV A;  2CKL A;  3PUQ A;  3KNV A;  1WEM A;  1VYX A;  4Q6F A;  4FIP A;  3IHP A;  3O37 A;  2KIZ A;  2VPD A;  3MDB C;  2JMD A;  2FD4 A;  1Z60 A;  3N9P A;  2M3H A;  2MA5 A;  2KE1 A;  2VPG A;  1K2F A;  4OGC A;  2Y1M A;  5SVX A;  2VJF B;  2ECT A;  1WEE A;  2HDP A;  2LGL A;  4O64 A;  5AIT A;  2ECI A;  3ZNI A;  4GNG A;  4V3L C;  1G25 A;  4LAD B;  3L1X A;  2KWN A;  3C6W A;  4NN2 A;  5B8D A;  4S3O B;  3T6R A;  4BBQ A;  4Z0O A;  3N9N A;  4AYC A;  3L1Z B;  1X4J A;  4AVX A; 
#chains in the Genus database with same CATH homology
 3M63 A;  4YC9 A;  4MSX A;  2VJE B;  2D8S A;  3O7A A;  2K4D A;  3L11 A;  2PUY A;  4C9Z A;  2KWJ A;  2MUM A;  5J3X A;  3U5P A;  4MVT A;  2LRI C;  4L58 A;  3MHS A;  5KH9 A;  1HYI A;  3LQH A;  2L43 A;  5C11 A;  5KH7 A;  2YYR A;  5TDW A;  2KR4 A;  2LDR A;  2KU3 A;  1FBV A;  3O34 A;  4AUQ B;  3U5M A;  2L75 A;  5AIU A;  4P5O B;  4A4C A;  2VJF A;  1V87 A;  3O70 A;  2F6J A;  3SOW A;  3RPG C;  2E6R A;  1WEO A;  2YT5 A;  3N9O A;  1DVP A;  4LJN A;  4A49 A;  1RMD A;  3N9M A;  4QF2 A;  2YUR A;  2I50 A;  3ZYQ A;  3O35 A;  4CCG X;  5LKX A;  4LK9 A;  5D1M B;  4YAX A;  3ZPV E;  4I7B A;  4R7E A;  2MNY A;  1Z6U A;  2KGI A;  4IC3 A;  2VJE A;  1CHC A;  3GV4 A;  2F42 A;  4FK5 A;  5H1T A;  3MHH A;  4XI1 A;  1X4U A;  2FUU A;  4WZ3 B;  3KV5 A;  3U5O A;  4YAB A;  3HCT A;  2MD7 B;  1WEQ A;  3V43 A;  4ZUX U;  3RPG B;  1LDK C;  1WIL A;  4R2Y A;  3C5K A;  3KQI A;  2YHN A;  3ZTG A;  4B86 C;  4GNE A;  4WZ2 A;  5H1V A;  2RI7 A;  4FJC A;  2LGK A;  2YRE A;  1WE9 A;  1N87 A;  5DIN A;  5TRB A;  2KFT A;  1WIM A;  3O33 A;  4PTB A;  5TBN A;  2G6Q A;  1WEP A;  2YUC A;  4W4U A;  4AP4 A;  2H0D B;  3T7L A;  3KV6 A;  2EA6 A;  2Y43 A;  3LQI A;  1X4I A;  1XWH A;  3U5N A;  3EB6 A;  1JM7 B;  4WZ0 A;  3QZV A;  3PHD A;  2JMI A;  2VNF A;  2ECW A;  2JRJ A;  4F52 B;  4ZQL A;  2CSY A;  4N3W A;  1WEW A;  2K17 A;  1MM3 A;  4GND A;  1VFY A;  5H9M A;  5H1U A;  2CSZ A;  1IYM A;  4L7X A;  5JG6 A;  2UZG A;  3NG2 A;  4B7Y C;  3PUR A;  1WGM A;  4YBS A;  2AN6 A;  5C13 A;  2YHO A;  5G0F A;  4LLB A;  3HTK C;  2H0D A;  4YBM A;  5FER A;  5LKT A;  3M62 A;  2YQL A;  2ECJ A;  2YW8 A;  4PPE A;  4QF3 A;  2YQM A;  4CA1 A;  1JOC A;  2JMJ A;  2XEU A;  4X3G A;  4GB0 A;  1JM7 A;  5TDR A;  4UP5 A;  4A4B A;  5B76 A;  1LDJ B;  5KH3 A;  2L80 A;  3SOX A;  2VPB A;  4S3O C;  1WES A;  2KYU A;  2MA6 A;  2YU4 A;  3SHB A;  3DPL R;  2Y1N A;  4BHW A;  5G05 B;  2HYE D;  2NAA A;  2MT5 A;  2LN0 A;  4WA6 A;  5D1L B;  1MM2 A;  4ZDT A;  2EOD A;  3I2D A;  2XB1 A;  5B77 A;  1FP0 A;  2L5U A;  1HYJ A;  2FUI A;  4YAD A;  2RSD A;  1WEU A;  5LCW B;  2ECG A;  2VPE A;  2C2V S;  2LV9 A;  1BOR A;  2ZET C;  4I7C A;  3M99 A;  5LKZ A;  2KRE A;  2C2L A;  4TKP B;  1WEN A;  4UI9 B;  1WFK A;  1Z2Q A;  2G43 A;  2L0B A;  3HCU A;  2ECN A;  3HCS A;  3ZPV 1;  2KWK A;  4FO9 A;  2M1R A;  2G45 A;  4A0C D;  2LXH C;  2M6M A;  2QJ0 A;  2QIC A;  5G04 B;  3N9Q A;  3ASL A;  3LQJ A;  4YAT A;  2CT2 A;  2DX8 A;  1F62 A;  2YSJ A;  5EYA F;  2MD8 C;  5DKA A;  2QIZ A;  2CKL B;  5FB1 A;  1T1H A;  3ZVY A;  3EB5 A;  4IC2 A;  2MNZ A;  2F6N A;  2FSA A;  2OXQ C;  3DQV R;  2K16 A;  2ECV A;  2M85 A;  3N9L A;  2KGG A;  3SOU A;  2VP7 A;  4UP0 A;  5B79 A;  5FB0 A;  5B78 A;  3GL6 A;  2LXP C;  3RTR B;  4R8P K;  2BAY A;  2LGG A;  4I7D A;  3FL2 A;  1WEV A;  5I3L A;  2E6S A;  2IDA A;  5LKU A;  5B75 A;  2MIQ A;  4YBT A;  4V3K C;  3O36 A;  4N4F A;  4LKA A;  2YSM A;  3VK6 A;  2EGP A;  2K1J A;  1ZBD B;  2KWO A;  4AYC B;  3LRQ A;  3ZVZ B;  5TAB A;  5FEY A;  1E4U A;  4GNF A;  2LQ6 A;  2PNX A;  5D1K B;  1U6G B;  1VD4 A;  2LGV A;  2CKL A;  3PUQ A;  3KNV A;  1WEM A;  1VYX A;  4Q6F A;  4FIP A;  3IHP A;  3O37 A;  2KIZ A;  2VPD A;  2JMD A;  1Z60 A;  3N9P A;  2M3H A;  2MA5 A;  2KE1 A;  2VPG A;  1K2F A;  2Y1M A;  2VJF B;  2ECT A;  1WEE A;  2HDP A;  2LGL A;  4O64 A;  5AIT A;  2ECI A;  3ZNI A;  4GNG A;  4V3L C;  1G25 A;  4LAD B;  3L1X A;  2KWN A;  3C6W A;  4NN2 A;  5B8D A;  4S3O B;  3T6R A;  4BBQ A;  3N9N A;  4AYC A;  3L1Z B;  1X4J A;  4AVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...